HHsearch results for GI: 254780444 and protein with PDBid: 1y7y_A

>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3
Probab=98.87  E-value=6.4e-09  Score=76.43  Aligned_cols=61  Identities=21%  Similarity=0.178  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      +|+++|+.+|+++|+||.+||+++|++++++++|++|..     .|+.+.+.++++++++++++|.
T Consensus        13 ~ig~~ik~~R~~~gltq~~lA~~~gis~~~i~~~E~g~~-----~p~~~~l~~ia~~l~v~~~~lF   73 (74)
T 1y7y_A           13 KFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQR-----NVSLVNILKLATALDIEPRELF   73 (74)
T ss_dssp             HHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCS-----CCBHHHHHHHHHHTTSCGGGGC
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHC
T ss_conf             999999999998199999999896979999999987998-----9999999999999893999984