HHsearch results for GI: 254780444 and protein with PDBid: 2fbq_A

>2fbq_A Probable transcriptional regulator; PA3006, APC5893, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1
Probab=93.35  E-value=0.19  Score=28.03  Aligned_cols=40  Identities=15%  Similarity=0.218  Sum_probs=33.9

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -|+++|+++=-+|..+.|+   |-.++|+++|++++++.++..
T Consensus         7 ~trerIl~AA~~l~~~~G~~~~t~~~IA~~aGvs~~~lY~yF~   49 (235)
T 2fbq_A            7 ETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFG   49 (235)
T ss_dssp             HHHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999998590407799999997939889999859