HHsearch results for GI: 254780444 and protein with PDBid: 2hyt_A

>2hyt_A TETR-family transcriptional regulator; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.64A {Pectobacterium atrosepticum}
Probab=91.22  E-value=0.52  Score=25.19  Aligned_cols=39  Identities=8%  Similarity=0.118  Sum_probs=30.5

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |+++|.++--+|..+.|   +|-.++|+.+|++++|+.++..
T Consensus        13 tR~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~yF~   54 (197)
T 2hyt_A           13 TRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFG   54 (197)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCTTHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHCCC
T ss_conf             999999999999998691518799999983859240655089