HHsearch results for GI: 254780444 and protein with PDBid: 2np5_A

>2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=90.38  E-value=0.37  Score=26.12  Aligned_cols=40  Identities=20%  Similarity=0.236  Sum_probs=32.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .-|.++|.++--+|..++|+   |-.++|+.+|++++++.++.
T Consensus         8 ~~~re~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   50 (203)
T 2np5_A            8 STSPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHF   50 (203)
T ss_dssp             -CHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             2899999999999999729030779999999790988770106