HHsearch results for GI: 254780444 and protein with PDBid: 2q24_A

>2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3}
Probab=90.98  E-value=0.69  Score=24.39  Aligned_cols=38  Identities=24%  Similarity=0.325  Sum_probs=31.4

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--++..++|+  |-.++|+.+|++++||.++.
T Consensus        16 ~R~~Il~aa~~l~~~~G~~~T~~~IA~~agvs~~tiY~~F   55 (194)
T 2q24_A           16 NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNF   55 (194)
T ss_dssp             CHHHHHHHHHHHHHHHCTTCCHHHHHHHTTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999986966769999998398874698876