HHsearch results for GI: 254780444 and protein with PDBid: 2wiu_B

>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B*
Probab=98.91  E-value=3.7e-09  Score=77.93  Aligned_cols=68  Identities=18%  Similarity=0.219  Sum_probs=60.4

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             5589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .+..+|+.+|+.+|+++||||.+||+++|+++++|++|++|..     .|+.+.|.++|++++++++++....
T Consensus         8 ~~~~~lg~~lr~~R~~~glsq~~lA~~~gvs~~~is~~E~g~~-----~ps~~~l~~ia~~lgv~~~~~~~~~   75 (88)
T 2wiu_B            8 YSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPD-----NTTLTTFFKILQSLELSMTLCDAKN   75 (88)
T ss_dssp             CSHHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHHCGG-----GCBHHHHHHHHHHTTCEEEEEC---
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCEEEEECCC
T ss_conf             8999999999999998599999997863998999999987999-----9999999999999699408645799