HHsearch results for GI: 254780444 and protein with PDBid: 3bs3_A

>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis nctc 9343}
Probab=98.88  E-value=1.2e-09  Score=81.18  Aligned_cols=66  Identities=17%  Similarity=0.155  Sum_probs=58.5

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             99999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      +.++.+|+.+|+++|+||.+||+++|++++++++|++|...     |+.+.+.++|++++++++||+....
T Consensus         9 ~~i~~rik~~r~~~gltq~~lA~~~gvs~~tis~~e~g~~~-----p~~~~l~~ia~~l~v~~~~ll~~~~   74 (76)
T 3bs3_A            9 QMMLNRIKVVLAEKQRTNRWLAEQMGKSENTISRWCSNKSQ-----PSLDMLVKVAELLNVDPRQLINGKI   74 (76)
T ss_dssp             -CCCBCHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTSCGGGGBC---
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             99999999999990998999999988899999999859999-----9999999999997997999966887