HHsearch results for GI: 254780444 and protein with PDBid: 3fiw_A

>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structural genomics, PSI-2; 2.20A {Streptomyces coelicolor}
Probab=93.70  E-value=0.098  Score=29.88  Aligned_cols=42  Identities=14%  Similarity=0.227  Sum_probs=34.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             977558999999999999649---998899998289987988997
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.+++++|+.+=-++..+.|   +|-.++|+++|++++++.++.
T Consensus        22 ~~~~~R~~IL~AA~~lf~e~G~~~~T~~~IA~~aGvs~~tlY~~F   66 (211)
T 3fiw_A           22 MTKMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYF   66 (211)
T ss_dssp             --CCCHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCTHHHHTTC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             258799999999999999749453759999999892885898988