HHsearch results for GI: 254780444 and protein with PDBid: 3fym_A

>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp}
Probab=97.84  E-value=2.7e-05  Score=52.91  Aligned_cols=71  Identities=18%  Similarity=0.124  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557-79899999873218752100001111
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~-p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      .|++.|+++|+++|+|+.++|++++++.++++.+|++.-+.-|.. ....-+.++|++++++.+++......
T Consensus         3 tiG~~Lr~~R~~~glSi~eva~~l~I~~~~l~aiE~g~~~~lp~~~~~~g~lr~ya~~L~ld~~~ll~~~~~   74 (130)
T 3fym_A            3 TVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQD   74 (130)
T ss_dssp             CHHHHHHHHHHHTTCCHHHHHHHHCCCHHHHHHHHTTCGGGSSSGGGHHHHHHHHHHHTTCCHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             799999999999699999999997514999999984885456770899999999999939599999999988