HHsearch results for GI: 254780444 and protein with PDBid: 3g7d_A

>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A
Probab=98.93  E-value=2.1e-08  Score=73.10  Aligned_cols=65  Identities=17%  Similarity=0.079  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      .+.|+..++++|+|..+||+++|++.+++++++|+..    ..|++.+|.|||+++++++.+|......
T Consensus       232 ~slLk~~rk~RGLTL~eLAkrTGIS~S~LSqIERngk----s~PSl~tL~KIA~AL~V~lsdLf~~~~~  296 (443)
T 3g7d_A          232 GSVLDLFLARRAHTRTSAAEAAGVPPADLEAALRSPA----SETGLTVLRTLGRALGFDYRVLLPADDQ  296 (443)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHHCTT----SHHHHHHHHHHHHHHTCCGGGGSCCCCC
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCC----CCCCHHHHHHHHHHCCCCHHHHCCCCCC
T ss_conf             8999999997188899999886989999999985688----8988999999999729999997488776