HHsearch results for GI: 254780444 and protein with PDBid: 3jsj_A

>3jsj_A Putative TETR-family transcriptional regulator; NP_821317.1, putative transcriptional regulator, structural genomics; 2.10A {Streptomyces avermitilis ma-4680}
Probab=92.08  E-value=0.4  Score=25.90  Aligned_cols=38  Identities=18%  Similarity=0.290  Sum_probs=32.5

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-.++..++|+  |-.++|+++|++++++.++.
T Consensus        10 ~R~~il~aa~~l~~~~G~~~t~~~IA~~agvs~~tlY~~F   49 (190)
T 3jsj_A           10 PRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLF   49 (190)
T ss_dssp             HHHHHHHHHHHHHHHHCTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999976978879999999790999996774