HHsearch results for GI: 254780444 and protein with PDBid: 3kxa_A

>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae}
Probab=98.78  E-value=4.5e-09  Score=77.44  Aligned_cols=67  Identities=16%  Similarity=0.083  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      +.++++|.+||+++||||.+||+++|++++++++|++|...     |+.+.+.++++++++++++|....+.
T Consensus        67 ~~~G~~l~~lR~~~glTQ~elA~~~gis~~~is~iE~G~~~-----ps~~~l~kia~~lgvs~~el~~~~e~  133 (141)
T 3kxa_A           67 KAGGETFVSLRMKKGFTQSELATAAGLPQPYLSRIENSKQS-----LQDKTVQKLANALGVSPLEVRAAFER  133 (141)
T ss_dssp             HHSSCCHHHHHHHTTCCHHHHHHHTTCCHHHHHHHHHTCSC-----CCHHHHHHHHHHHTCCHHHHHHHHGG
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999999999982998999999989699999999879978-----99999999999949989999865540