HHsearch results for GI: 254780444 and protein with PDBid: 3mky_B

>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A*
Probab=92.94  E-value=0.2  Score=27.86  Aligned_cols=39  Identities=10%  Similarity=-0.013  Sum_probs=29.7

Q ss_pred             CHHHHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             589999999999996-499988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~-~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |--+.+.+-++|+.+ .|.||.+||+++|+|+++|+++.+
T Consensus        25 S~~E~a~~y~rlL~~~~~~tq~eLA~~lG~Srs~VS~~L~   64 (189)
T 3mky_B           25 SAYERGQRYASRLQNEFAGNISALADAENISRKIITRCIN   64 (189)
T ss_dssp             CHHHHHHHHHHHHHTTTTTCHHHHHHHHTSCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999999999864388899999997979999999998