HHsearch results for GI: 254780444 and protein with PDBid: 3o9x_A

>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B*
Probab=98.21  E-value=1.4e-06  Score=61.25  Aligned_cols=59  Identities=19%  Similarity=0.247  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             99999999964999889999828998798899751578875577989999987321875210
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~   71 (223)
                      .+.|+++|+++||||.+||+++|++.+|+++|++|...  |. .....|.++++..+..+.+
T Consensus        73 ~e~ir~~R~~~glsQ~elA~~lg~~~~ti~~~E~G~~~--p~-~~~~~l~~~l~~~p~~l~e  131 (133)
T 3o9x_A           73 PEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQ--PH-PSTIKLLRVLDKHPELLNE  131 (133)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHCSCTTHHHHHHHTSSC--CC-HHHHHHHHHHHHCGGGHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC--CC-HHHHHHHHHHCCCCHHHHH
T ss_conf             99999999984999999999959999999999869988--99-9999999998438547897