Query         gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 223
No_of_seqs    143 out of 2241
Neff          9.8 
Searched_HMMs 23785
Date          Mon May 30 11:44:04 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780444.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3bdn_A Lambda repressor; repre 100.0 1.6E-31 6.9E-36  222.7  12.4  203    1-220     4-227 (236)
  2 1jhf_A LEXA repressor; LEXA SO  99.9 1.4E-25   6E-30  184.3  20.3  187    1-221     1-195 (202)
  3 2fjr_A Repressor protein CI; g  99.9 6.7E-27 2.8E-31  192.9  12.5  181    4-223     5-186 (189)
  4 3k2z_A LEXA repressor; winged   99.9   1E-23 4.3E-28  172.3  22.4  185    4-221     3-192 (196)
  5 2hnf_A Repressor protein CI101  99.8 6.3E-20 2.7E-24  147.7  14.5  125   86-223     3-133 (133)
  6 1kca_A Repressor protein CI; g  99.8 1.1E-18 4.8E-23  139.6  12.2   87  133-221     9-101 (109)
  7 1umu_A UMUD'; induced mutagene  99.7 1.4E-16 6.1E-21  125.9  10.4   87  133-222    23-111 (116)
  8 1y9q_A Transcriptional regulat  99.3 5.8E-11 2.4E-15   89.7  13.5   67    6-77      9-75  (192)
  9 2bnm_A Epoxidase; oxidoreducta  99.3 2.6E-10 1.1E-14   85.5  16.2   74    1-78      1-76  (198)
 10 2ewt_A BLDD, putative DNA-bind  99.1 3.6E-10 1.5E-14   84.6   8.0   68    1-73      1-70  (71)
 11 3op9_A PLI0006 protein; struct  99.1 1.5E-10 6.4E-15   86.9   5.9   69    5-78      6-74  (114)
 12 3b7h_A Prophage LP1 protein 11  99.0 1.4E-09 5.7E-14   80.8   8.2   67    6-76      5-71  (78)
 13 2ict_A Antitoxin HIGA; helix-t  99.0 5.2E-10 2.2E-14   83.5   5.8   71    1-76      1-71  (94)
 14 1b0n_A Protein (SINR protein);  99.0 7.8E-10 3.3E-14   82.3   6.6   65    9-77      2-66  (111)
 15 3ivp_A Putative transposon-rel  99.0 1.6E-09 6.6E-14   80.4   8.1   67    6-77     10-76  (126)
 16 3f52_A CLP gene regulator (CLG  98.9 1.2E-09 5.1E-14   81.1   6.6   67    6-77     26-92  (117)
 17 2kpj_A SOS-response transcript  98.9 2.1E-09 8.8E-14   79.6   7.7   64    8-76      9-72  (94)
 18 1adr_A P22 C2 repressor; trans  98.9 1.2E-09   5E-14   81.1   6.0   68    6-78      3-70  (76)
 19 3g7d_A PHPD; non heme Fe(II) d  98.9 2.1E-08 8.8E-13   73.1  12.3   65   10-78    232-296 (443)
 20 3omt_A Uncharacterized protein  98.9   4E-10 1.7E-14   84.2   3.3   68    4-76      4-71  (73)
 21 3g5g_A Regulatory protein; tra  98.9 2.4E-09   1E-13   79.2   7.1   70    2-76     22-91  (99)
 22 2wiu_B HTH-type transcriptiona  98.9 3.7E-09 1.6E-13   77.9   8.0   68    4-76      8-75  (88)
 23 2b5a_A C.BCLI; helix-turn-heli  98.9 2.5E-09   1E-13   79.1   6.9   67    6-77      8-74  (77)
 24 3mlf_A Transcriptional regulat  98.9 9.6E-10   4E-14   81.8   4.8   63    9-76     24-86  (111)
 25 1zug_A Phage 434 CRO protein;   98.9 1.9E-09   8E-14   79.8   5.8   65    9-79      4-68  (71)
 26 3bs3_A Putative DNA-binding pr  98.9 1.2E-09   5E-14   81.2   4.4   66    7-77      9-74  (76)
 27 1y7y_A C.AHDI; helix-turn-heli  98.9 6.4E-09 2.7E-13   76.4   8.0   61    8-73     13-73  (74)
 28 3f6w_A XRE-family like protein  98.9 4.1E-09 1.7E-13   77.7   7.0   69    6-79     12-80  (83)
 29 2jvl_A TRMBF1; coactivator, he  98.9   6E-09 2.5E-13   76.6   7.6   68    6-78     32-101 (107)
 30 2r1j_L Repressor protein C2; p  98.9 3.9E-09 1.7E-13   77.8   6.6   64    7-75      4-67  (68)
 31 3clc_A Regulatory protein; pro  98.9 4.7E-09   2E-13   77.3   6.9   72    1-77      4-75  (82)
 32 1x57_A Endothelial differentia  98.8 1.5E-08 6.1E-13   74.1   8.7   63    8-75     13-75  (91)
 33 1r69_A Repressor protein CI; g  98.8 3.5E-09 1.5E-13   78.1   5.4   65    9-79      2-66  (69)
 34 2l49_A C protein; P2 bacteriop  98.8 8.3E-09 3.5E-13   75.7   7.2   64    8-76      4-69  (99)
 35 3kz3_A Repressor protein CI; f  98.8 1.5E-08 6.3E-13   74.0   8.3   68    3-75      1-74  (80)
 36 2p5t_A Putative transcriptiona  98.8 4.6E-10 1.9E-14   83.8   0.0   64    9-77      2-65  (158)
 37 3kxa_A NGO0477 protein, putati  98.8 4.5E-09 1.9E-13   77.4   4.6   67    7-78     67-133 (141)
 38 2a6c_A Helix-turn-helix motif;  98.8 1.7E-08   7E-13   73.7   7.5   67    3-73     13-79  (83)
 39 1utx_A CYLR2; DNA-binding prot  98.8   1E-08 4.2E-13   75.1   6.1   61   11-76      4-64  (66)
 40 1lmb_3 Protein (lambda repress  98.8 2.6E-08 1.1E-12   72.4   7.8   64    7-75     16-79  (92)
 41 2ef8_A C.ECOT38IS, putative tr  98.7 2.4E-08   1E-12   72.7   6.2   64    6-74      8-71  (84)
 42 3cec_A Putative antidote prote  98.7 3.6E-08 1.5E-12   71.6   6.4   63    9-76     19-81  (104)
 43 3eus_A DNA-binding protein; st  98.6 8.2E-08 3.5E-12   69.2   7.7   58    6-68     12-69  (86)
 44 2ofy_A Putative XRE-family tra  98.6 8.1E-08 3.4E-12   69.3   7.3   66    7-78     15-80  (86)
 45 3fmy_A HTH-type transcriptiona  98.5 5.3E-08 2.2E-12   70.5   3.3   67    1-73      3-70  (73)
 46 2awi_A PRGX; repressor, pherom  98.3 6.6E-07 2.8E-11   63.4   6.0   65    8-78      3-67  (317)
 47 2o38_A Hypothetical protein; a  98.3 2.9E-06 1.2E-10   59.2   7.6   64    7-74     39-102 (120)
 48 3o9x_A Uncharacterized HTH-typ  98.2 1.4E-06 5.9E-11   61.2   5.1   59   10-71     73-131 (133)
 49 2eby_A Putative HTH-type trans  98.2 6.6E-07 2.8E-11   63.4   3.1   64    9-77     11-75  (113)
 50 2qfc_A PLCR protein; TPR, HTH,  98.2   1E-06 4.4E-11   62.1   3.6   67    5-77      2-68  (293)
 51 2wus_R RODZ, putative uncharac  98.2 3.6E-06 1.5E-10   58.6   6.2   72    6-77      5-77  (112)
 52 2ppx_A AGR_C_3184P, uncharacte  98.0 6.3E-06 2.6E-10   57.0   5.3   57   11-73     33-89  (99)
 53 3fym_A Putative uncharacterize  97.8 2.7E-05 1.1E-09   52.9   6.0   71    8-78      3-74  (130)
 54 1b12_A Signal peptidase I; ser  97.6 0.00017 7.2E-09   47.7   7.4   58  139-196     8-83  (248)
 55 2auw_A Hypothetical protein NE  97.6 0.00012   5E-09   48.8   6.2   36   11-46     93-128 (170)
 56 3bd1_A CRO protein; transcript  97.2  0.0005 2.1E-08   44.7   5.3   58   11-75      2-61  (79)
 57 1dw9_A Cyanate lyase; cyanate   97.0  0.0013 5.4E-08   42.1   6.1   70    2-76      7-76  (156)
 58 1neq_A DNA-binding protein NER  96.1  0.0075 3.2E-07   37.1   5.1   54   12-73     13-66  (74)
 59 3nnr_A Transcriptional regulat  95.6   0.027 1.2E-06   33.5   6.3   42    1-42      2-46  (228)
 60 1hlv_A CENP-B, major centromer  95.1    0.11 4.6E-06   29.6   8.0   43    2-44      6-48  (131)
 61 1jko_C HIN recombinase, DNA-in  95.0   0.025   1E-06   33.7   4.5   41    2-44      4-44  (52)
 62 1zx4_A P1 PARB, plasmid partit  95.0   0.041 1.7E-06   32.3   5.5   40    5-45      9-48  (192)
 63 2vke_A Tetracycline repressor   94.9   0.076 3.2E-06   30.6   6.7   41    2-42      1-44  (207)
 64 2yve_A Transcriptional regulat  94.9   0.094 3.9E-06   30.0   7.1   42    1-42      1-45  (185)
 65 2elh_A CG11849-PA, LD40883P; s  94.8   0.054 2.3E-06   31.6   5.7   40    3-44     22-61  (87)
 66 2w48_A Sorbitol operon regulat  94.7   0.056 2.4E-06   31.4   5.6   43    1-43      1-43  (315)
 67 2opt_A Actii protein; helical   94.6    0.13 5.4E-06   29.1   7.2   43    1-43      3-48  (234)
 68 1r71_A Transcriptional repress  94.3   0.082 3.5E-06   30.4   5.8   41    3-44     35-75  (178)
 69 2vpr_A Tetracycline resistance  94.2   0.045 1.9E-06   32.1   4.2   42    1-42      1-45  (207)
 70 3cta_A Riboflavin kinase; stru  93.8   0.081 3.4E-06   30.4   4.9   41    1-41      1-47  (230)
 71 3fiw_A Putative TETR-family tr  93.7   0.098 4.1E-06   29.9   5.2   42    1-42     22-66  (211)
 72 1j5y_A Transcriptional regulat  93.7   0.052 2.2E-06   31.7   3.7   41    1-41     15-56  (187)
 73 2eh3_A Transcriptional regulat  93.4    0.12 4.9E-06   29.4   5.2   40    3-42      1-43  (179)
 74 2fbq_A Probable transcriptiona  93.3    0.19   8E-06   28.0   6.2   40    4-43      7-49  (235)
 75 3frq_A Repressor protein MPHR(  93.3    0.25   1E-05   27.3   6.7   42    2-43      6-50  (195)
 76 3dpj_A Transcription regulator  93.0    0.17 7.2E-06   28.3   5.5   41    2-42      6-49  (194)
 77 1on2_A Transcriptional regulat  93.0    0.15 6.3E-06   28.7   5.2   41    1-41      1-42  (142)
 78 3mky_B Protein SOPB; partition  92.9     0.2 8.5E-06   27.9   5.8   39    5-43     25-64  (189)
 79 2id3_A Putative transcriptiona  92.8    0.25   1E-05   27.3   6.1   40    4-43     40-82  (225)
 80 3bqy_A Putative TETR family tr  92.8    0.16 6.7E-06   28.5   5.1   40    4-43      2-44  (209)
 81 2g7l_A TETR-family transcripti  92.7     0.2 8.5E-06   27.8   5.6   40    3-42     18-60  (243)
 82 3o60_A LIN0861 protein; PSI, M  92.7    0.14 5.9E-06   28.9   4.7   40    4-43     19-62  (185)
 83 2o7t_A Transcriptional regulat  92.7     0.3 1.2E-05   26.8   6.3   39    4-42      8-49  (199)
 84 1uxc_A FRUR (1-57), fructose r  92.4    0.17 7.3E-06   28.3   4.9   50   22-71      1-51  (65)
 85 2d6y_A Putative TETR family re  92.4    0.33 1.4E-05   26.5   6.3   39    4-42      8-49  (202)
 86 3kjx_A Transcriptional regulat  92.4    0.18 7.6E-06   28.2   4.9   48   18-70      7-57  (344)
 87 1u78_A TC3 transposase, transp  92.3    0.34 1.4E-05   26.4   6.3   39    4-44      7-45  (141)
 88 3jsj_A Putative TETR-family tr  92.1     0.4 1.7E-05   25.9   6.4   38    5-42     10-49  (190)
 89 1zs4_A Regulatory protein CII;  92.0    0.38 1.6E-05   26.1   6.3   39   23-70     26-64  (83)
 90 3gzi_A Transcriptional regulat  92.0    0.44 1.8E-05   25.7   6.5   39    5-43     18-59  (218)
 91 2hxi_A Putative transcriptiona  92.0    0.39 1.6E-05   26.0   6.3   40    3-42     28-70  (241)
 92 2qwt_A Transcriptional regulat  91.7     0.5 2.1E-05   25.3   6.6   39    4-42     13-53  (196)
 93 2guh_A Putative TETR-family tr  91.7    0.54 2.3E-05   25.1   6.7   40    4-43     39-81  (214)
 94 2jn6_A Protein CGL2762, transp  91.7    0.23 9.6E-06   27.5   4.8   35   10-44     12-46  (97)
 95 1zk8_A Transcriptional regulat  91.6     0.3 1.2E-05   26.8   5.3   40    3-42      7-49  (183)
 96 2dg8_A Putative TETR-family tr  91.5    0.43 1.8E-05   25.7   6.1   38    5-42     10-50  (193)
 97 2wui_A MEXZ, transcriptional r  91.5    0.31 1.3E-05   26.6   5.3   38    5-42     12-52  (210)
 98 1t33_A Putative transcriptiona  91.5    0.44 1.9E-05   25.7   6.1   38    5-42     13-52  (224)
 99 3g7r_A Putative transcriptiona  91.3    0.52 2.2E-05   25.2   6.3   38    5-42     36-76  (221)
100 3lhq_A Acrab operon repressor   91.3    0.53 2.2E-05   25.1   6.3   38    5-42     15-55  (220)
101 2iu5_A DHAS, hypothetical prot  91.3    0.13 5.3E-06   29.2   3.1   40    3-42     12-54  (195)
102 2fq4_A Transcriptional regulat  91.2    0.55 2.3E-05   25.0   6.4   38    5-42     13-53  (192)
103 2hyt_A TETR-family transcripti  91.2    0.52 2.2E-05   25.2   6.2   39    5-43     13-54  (197)
104 3kz9_A SMCR; transcriptional r  91.1    0.65 2.7E-05   24.6   6.6   37    6-42     19-58  (206)
105 1ui5_A A-factor receptor homol  91.0    0.33 1.4E-05   26.4   5.1   40    4-43      9-51  (215)
106 2q24_A Putative TETR family tr  91.0    0.69 2.9E-05   24.4   6.7   38    5-42     16-55  (194)
107 3bjb_A Probable transcriptiona  90.8    0.74 3.1E-05   24.2   6.7   38    5-42     23-63  (207)
108 3on4_A Transcriptional regulat  90.8    0.56 2.4E-05   25.0   6.1   39    4-42     10-51  (191)
109 3bni_A Putative TETR-family tr  90.7    0.66 2.8E-05   24.5   6.4   38    5-42     44-84  (229)
110 2hxo_A Putative TETR-family tr  90.6     0.4 1.7E-05   25.9   5.2   40    3-42     15-57  (237)
111 3bru_A Regulatory protein, TET  90.6    0.45 1.9E-05   25.6   5.4   40    3-42     29-71  (222)
112 1umq_A Photosynthetic apparatu  90.6    0.57 2.4E-05   24.9   5.9   39    4-42     36-75  (81)
113 2gen_A Probable transcriptiona  90.5    0.87 3.7E-05   23.7   6.9   38    5-42      8-48  (197)
114 2f07_A YVDT; helix-turn-helix,  90.5    0.45 1.9E-05   25.6   5.4   39    5-43     11-52  (197)
115 3bqz_B HTH-type transcriptiona  90.5    0.67 2.8E-05   24.5   6.2   38    5-42      3-43  (194)
116 1vi0_A Transcriptional regulat  90.4    0.62 2.6E-05   24.7   6.0   38    5-42      9-49  (206)
117 2nx4_A Transcriptional regulat  90.4    0.73 3.1E-05   24.2   6.4   38    5-42     11-51  (194)
118 2np5_A Transcriptional regulat  90.4    0.37 1.6E-05   26.1   4.9   40    3-42      8-50  (203)
119 2zcx_A SCO7815, TETR-family tr  90.4    0.71   3E-05   24.3   6.3   38    5-42     24-64  (231)
120 1z05_A Transcriptional regulat  90.4    0.42 1.7E-05   25.8   5.1   31   12-42     44-74  (429)
121 1rzs_A Antirepressor, regulato  90.3    0.16 6.8E-06   28.5   3.0   44   17-69      7-50  (61)
122 3cwr_A Transcriptional regulat  90.3    0.66 2.8E-05   24.5   6.1   38    5-42     18-58  (208)
123 1z6r_A MLC protein; transcript  90.3    0.29 1.2E-05   26.9   4.2   32   10-41     19-50  (406)
124 3mvp_A TETR/ACRR transcription  90.2    0.37 1.5E-05   26.2   4.7   38    5-42     27-67  (217)
125 3dew_A Transcriptional regulat  90.2    0.38 1.6E-05   26.1   4.8   39    4-42      8-49  (206)
126 2wte_A CSA3; antiviral protein  90.2     0.4 1.7E-05   25.9   4.9   38    3-41    149-186 (244)
127 2x4h_A Hypothetical protein SS  90.0    0.45 1.9E-05   25.6   5.1   41    1-41      8-51  (139)
128 2rek_A Putative TETR-family tr  90.0    0.61 2.6E-05   24.7   5.7   38    5-42     17-56  (199)
129 3ni7_A Bacterial regulatory pr  90.0     0.9 3.8E-05   23.6   6.6   38    5-42      8-48  (213)
130 2hsg_A Glucose-resistance amyl  90.0    0.48   2E-05   25.4   5.2   44   21-69      2-48  (332)
131 3bhq_A Transcriptional regulat  90.0    0.97 4.1E-05   23.4   6.7   38    5-42     13-53  (211)
132 3b81_A Transcriptional regulat  89.9    0.53 2.2E-05   25.2   5.3   38    5-42     12-52  (203)
133 1pb6_A Hypothetical transcript  89.9    0.84 3.5E-05   23.8   6.3   38    5-42     19-59  (212)
134 3knw_A Putative transcriptiona  89.9    0.47   2E-05   25.4   5.1   38    5-42     15-55  (212)
135 2dg7_A Putative transcriptiona  89.9    0.48   2E-05   25.4   5.1   41    3-43      6-49  (195)
136 3c07_A Putative TETR-family tr  89.7    0.98 4.1E-05   23.4   6.6   39    4-42     41-82  (273)
137 1sgm_A Putative HTH-type trans  89.7    0.29 1.2E-05   26.8   3.9   43    1-43      1-48  (191)
138 1t56_A EThr repressor; helix-t  89.6     0.6 2.5E-05   24.8   5.4   38    5-42     25-65  (216)
139 3c2b_A Transcriptional regulat  89.6    0.97 4.1E-05   23.4   6.5   39    5-43     16-57  (221)
140 3lwj_A Putative TETR-family tr  89.5    0.53 2.2E-05   25.2   5.0   38    5-42     13-53  (202)
141 3hta_A EBRA repressor; TETR fa  89.5    0.83 3.5E-05   23.9   6.0   37    6-42     30-69  (217)
142 3f1b_A TETR-like transcription  89.4    0.53 2.2E-05   25.1   5.0   38    5-42     15-55  (203)
143 3e7q_A Transcriptional regulat  89.4    0.71   3E-05   24.3   5.7   38    5-42     15-55  (215)
144 2rae_A Transcriptional regulat  89.3    0.64 2.7E-05   24.6   5.3   41    3-43     16-59  (207)
145 2of7_A Putative TETR-family tr  89.3    0.55 2.3E-05   25.0   5.0   40    4-43     48-90  (260)
146 1fx7_A Iron-dependent represso  89.2       1 4.3E-05   23.3   6.4   41    1-41      1-44  (230)
147 2zcm_A Biofilm operon icaabcd   89.2    0.64 2.7E-05   24.6   5.3   37    6-42      9-48  (192)
148 2h8r_A Hepatocyte nuclear fact  89.2    0.84 3.5E-05   23.9   5.9   38    8-45     31-68  (221)
149 2i10_A Putative TETR transcrip  89.2     1.1 4.7E-05   23.0   6.5   41    3-43     10-53  (202)
150 3h5t_A Transcriptional regulat  89.2     0.4 1.7E-05   25.9   4.2   45   18-67      6-53  (366)
151 3he0_A Transcriptional regulat  89.1    0.43 1.8E-05   25.7   4.3   39    4-42     11-52  (196)
152 2pz9_A Putative regulatory pro  89.1    0.36 1.5E-05   26.3   3.9   40    3-42     29-71  (226)
153 3egq_A TETR family transcripti  89.0    0.43 1.8E-05   25.7   4.3   38    5-42      5-45  (170)
154 3crj_A Transcription regulator  89.0    0.37 1.6E-05   26.1   4.0   38    5-42     15-55  (199)
155 1z0x_A Transcriptional regulat  88.9    0.48   2E-05   25.4   4.5   40    3-42      4-47  (220)
156 2g7g_A RHA04620, putative tran  88.9    0.51 2.2E-05   25.2   4.7   40    3-42     10-50  (213)
157 3cjd_A Transcriptional regulat  88.9    0.53 2.2E-05   25.1   4.7   38    5-42     13-53  (198)
158 3bpv_A Transcriptional regulat  88.9    0.65 2.7E-05   24.6   5.1   37    4-41     27-63  (138)
159 2oi8_A Putative regulatory pro  88.8    0.72   3E-05   24.3   5.3   39    4-42     16-57  (216)
160 2zb9_A Putative transcriptiona  88.8    0.56 2.4E-05   25.0   4.8   38    5-42     24-64  (214)
161 3f0c_A TETR-molecule A, transc  88.7    0.65 2.7E-05   24.6   5.1   38    5-42     12-52  (216)
162 2qib_A TETR-family transcripti  88.7    0.74 3.1E-05   24.2   5.3   38    5-42     14-54  (231)
163 2jj7_A Hemolysin II regulatory  88.7    0.34 1.4E-05   26.4   3.6   39    5-43      8-49  (186)
164 3col_A Putative transcription   88.6    0.64 2.7E-05   24.6   5.0   38    5-42     11-51  (196)
165 3pas_A TETR family transcripti  88.6    0.87 3.6E-05   23.8   5.6   38    5-42      9-49  (195)
166 3cdl_A Transcriptional regulat  88.5    0.42 1.8E-05   25.8   4.0   38    5-42     10-50  (203)
167 1rkt_A Protein YFIR; transcrip  88.5    0.77 3.2E-05   24.1   5.3   38    5-42     13-53  (205)
168 2g3b_A Putative TETR-family tr  88.4     1.1 4.5E-05   23.2   6.0   39    5-43      4-45  (208)
169 2k27_A Paired box protein PAX-  88.4    0.65 2.7E-05   24.6   4.9   37    7-44     28-64  (159)
170 3dcf_A Transcriptional regulat  88.4    0.81 3.4E-05   23.9   5.4   38    5-42     32-72  (218)
171 3ljl_A Transcriptional regulat  88.4    0.43 1.8E-05   25.8   3.9   39    4-42     14-55  (156)
172 1vz0_A PARB, chromosome partit  88.3     1.1 4.6E-05   23.1   6.0   41    3-44    117-157 (230)
173 2xdn_A HTH-type transcriptiona  88.2    0.57 2.4E-05   24.9   4.5   38    5-42     12-52  (210)
174 2qtq_A Transcriptional regulat  88.2    0.75 3.1E-05   24.2   5.1   39    5-43     17-58  (213)
175 2v57_A TETR family transcripti  88.1     1.1 4.7E-05   23.1   6.0   39    4-42     14-53  (190)
176 3ccy_A Putative TETR-family tr  88.1     0.6 2.5E-05   24.8   4.6   38    5-42     15-55  (203)
177 2ras_A Transcriptional regulat  88.1    0.71   3E-05   24.3   4.9   37    6-42     13-52  (212)
178 1k78_A Paired box protein PAX5  88.0    0.92 3.8E-05   23.6   5.5   34    8-42     36-69  (149)
179 3g1l_A Transcriptional regulat  88.0    0.82 3.5E-05   23.9   5.2   38    5-42     45-85  (256)
180 3npi_A TETR family regulatory   87.8    0.57 2.4E-05   24.9   4.3   41    3-43     17-60  (251)
181 2oer_A Probable transcriptiona  87.8    0.81 3.4E-05   23.9   5.1   38    5-42     25-65  (214)
182 3kkc_A TETR family transcripti  87.6    0.31 1.3E-05   26.7   2.8   39    4-42     12-53  (177)
183 2w53_A Repressor, SMet; antibi  87.5     1.1 4.6E-05   23.1   5.6   38    5-42     12-52  (219)
184 2qko_A Possible transcriptiona  87.4    0.96   4E-05   23.5   5.2   38    5-42     29-69  (215)
185 2d5v_A Hepatocyte nuclear fact  87.3     1.5 6.1E-05   22.3   8.6   41    4-44      4-45  (164)
186 2fd5_A Transcriptional regulat  87.2    0.73 3.1E-05   24.2   4.5   39    4-42      7-48  (180)
187 2ibd_A Possible transcriptiona  87.2     0.9 3.8E-05   23.7   5.0   38    5-42     15-55  (204)
188 2g7s_A Transcriptional regulat  87.1    0.82 3.4E-05   23.9   4.8   39    4-42      8-49  (194)
189 2qq9_A Diphtheria toxin repres  87.1       1 4.3E-05   23.3   5.2   42    1-42      1-45  (226)
190 1qpz_A PURA, protein (purine n  87.1    0.98 4.1E-05   23.4   5.2   47   23-71      2-48  (340)
191 2id6_A Transcriptional regulat  86.8    0.97 4.1E-05   23.4   5.0   38    6-43      7-47  (202)
192 2gfn_A HTH-type transcriptiona  86.7    0.87 3.7E-05   23.7   4.7   38    6-43     11-51  (209)
193 2p5v_A Transcriptional regulat  86.7    0.64 2.7E-05   24.6   4.0   40    1-40      3-43  (162)
194 2pij_A Prophage PFL 6 CRO; tra  86.4    0.96   4E-05   23.5   4.8   32   13-45      6-37  (67)
195 2hyj_A Putative TETR-family tr  86.4    0.59 2.5E-05   24.8   3.7   39    4-42     12-53  (200)
196 3iwf_A Transcription regulator  86.1       1 4.2E-05   23.3   4.8   38    6-43     19-57  (107)
197 2l1p_A DNA-binding protein SAT  86.0     1.1 4.5E-05   23.1   4.9   44    4-49     17-60  (83)
198 2hoe_A N-acetylglucosamine kin  85.8    0.83 3.5E-05   23.9   4.3   29   13-42     26-54  (380)
199 3geu_A Intercellular adhesion   85.8    0.61 2.6E-05   24.7   3.6   39    4-42      3-44  (189)
200 2eth_A Transcriptional regulat  85.8    0.93 3.9E-05   23.6   4.5   32   10-41     47-78  (154)
201 3him_A Probable transcriptiona  85.7    0.31 1.3E-05   26.7   2.0   41    2-42     14-57  (211)
202 2zkz_A Transcriptional repress  85.7    0.62 2.6E-05   24.7   3.5   39    4-42     24-62  (99)
203 3cuo_A Uncharacterized HTH-typ  85.7    0.25 1.1E-05   27.2   1.5   40    3-42     20-59  (99)
204 3kkd_A Transcriptional regulat  85.2    0.86 3.6E-05   23.8   4.1   40    4-43     35-77  (237)
205 3nrv_A Putative transcriptiona  85.0       1 4.2E-05   23.4   4.3   37    4-41     38-74  (148)
206 2rdp_A Putative transcriptiona  85.0     1.3 5.4E-05   22.6   4.9   37    4-41     40-76  (150)
207 3a03_A T-cell leukemia homeobo  85.0     1.7 7.3E-05   21.8   5.6   44    1-44      1-47  (56)
208 2csf_A DNA-binding protein SAT  84.9     1.6 6.8E-05   22.0   5.4   65    6-70     19-85  (101)
209 2cyy_A Putative HTH-type trans  84.8    0.83 3.5E-05   23.9   3.8   31   10-40     10-40  (151)
210 2d1h_A ST1889, 109AA long hypo  84.7    0.86 3.6E-05   23.8   3.9   32   10-41     24-56  (109)
211 2gau_A Transcriptional regulat  84.2     2.1 8.7E-05   21.3   6.6   59    6-64    154-231 (232)
212 3bdd_A Regulatory protein MARR  84.1     1.2 5.2E-05   22.8   4.5   32   10-41     34-65  (142)
213 3hef_A Gene 1 protein; bacteri  84.1     1.3 5.6E-05   22.5   4.7   40    3-44     15-55  (143)
214 3on2_A Probable transcriptiona  84.1    0.67 2.8E-05   24.5   3.1   38    5-42     13-53  (199)
215 3cjn_A Transcriptional regulat  84.0    0.83 3.5E-05   23.9   3.6   32   10-41     55-86  (162)
216 3bil_A Probable LACI-family tr  83.6    0.18 7.4E-06   28.2   0.0   51   17-69      4-54  (348)
217 2hr3_A Probable transcriptiona  83.6     1.5 6.2E-05   22.2   4.7   32   10-41     38-70  (147)
218 3e7l_A Transcriptional regulat  83.0     1.8 7.6E-05   21.7   5.0   31   11-41     22-52  (63)
219 2qco_A CMER; transcriptional r  82.7    0.43 1.8E-05   25.8   1.6   38    5-42     14-54  (210)
220 2nnn_A Probable transcriptiona  82.6     1.6 6.9E-05   22.0   4.6   32   10-41     41-72  (140)
221 3kor_A Possible Trp repressor;  82.4     1.8 7.5E-05   21.7   4.8   30   13-43     68-97  (119)
222 3k0l_A Repressor protein; heli  82.3     1.2 5.2E-05   22.7   3.9   32   10-41     49-80  (162)
223 3nqo_A MARR-family transcripti  82.0     1.7 7.2E-05   21.8   4.5   32   10-41     44-77  (189)
224 2dbb_A Putative HTH-type trans  81.8     1.3 5.4E-05   22.6   3.8   30   11-40     13-42  (151)
225 1g2h_A Transcriptional regulat  81.6     1.4   6E-05   22.3   4.0   30   11-41     24-53  (61)
226 1wiz_A DNA-binding protein SAT  81.6     2.6 0.00011   20.7   6.1   59    7-68     20-83  (101)
227 3ech_A MEXR, multidrug resista  81.6     1.4 5.7E-05   22.5   3.9   30   12-41     42-71  (142)
228 2qww_A Transcriptional regulat  81.6     1.2   5E-05   22.9   3.6   32   10-41     44-75  (154)
229 1ntc_A Protein (nitrogen regul  81.6     1.4 5.7E-05   22.5   3.9   29   12-40     55-83  (91)
230 3oop_A LIN2960 protein; protei  81.6     1.3 5.7E-05   22.5   3.9   32   10-41     40-71  (143)
231 2pex_A Transcriptional regulat  81.4     1.2   5E-05   22.8   3.6   32   10-41     50-81  (153)
232 2o3f_A Putative HTH-type trans  81.4     1.9 8.1E-05   21.5   4.6   40    6-45     23-63  (111)
233 2cg4_A Regulatory protein ASNC  81.4     1.4 5.8E-05   22.4   3.9   30   11-40     12-41  (152)
234 3nrg_A TETR family transcripti  81.3    0.89 3.7E-05   23.7   2.9   38    5-42     14-54  (217)
235 1z91_A Organic hydroperoxide r  81.3     1.1 4.6E-05   23.1   3.3   32   10-41     43-74  (147)
236 2hku_A A putative transcriptio  81.3     2.7 0.00011   20.6   6.8   39    4-42     20-60  (215)
237 2iai_A Putative transcriptiona  81.1    0.62 2.6E-05   24.7   2.0   39    4-42     30-71  (230)
238 1eto_A FIS, factor for inversi  81.1     1.9   8E-05   21.5   4.5   29   12-40     62-90  (98)
239 2ovg_A Phage lambda CRO; trans  81.0     1.4 6.1E-05   22.3   3.9   30   13-44      7-36  (66)
240 2h09_A Transcriptional regulat  81.0     2.7 0.00011   20.5   5.3   35    7-41     39-74  (155)
241 2cfx_A HTH-type transcriptiona  80.9     1.5 6.3E-05   22.2   3.9   30   12-41     10-39  (144)
242 3g3z_A NMB1585, transcriptiona  80.8     1.9 8.1E-05   21.5   4.5   31   11-41     35-65  (145)
243 3frw_A Putative Trp repressor   80.8     2.1 8.7E-05   21.3   4.6   30   13-43     51-80  (107)
244 1u2w_A CADC repressor, cadmium  80.7    0.98 4.1E-05   23.4   2.9   39    4-42     39-77  (122)
245 3e3m_A Transcriptional regulat  80.6    0.27 1.1E-05   27.1   0.0   49   18-68      9-57  (355)
246 2a61_A Transcriptional regulat  80.6       2 8.6E-05   21.3   4.5   31   11-41     37-67  (145)
247 3eup_A Transcriptional regulat  80.5    0.76 3.2E-05   24.1   2.3   39    4-42     11-52  (204)
248 3fzv_A Probable transcriptiona  80.5     2.6 0.00011   20.7   5.0   38    1-41      1-38  (306)
249 1ub9_A Hypothetical protein PH  80.4     1.3 5.3E-05   22.7   3.4   32   10-41     19-50  (100)
250 2e1c_A Putative HTH-type trans  80.2     1.6 6.6E-05   22.1   3.8   30   11-40     31-60  (171)
251 2ia0_A Putative HTH-type trans  80.2     1.6 6.6E-05   22.1   3.8   30   11-40     21-50  (171)
252 2w25_A Probable transcriptiona  80.2       2 8.4E-05   21.4   4.4   30   11-40     11-40  (150)
253 1sfx_A Conserved hypothetical   80.2     2.3 9.8E-05   21.0   4.7   31   11-41     24-54  (109)
254 2pn6_A ST1022, 150AA long hypo  80.1    0.98 4.1E-05   23.4   2.8   30   11-40      7-36  (150)
255 2fa5_A Transcriptional regulat  80.1     2.1 8.8E-05   21.3   4.4   32   10-41     52-83  (162)
256 1jgs_A Multiple antibiotic res  80.1     2.1 8.9E-05   21.2   4.5   32   10-41     37-68  (138)
257 1i1g_A Transcriptional regulat  79.9     1.6 6.9E-05   22.0   3.8   29   12-40      9-37  (141)
258 3bj6_A Transcriptional regulat  79.8     1.7   7E-05   21.9   3.8   32   10-41     43-74  (152)
259 2o20_A Catabolite control prot  79.4    0.31 1.3E-05   26.7   0.0   50   19-70      3-52  (332)
260 2oqg_A Possible transcriptiona  79.0       3 0.00012   20.3   4.9   29   13-42     27-55  (114)
261 3e6c_C CPRK, cyclic nucleotide  78.9     3.2 0.00013   20.1   7.1   59    6-64    150-228 (250)
262 3i4p_A Transcriptional regulat  78.2     1.3 5.3E-05   22.7   2.8   29   12-40      8-36  (162)
263 3dbi_A Sugar-binding transcrip  78.1    0.36 1.5E-05   26.3   0.0   46   22-69      4-49  (338)
264 3kp7_A Transcriptional regulat  78.1     1.7 7.1E-05   21.9   3.5   29   12-41     43-71  (151)
265 2nyx_A Probable transcriptiona  77.9     2.3 9.6E-05   21.0   4.1   37    4-41     43-79  (168)
266 1u8b_A ADA polyprotein; protei  77.3     1.9   8E-05   21.6   3.5   38    8-45     80-117 (133)
267 3h5o_A Transcriptional regulat  76.9     0.4 1.7E-05   25.9   0.0   47   20-68      3-49  (339)
268 3lsj_A DEST; transcriptional r  76.8    0.81 3.4E-05   23.9   1.5   38    5-42     12-53  (220)
269 3la7_A Global nitrogen regulat  76.8     3.6 0.00015   19.7   5.1   11  149-159    46-56  (243)
270 2np3_A Putative TETR-family re  76.5    0.42 1.8E-05   25.8   0.0   39    4-42     30-71  (212)
271 1mkm_A ICLR transcriptional re  76.5     3.7 0.00016   19.7   5.6   38    5-42      6-44  (249)
272 3cdh_A Transcriptional regulat  76.5     1.5 6.2E-05   22.3   2.8   32   10-41     46-77  (155)
273 1j9i_A GPNU1 DBD;, terminase s  76.5     1.1 4.4E-05   23.2   2.1   24   21-44      2-25  (68)
274 3bro_A Transcriptional regulat  76.3     3.6 0.00015   19.7   4.8   31   11-41     38-70  (141)
275 3lsg_A Two-component response   76.2     3.2 0.00014   20.0   4.5   40    6-45      4-43  (103)
276 2zhg_A Redox-sensitive transcr  76.1     2.4   1E-04   20.9   3.8   57   20-76     10-77  (154)
277 1qbj_A Protein (double-strande  76.0     2.4  0.0001   20.9   3.8   33    9-41     15-47  (81)
278 3hrs_A Metalloregulator SCAR;   75.9     2.8 0.00012   20.5   4.1   39    4-42      2-41  (214)
279 2di3_A Bacterial regulatory pr  75.8     3.3 0.00014   20.0   4.5   41    1-41      1-48  (239)
280 1s3j_A YUSO protein; structura  75.2     2.2 9.1E-05   21.2   3.4   32   10-41     40-71  (155)
281 1wh5_A ZF-HD homeobox family p  74.8     4.1 0.00017   19.4   4.8   44    2-46     22-73  (80)
282 2fbk_A Transcriptional regulat  74.7    0.81 3.4E-05   24.0   1.1   33    9-41     74-106 (181)
283 2jsc_A Transcriptional regulat  74.6     1.7 7.1E-05   21.9   2.7   38    4-42     18-55  (118)
284 1pdn_C Protein (PRD paired); p  74.4     4.2 0.00018   19.3   5.5   32    9-41     22-53  (128)
285 3jvd_A Transcriptional regulat  74.0    0.53 2.2E-05   25.1   0.0   48   20-69      5-52  (333)
286 2fbi_A Probable transcriptiona  73.9     3.4 0.00014   19.9   4.1   32   10-41     39-70  (142)
287 1r1u_A CZRA, repressor protein  73.8       4 0.00017   19.4   4.5   37    4-41     23-59  (106)
288 1lj9_A Transcriptional regulat  73.3     2.6 0.00011   20.6   3.4   32   10-41     32-63  (144)
289 1jhg_A Trp operon repressor; c  73.2     4.5 0.00019   19.1   5.6   38    4-41     36-78  (101)
290 3ctp_A Periplasmic binding pro  72.9    0.59 2.5E-05   24.8   0.0   46   23-70      4-49  (330)
291 2fxa_A Protease production reg  72.5     3.9 0.00016   19.6   4.1   31   11-41     52-82  (207)
292 2fbh_A Transcriptional regulat  72.5     4.6  0.0002   19.0   4.6   31   11-41     41-72  (146)
293 3deu_A Transcriptional regulat  72.4       3 0.00012   20.3   3.5   31   11-41     57-88  (166)
294 3bja_A Transcriptional regulat  72.4     1.8 7.6E-05   21.7   2.4   32   10-41     36-67  (139)
295 3eco_A MEPR; mutlidrug efflux   72.3     2.9 0.00012   20.3   3.4   30   12-41     36-67  (139)
296 2zcw_A TTHA1359, transcription  72.1     4.7  0.0002   19.0   5.6   62    6-67    120-200 (202)
297 1yse_A DNA-binding protein SAT  72.0     4.4 0.00018   19.2   4.3   59    7-68     24-87  (141)
298 1jye_A Lactose operon represso  72.0    0.64 2.7E-05   24.6   0.0   47   21-69      3-49  (349)
299 1aoy_A Arginine repressor; DNA  71.8     3.4 0.00014   19.9   3.7   42    1-42      1-50  (78)
300 2bv6_A MGRA, HTH-type transcri  71.6     2.1 8.7E-05   21.3   2.6   32   10-41     40-71  (142)
301 2jml_A DNA binding domain/tran  71.4       2 8.5E-05   21.4   2.5   56   19-74      3-72  (81)
302 1r8d_A Transcription activator  71.2       3 0.00013   20.2   3.3   55   21-75      2-68  (109)
303 3f3x_A Transcriptional regulat  71.1     3.5 0.00015   19.8   3.6   28   13-41     43-70  (144)
304 2ao9_A Phage protein; structur  71.1     3.2 0.00013   20.1   3.4   25   20-44     47-71  (155)
305 3b73_A PHIH1 repressor-like pr  70.9     3.3 0.00014   20.0   3.4   33    6-41     15-49  (111)
306 3oio_A Transcriptional regulat  69.9     5.3 0.00022   18.7   4.5   42    4-45      4-47  (113)
307 3d0s_A Transcriptional regulat  69.9     5.3 0.00022   18.7   5.6   21   21-41    177-197 (227)
308 1ku9_A Hypothetical protein MJ  69.7       3 0.00013   20.2   3.1   24   18-41     38-61  (152)
309 3hsr_A HTH-type transcriptiona  68.9     1.3 5.6E-05   22.5   1.1   31   11-41     40-70  (140)
310 3boq_A Transcriptional regulat  68.9     1.8 7.6E-05   21.7   1.8   30   12-41     52-82  (160)
311 3gpv_A Transcriptional regulat  68.8     3.8 0.00016   19.6   3.4   59   15-73     10-80  (148)
312 2k9s_A Arabinose operon regula  68.7     5.6 0.00024   18.5   5.4   39    7-45      3-44  (107)
313 1nr3_A MTH0916, DNA-binding pr  68.7    0.18 7.5E-06   28.2  -3.4   28   18-45      2-29  (122)
314 3jth_A Transcription activator  68.0       2 8.5E-05   21.4   1.9   39    3-42     19-57  (98)
315 2vz4_A Tipal, HTH-type transcr  68.0     3.4 0.00014   19.9   3.0   54   22-75      2-67  (108)
316 3e6m_A MARR family transcripti  67.9     3.8 0.00016   19.6   3.2   32   10-41     56-87  (161)
317 1ic8_A Hepatocyte nuclear fact  67.8     5.8 0.00025   18.4   6.2   41    7-47     29-69  (194)
318 3dv8_A Transcriptional regulat  67.0       6 0.00025   18.3   5.6   19   22-40    170-188 (220)
319 1r1t_A Transcriptional repress  66.6     3.3 0.00014   20.0   2.7   38    4-42     43-80  (122)
320 1q06_A Transcriptional regulat  66.4     4.6 0.00019   19.1   3.4   53   22-74      1-65  (135)
321 3fm5_A Transcriptional regulat  66.4     6.2 0.00026   18.2   4.2   31   11-41     43-74  (150)
322 2o4a_A DNA-binding protein SAT  66.2     6.3 0.00026   18.2   5.5   60    7-69     10-74  (93)
323 2c35_A Human RPB4, DNA-directe  66.1     6.3 0.00026   18.2   4.4   62    3-65     83-144 (152)
324 3jw4_A Transcriptional regulat  66.0     3.4 0.00014   19.9   2.7   31   11-41     45-77  (148)
325 1uly_A Hypothetical protein PH  65.8     4.2 0.00018   19.3   3.1   36    5-41     18-53  (192)
326 1y0u_A Arsenical resistance op  65.5     5.7 0.00024   18.5   3.8   25   16-41     39-63  (96)
327 2cpg_A REPA protein, transcrip  65.2     4.3 0.00018   19.3   3.1   25    6-30     10-34  (45)
328 2g7u_A Transcriptional regulat  64.8     3.2 0.00013   20.1   2.4   34    9-42     16-50  (257)
329 3c57_A Two component transcrip  64.6     6.7 0.00028   18.0   4.4   23   20-42     41-63  (95)
330 2o0m_A Transcriptional regulat  64.4     1.1 4.8E-05   23.0   0.0   28   15-42     28-55  (345)
331 2zdb_A Transcriptional regulat  64.1     6.9 0.00029   17.9   4.5   58    6-63    113-189 (195)
332 1qgp_A Protein (double strande  64.1     3.8 0.00016   19.6   2.7   34    8-41     14-51  (77)
333 3mzy_A RNA polymerase sigma-H   63.7     5.5 0.00023   18.5   3.4   25   19-43    122-146 (164)
334 1ft9_A Carbon monoxide oxidati  63.4       5 0.00021   18.8   3.2   22   20-41    162-183 (222)
335 1je8_A Nitrate/nitrite respons  62.7     7.3 0.00031   17.8   4.5   25   19-43     34-58  (82)
336 2o0y_A Transcriptional regulat  62.5     3.6 0.00015   19.8   2.3   32   11-42     27-59  (260)
337 3gp4_A Transcriptional regulat  62.5     4.9  0.0002   18.9   2.9   54   21-74      2-67  (142)
338 2rn7_A IS629 ORFA; helix, all   62.1     7.5 0.00031   17.7   3.9   25   20-44     29-53  (108)
339 3mkl_A HTH-type transcriptiona  62.0     4.3 0.00018   19.3   2.6   37    8-45     11-47  (120)
340 1fse_A GERE; helix-turn-helix   61.4     6.5 0.00027   18.1   3.4   25   19-43     24-48  (74)
341 3hh0_A Transcriptional regulat  60.6     6.7 0.00028   18.0   3.4   56   20-75      3-70  (146)
342 2jpc_A SSRB; DNA binding prote  59.4     5.9 0.00025   18.4   2.9   25   19-43     11-35  (61)
343 1y14_A B32, RPB4, DNA-directed  58.8     8.5 0.00036   17.3   5.1   62    3-65    119-180 (187)
344 2dg6_A Putative transcriptiona  58.2     8.7 0.00037   17.3   3.9   26   22-47      1-26  (222)
345 1x3u_A Transcriptional regulat  58.1     8.7 0.00037   17.3   4.1   26   19-44     29-54  (79)
346 3f6o_A Probable transcriptiona  58.0       4 0.00017   19.5   1.9   30   12-42     23-52  (118)
347 2krf_A Transcriptional regulat  57.9     8.8 0.00037   17.2   4.5   25   19-43     25-49  (73)
348 3fx3_A Cyclic nucleotide-bindi  57.2     8.3 0.00035   17.4   3.4   20   22-41    179-198 (237)
349 3klo_A Transcriptional regulat  56.6     9.3 0.00039   17.1   5.2   27   19-45    172-198 (225)
350 1xwr_A Regulatory protein CII;  56.5     3.5 0.00015   19.8   1.4   23   21-43     23-45  (97)
351 1wh6_A CUT-like 2, homeobox pr  55.8     9.5  0.0004   17.0   5.5   40    4-43     17-57  (101)
352 1x2l_A CUT-like 2, homeobox pr  55.7     9.5  0.0004   17.0   5.6   58    6-66     19-81  (101)
353 2p4w_A Transcriptional regulat  54.3      10 0.00042   16.9   4.1   26   16-41     23-48  (202)
354 3hou_D DNA-directed RNA polyme  54.1      10 0.00043   16.8   5.0   62    3-65    153-214 (221)
355 2kko_A Possible transcriptiona  53.5     9.3 0.00039   17.1   3.2   26   17-42     34-59  (108)
356 1p4w_A RCSB; solution structur  53.4      10 0.00044   16.8   3.6   26   19-44     47-72  (99)
357 2ia2_A Putative transcriptiona  53.1     4.7  0.0002   19.0   1.6   30   13-42     27-57  (265)
358 2fmy_A COOA, carbon monoxide o  53.0      11 0.00044   16.7   5.7   21   21-41    167-187 (220)
359 2gxg_A 146AA long hypothetical  53.0      11 0.00044   16.7   3.8   36    4-41     35-70  (146)
360 1xd7_A YWNA; structural genomi  52.8      11 0.00045   16.7   4.4   41    1-41      1-43  (145)
361 1v4r_A Transcriptional repress  52.0      11 0.00046   16.6   3.4   37    5-41     12-55  (102)
362 2l01_A Uncharacterized protein  51.4     7.8 0.00033   17.6   2.5   33    1-34      1-37  (77)
363 2p5k_A Arginine repressor; DNA  51.1      11 0.00047   16.5   5.5   39    5-43      2-46  (64)
364 1wh8_A CUT-like 2, homeobox pr  50.2      12 0.00049   16.4   5.7   38    6-43     29-67  (111)
365 3f6v_A Possible transcriptiona  50.1     6.8 0.00029   17.9   2.0   28   13-41     64-91  (151)
366 2kfs_A Conserved hypothetical   49.8     8.7 0.00036   17.3   2.5   24   22-45     32-55  (148)
367 3isp_A HTH-type transcriptiona  49.8      12  0.0005   16.4   5.4   31    9-41     10-40  (303)
368 3oou_A LIN2118 protein; protei  49.7      12  0.0005   16.4   4.2   37    8-45      9-45  (108)
369 1tty_A Sigma-A, RNA polymerase  49.5      12  0.0005   16.4   4.1   45   21-66     38-83  (87)
370 2rnj_A Response regulator prot  49.4      10 0.00044   16.8   2.9   25   19-43     42-66  (91)
371 1b9m_A Protein (mode); DNA-bin  49.4      12 0.00051   16.4   6.2   32    8-41     23-54  (265)
372 3bwg_A Uncharacterized HTH-typ  49.3      12 0.00051   16.3   4.5   40    2-41      3-49  (239)
373 1xsv_A Hypothetical UPF0122 pr  49.2      12 0.00051   16.3   3.8   28   15-42     35-62  (113)
374 3hhg_A Transcriptional regulat  48.9      12 0.00051   16.3   5.8   32    8-41      6-37  (306)
375 2frh_A SARA, staphylococcal ac  48.6      12 0.00052   16.3   3.2   29   13-41     43-73  (127)
376 3hug_A RNA polymerase sigma fa  48.2      13 0.00053   16.2   7.0   44   16-68     48-91  (92)
377 1zvp_A Hypothetical protein VC  48.0      10 0.00043   16.8   2.7   15  146-160    14-28  (133)
378 3gbg_A TCP pilus virulence reg  47.8      13 0.00053   16.2   3.4   23   21-43    185-207 (276)
379 1iuf_A Centromere ABP1 protein  47.1     7.7 0.00032   17.6   1.9   23   20-42     29-57  (144)
380 2k5j_A Uncharacterized protein  43.8      15 0.00061   15.8   3.6   25    7-31     18-42  (80)
381 3by6_A Predicted transcription  43.8      15 0.00061   15.8   5.2   36    6-41     13-55  (126)
382 2gqq_A Leucine-responsive regu  43.5     2.7 0.00011   20.6  -0.9   29   12-40     18-46  (163)
383 2o8x_A Probable RNA polymerase  43.5      15 0.00062   15.8   3.7   27   15-41     25-51  (70)
384 3fxq_A LYSR type regulator of   43.3      15 0.00062   15.8   5.9   35    4-41      2-36  (305)
385 3edp_A LIN2111 protein; APC883  42.8      15 0.00063   15.7   5.4   36    6-41     11-53  (236)
386 1zav_U 50S ribosomal protein L  42.3      13 0.00055   16.1   2.5   22    4-31      1-22  (30)
387 2wv0_A YVOA, HTH-type transcri  41.5      16 0.00067   15.6   5.3   37    5-41     11-54  (243)
388 2q0o_A Probable transcriptiona  41.0      16 0.00068   15.5   3.4   10    9-18      7-16  (236)
389 1r8e_A Multidrug-efflux transp  40.8      11 0.00046   16.6   1.9   58   17-75      1-72  (278)
390 3ezq_A Tumor necrosis factor r  39.7      17 0.00071   15.4   4.5   42    4-45      2-44  (115)
391 2oa4_A SIR5; structure, struct  39.3      17 0.00072   15.4   3.8   42   20-61     48-90  (101)
392 1l3l_A Transcriptional activat  39.3      17 0.00072   15.4   3.9   12   11-22     23-34  (234)
393 3dp7_A SAM-dependent methyltra  39.2      17 0.00072   15.4   3.4   31   14-44     42-73  (363)
394 1bl0_A Protein (multiple antib  39.0      17 0.00073   15.3   3.8   37    9-45     13-51  (129)
395 2ezk_A Transposase; DNA-bindin  38.9      17 0.00073   15.3   5.5   53    9-66     38-94  (99)
396 2ijl_A AGR_C_4647P, molybdenum  38.9      17 0.00073   15.3   6.0   37   18-71     36-72  (135)
397 3lap_A Arginine repressor; arg  37.7      18 0.00076   15.2   4.1   34   10-43     22-61  (170)
398 2x48_A CAG38821; archeal virus  37.1      19 0.00078   15.1   5.4   37    5-42     16-52  (55)
399 1s7o_A Hypothetical UPF0122 pr  36.6      19 0.00079   15.1   3.9   28   15-42     32-59  (113)
400 2v79_A DNA replication protein  36.4      19  0.0008   15.1   4.4   19   23-41     53-71  (135)
401 1y9i_A Low temperature require  36.2      15 0.00063   15.7   2.0   31    1-31      1-32  (178)
402 1rfz_A Hypothetical protein AP  36.1     7.1  0.0003   17.8   0.3   31    1-31      4-34  (168)
403 3eet_A Putative GNTR-family tr  35.8      19 0.00081   15.0   5.2   35    7-41     32-73  (272)
404 3hot_A Transposable element ma  35.2      20 0.00083   14.9   7.6   62    1-63      1-82  (345)
405 2esn_A Probable transcriptiona  35.2      20 0.00083   14.9   6.0   30   10-41     15-44  (310)
406 2vi6_A Homeobox protein nanog;  35.1      20 0.00084   14.9   5.8   43    2-44      8-53  (62)
407 1ahd_P Antennapedia protein mu  35.0      20 0.00084   14.9   5.1   42    2-44      7-52  (68)
408 2o8n_A APOA-I binding protein;  35.0      20 0.00084   14.9   3.5   37    1-37     28-64  (265)
409 1ig7_A Homeotic protein MSX-1;  34.6      20 0.00085   14.9   5.8   43    2-44      5-50  (58)
410 3a02_A Homeobox protein arista  34.3      20 0.00086   14.9   5.6   44    2-45      4-50  (60)
411 1tlq_A Hypothetical protein YP  33.9      21 0.00087   14.8   4.2   31    1-31      3-33  (189)
412 2rhf_A DNA helicase RECQ; HRDC  33.8      21 0.00088   14.8   5.9   51    6-77      4-54  (77)
413 2ek5_A Predicted transcription  33.4      21 0.00089   14.8   5.2   41    1-41      1-48  (129)
414 3mn2_A Probable ARAC family tr  33.3      21 0.00089   14.8   5.7   37    8-45      6-42  (108)
415 1nq4_A Oxytetracycline polyket  32.5      19 0.00081   15.0   2.1   24    1-24      1-25  (95)
416 1puf_A HOX-1.7, homeobox prote  31.7      23 0.00095   14.6   5.8   44    2-45     18-64  (77)
417 3h87_C Putative uncharacterize  31.6      23 0.00095   14.6   6.1   50    6-65     10-59  (73)
418 2p7v_B Sigma-70, RNA polymeras  31.3      23 0.00096   14.5   3.3   24   20-43     24-47  (68)
419 1ftt_A TTF-1 HD, thyroid trans  31.2      23 0.00096   14.5   5.8   43    2-44      7-52  (68)
420 2rrd_A BLM HRDC domain, HRDC d  31.0      23 0.00097   14.5   5.8   49    8-77     23-71  (101)
421 2ooa_A E3 ubiquitin-protein li  30.5      13 0.00056   16.1   0.9   33    5-38      7-39  (52)
422 2cue_A Paired box protein PAX6  30.3      24   0.001   14.4   4.7   43    2-45     12-58  (80)
423 1p4x_A Staphylococcal accessor  30.1      24   0.001   14.4   3.1   22   20-41     49-70  (250)
424 2ns0_A Hypothetical protein; r  29.8      24   0.001   14.4   4.2   30    4-33      3-36  (85)
425 2qlz_A Transcription factor PF  29.6      10 0.00042   16.8   0.2   36    5-41     10-45  (232)
426 1zq3_P PRD-4, homeotic bicoid   29.4      25   0.001   14.3   4.7   43    2-45      7-53  (68)
427 2ay0_A Bifunctional PUTA prote  29.4      25   0.001   14.3   3.9   26    6-31     11-36  (58)
428 1b72_A Protein (homeobox prote  29.1      25   0.001   14.3   4.7   42    3-45     40-85  (97)
429 2w7n_A TRFB transcriptional re  28.6      25  0.0011   14.3   3.4   24   20-43     33-56  (101)
430 1b4a_A Arginine repressor; hel  28.5      26  0.0011   14.2   3.9   34   10-43      7-46  (149)
431 3c7j_A Transcriptional regulat  28.1      26  0.0011   14.2   4.6   38    4-41     26-69  (237)
432 2juj_A E3 ubiquitin-protein li  28.0      26  0.0011   14.2   2.1   31    6-37      4-34  (56)
433 2k9q_A Uncharacterized protein  27.1      27  0.0011   14.1   5.2   62    4-75      3-64  (77)
434 2ev1_A Hypothetical protein RV  27.0      27  0.0011   14.1   2.8   25   22-46     79-103 (222)
435 3c3w_A Two component transcrip  26.1      28  0.0012   14.0   6.6   26   19-44    162-187 (225)
436 1s4k_A Putative cytoplasmic pr  25.7      29  0.0012   13.9   6.2   35   13-47      8-44  (120)
437 2pjp_A Selenocysteine-specific  25.4      27  0.0011   14.0   1.8   36    6-41      5-40  (121)
438 2oo9_A E3 ubiquitin-protein li  24.9      20 0.00084   14.9   1.0   30    8-38      3-32  (46)
439 3e97_A Transcriptional regulat  24.9      30  0.0012   13.8   5.4   19   22-40    176-194 (231)
440 1x2m_A LAG1 longevity assuranc  24.8      30  0.0012   13.8   2.4   22   24-45     31-52  (64)
441 1fjl_A Paired protein; DNA-bin  24.8      30  0.0012   13.8   5.8   43    3-45     24-69  (81)
442 1jgg_A Segmentation protein EV  24.5      30  0.0013   13.8   5.8   42    2-44      6-51  (60)
443 3m8j_A FOCB protein; all-alpha  24.0      31  0.0013   13.7   4.3   31   12-42     49-81  (111)
444 1al3_A Cys regulon transcripti  23.8      13 0.00057   16.0   0.0   23   19-41     14-36  (324)
445 1mbm_A NSP4 proteinase, chymot  23.8      15 0.00065   15.7   0.3   51  133-185   101-152 (198)
446 1z4h_A TORI, TOR inhibition pr  23.7      31  0.0013   13.7   2.5   24   22-45     11-34  (66)
447 3neu_A LIN1836 protein; struct  23.7      31  0.0013   13.7   5.2   36    6-41     15-57  (125)
448 1bw5_A ISL-1HD, insulin gene e  23.6      31  0.0013   13.7   5.8   43    2-45      8-54  (66)
449 2kwp_A Transcription elongatio  22.4      33  0.0014   13.5   3.3   25    7-31      3-27  (129)
450 2e5p_A Protein PHF1, PHD finge  22.3      33  0.0014   13.5   3.6   18  144-162     4-21  (68)
451 3kt9_A Aprataxin; FHA domain,   22.0      34  0.0014   13.5   2.4   25  148-172    64-88  (102)
452 2rqp_A Heterochromatin protein  21.8      34  0.0014   13.4   3.4   26    6-31     13-38  (88)
453 2h9b_A HTH-type transcriptiona  21.8      16 0.00066   15.6   0.0   29   11-41      7-35  (312)
454 1yz8_P Pituitary homeobox 2; D  21.7      34  0.0014   13.4   4.0   42    2-44      8-53  (68)
455 3keo_A Redox-sensing transcrip  20.9      35  0.0015   13.3   4.5   59   12-71     21-85  (212)
456 2djn_A Homeobox protein DLX-5;  20.8      36  0.0015   13.3   4.7   22   24-45     37-58  (70)
457 2d9s_A CBL E3 ubiquitin protei  20.3      30  0.0013   13.8   1.2   31    7-38      7-37  (53)
458 1nk2_P Homeobox protein VND; h  20.2      36  0.0015   13.2   5.8   41    3-44     15-59  (77)
459 2hdd_A Protein (engrailed home  20.2      37  0.0015   13.2   5.8   42    2-44      8-53  (61)

No 1  
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda}
Probab=99.97  E-value=1.6e-31  Score=222.74  Aligned_cols=203  Identities=12%  Similarity=0.086  Sum_probs=145.9

Q ss_pred             CCCCCHHH------HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             97755899------999999999964999889999828998798899751578875577989999987321875210000
Q gi|254780444|r    1 MTSFSHKK------IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD   74 (223)
Q Consensus         1 ~~~~~~~~------i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~   74 (223)
                      ++++|-++      +.+.++++|+++||||++||+++|++++||++|++|..     .|+.+.|.++|++++++++||..
T Consensus         4 ~~~~~~~~~~~~~rLk~l~~~~r~e~Glsq~elA~~~Gis~~tis~~e~G~~-----~~~~~~l~~ia~~l~v~~~~l~~   78 (236)
T 3bdn_A            4 KKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGIN-----ALNAYNAALLAKILKVSVEEFSP   78 (236)
T ss_dssp             SCCCCSHHHHHHHHHHHHHHHHTTTTTCCSHHHHHHHTSCHHHHHHHTTTTS-----CCCHHHHHHTTTTTTSCGGGTCH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----HHHHHHHHHHHHHCEEEEEHHCC
T ss_conf             8989999999999999999999998399999999997979999988872852-----46799999752202785121103


Q ss_pred             CCCCCCCCC---------CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             111124445---------44221220243101134522211125444640356437211354542003685599996283
Q gi|254780444|r   75 LPFSDGRTT---------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT  145 (223)
Q Consensus        75 ~~~~~~~~~---------~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GD  145 (223)
                      .........         .......++....+++......          +.................+.++++++|.||
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ag~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~l~v~Gd  148 (236)
T 3bdn_A           79 SIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQAGMFSPEL----------RTFTKGDAERWVSTTKKASDSAFWLEVEGN  148 (236)
T ss_dssp             HHHHHHHHHHHHHHCCCCSSCSCCCCCCCSSCCCCTTTTC----------CCCSSCCCCCCCCCSCCCSSSCEEEECCSS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCC----------CCCCCCCCEEEEEECCCCCCCEEEEEEECC
T ss_conf             2232322222212235543332112431353157752245----------553234321344202479877399999622


Q ss_pred             CC------CCCCCCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEEEE
Q ss_conf             32------421487868999368974058889999717968999999977987999968589887585478659997799
Q gi|254780444|r  146 SM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL  219 (223)
Q Consensus       146 SM------~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigrVv  219 (223)
                      ||      +|.|++||+++||+..+..+|++||++..+++++|||+++. ++.+.|+|+||+||++.+. ++++||||||
T Consensus       149 sM~~~~~~ep~i~~Gd~v~vd~~~~~~~~~~v~v~~~~~~~~iKrl~~~-~~~~~L~s~N~~y~~~~~~-~~~~IiG~Vv  226 (236)
T 3bdn_A          149 SMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRG-SGQVFLQPLNPQYPMIPCN-ESCSVVGKVI  226 (236)
T ss_dssp             SSCCCSSCSSCCCSSCEEEECCSSCCCTTSEEEEESTTTCCCCEEEECC-SSSCEEECSSTTSCCBC---CCCEEEEEEE
T ss_pred             CCCCCCCCCCEEECCEEEEEECCCCCCCCCEEEEEECCCEEEEEEEEEE-CCEEEEEECCCCCCCEECC-CCCEEEEEEE
T ss_conf             0577778898886880687614543213878999986999999999997-9989999899998978659-9969999999


Q ss_pred             E
Q ss_conf             8
Q gi|254780444|r  220 W  220 (223)
Q Consensus       220 w  220 (223)
                      +
T Consensus       227 ~  227 (236)
T 3bdn_A          227 A  227 (236)
T ss_dssp             E
T ss_pred             E
T ss_conf             8


No 2  
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 1jhc_A 1jhe_A 1lea_A 1leb_A
Probab=99.95  E-value=1.4e-25  Score=184.26  Aligned_cols=187  Identities=14%  Similarity=0.203  Sum_probs=133.6

Q ss_pred             CCCCCH--HHHHHHHHHHHHHCCC--CHHHHHHHHCC-CHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             977558--9999999999996499--98899998289-987988997515788755779899999873218752100001
Q gi|254780444|r    1 MTSFSH--KKIWEAIDRMAERHNL--TPSGLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         1 ~~~~~~--~~i~~~i~~l~~~~gl--s~~~lA~~~Gv-~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      |+.||.  ++|+++|++.+++.|.  |++++|+++|+ |+++++++-+             .|.+    .|. +....+.
T Consensus         1 M~~LT~kq~~il~~I~~~~~~~g~~PS~~Eia~~~GikS~s~v~~~l~-------------~L~~----~G~-l~~~~~~   62 (202)
T 1jhf_A            1 MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLK-------------ALAR----KGV-IEIVSGA   62 (202)
T ss_dssp             -CCCCHHHHHHHHHHHHHHHHHSSCCCHHHHHHHTTCSSHHHHHHHHH-------------HHHH----TTS-EEECSSS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCHHHHHHHH-------------HHHH----CCC-CCCCCCC
T ss_conf             974599999999999999998298966999999849997289999999-------------8876----385-0001354


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCC-CCCC
Q ss_conf             111244454422122024310113452221112544464035643721135454200368559999628332421-4878
Q gi|254780444|r   76 PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKG  154 (223)
Q Consensus        76 ~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GDSM~P~-i~~G  154 (223)
                      ... ..........+|+++...+|......+      ...+....|...       ..++.+|+++|.||||.|. |++|
T Consensus        63 ~r~-~~~~~~~~~~iP~~g~i~ag~~~~~~~------~~~~~~~~~~~~-------~~~~~~f~l~V~GdSM~~~gI~~G  128 (202)
T 1jhf_A           63 SRG-IRLLQEEEEGLPLVGRVAADEPLLAQQ------HIEGHYQVDPSL-------FKPNADFLLRVSGMSMKDIGIMDG  128 (202)
T ss_dssp             SSC-EEECCCCCSSEEEECCCCTTSCTTCGG------GEEEEECBCGGG-------SSSCCCEEEECCSSTTGGGTCCTT
T ss_pred             CCC-CCCCCCCCCCCCCEEEEECCCCCCCCC------CCCEEECCCHHH-------CCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             433-323467656788662461699805644------631345268777-------589974999987976756314798


Q ss_pred             CEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECH--HHEEEEEEEEEE
Q ss_conf             6899936897405888999971796899999997798799996858988758547--865999779985
Q gi|254780444|r  155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM--SDIEWIARILWA  221 (223)
Q Consensus       155 d~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~--~~i~iigrVvw~  221 (223)
                      |+|+|+++.++.+|++|++.. +|++++||+.+. ++.+.|.|+||+|+|+.++.  ++++|+|+||++
T Consensus       129 Diviv~~~~~~~~GdIvv~~~-~~e~t~Kr~~~~-~~~i~L~p~N~~y~pi~~~~~~~~~~I~G~Vv~v  195 (202)
T 1jhf_A          129 DLLAVHKTQDVRNGQVVVARI-DDEVTVKRLKKQ-GNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGV  195 (202)
T ss_dssp             CEEEEEECSCCCTTSEEEEEE-TTEEEEEEEEEE-TTEEEEECSSTTCCCEEEETTTSCEEEEEEEEEE
T ss_pred             CEEEEECCCCCCCCCEEEEEE-CCEEEEEEEEEE-CCEEEEECCCCCCCCEEECCCCCEEEEEEEEEEE
T ss_conf             399997244323797899998-995789999998-9999998599899986615889808999999999


No 3  
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A
Probab=99.94  E-value=6.7e-27  Score=192.88  Aligned_cols=181  Identities=13%  Similarity=0.119  Sum_probs=130.4

Q ss_pred             CCHHHHHHHHHHHHHHCCC-CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             5589999999999996499-988999982899879889975157887557798999998732187521000011112444
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT   82 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl-s~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~~~~~   82 (223)
                      ++.+   +.|+||++.+|+ ||++||+++|++++|+++|+++...     | .+.+.+++.++++++.||..........
T Consensus         5 ~~~~---e~l~Rl~~~~g~~sq~eLA~~lGvs~stis~~e~~~~~-----p-~~~l~~ia~~~gv~~~~l~~~~~~~~~~   75 (189)
T 2fjr_A            5 WSNV---DVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAI-----S-YDFAAHCALETGANLQWLLTGEGEAFVN   75 (189)
T ss_dssp             CCHH---HHHHHHHHHHTCSSHHHHHHHTTCCHHHHHHHHHSSSC-----C-HHHHHHHHHHHCCCHHHHHHCCSCSCSS
T ss_pred             CCHH---HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCC-----C-HHHHHHHHHHHCCCHHHHCCCCCCCCCC
T ss_conf             6889---99999999829987999999979799999999828999-----7-7899999988099834511665455766


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCEEEEECC
Q ss_conf             54422122024310113452221112544464035643721135454200368559999628332421487868999368
Q gi|254780444|r   83 TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA  162 (223)
Q Consensus        83 ~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GDSM~P~i~~Gd~vlVd~~  162 (223)
                      .... ...+......+..           |........             ..+..++++.||||+|++.+||+++||++
T Consensus        76 ~~~~-~~~~~~~~~~~~~-----------g~~~~~~~~-------------~~~~~~l~~~g~sm~p~~~~Gd~v~vd~~  130 (189)
T 2fjr_A           76 NRES-SDAKRIEGFTLSE-----------EILKSDKQL-------------SVDAQFFTKPLTDGMAIRSEGKIYFVDKQ  130 (189)
T ss_dssp             TTSS-CSCSEEEEEEEET-----------TEEEEEEEE-------------EBCGGGCSSCCSSEEEEEETTEEEEEETT
T ss_pred             CCCC-CCCCCCCEEEECC-----------CCCCCCCCC-------------CCCCCEEEECCCCCCCEECCCCEEEEECC
T ss_conf             5433-1223320587327-----------742017711-------------23431797179877768579949999299


Q ss_pred             CCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEEEEEEEC
Q ss_conf             9740588899997179689999999779879999685898875854786599977998529
Q gi|254780444|r  163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ  223 (223)
Q Consensus       163 ~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigrVvw~~~  223 (223)
                      ....  |++|++..+|+++||||++.+++.+.+.|+|+.|   .++.++++|||||||+.+
T Consensus       131 ~~~~--dGiyvi~~~g~~~iKrl~~~p~g~i~~~s~n~~~---~~~~~di~IiGrVv~v~~  186 (189)
T 2fjr_A          131 ASLS--DGLWLVDIKGAISIRELTKLPGRKLHVAGGKVPF---ECGIDDIKTLGRVVGVYS  186 (189)
T ss_dssp             CCSC--SEEEEEEETTEEEEEEEEEETTTEEEEESSSSCE---EEETTSSEEEEEEEEEEE
T ss_pred             CCCC--CCEEEEEECCCEEEEEEEECCCCEEEEECCCCCC---CCCCCCEEEEEEEEEEEE
T ss_conf             8444--9889998179288999998589869996899888---998543499999999998


No 4  
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima}
Probab=99.93  E-value=1e-23  Score=172.27  Aligned_cols=185  Identities=15%  Similarity=0.161  Sum_probs=131.4

Q ss_pred             CC--HHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             55--89999999999996499--988999982899879889975157887557798999998732187521000011112
Q gi|254780444|r    4 FS--HKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD   79 (223)
Q Consensus         4 ~~--~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~~   79 (223)
                      ||  +++|+++|..++++.|+  |+.++|+++|+++++...+-             +.|.+.    |. +....+... .
T Consensus         3 LT~kq~~il~~I~~~~~~~G~~PS~reIa~~~Giss~s~v~~L-------------~~Le~k----G~-i~~~~~~~r-~   63 (196)
T 3k2z_A            3 LTERQRKVLLFIEEFIEKNGYPPSVREIARRFRITPRGALLHL-------------IALEKK----GY-IERKNGKPR-A   63 (196)
T ss_dssp             CCHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHTSCHHHHHHHH-------------HHHHHT----TS-EECC---TT-C
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHH-------------HHHHHC----CC-HHCCCCCCC-C
T ss_conf             8989999999999999984989669999998299964578889-------------999875----83-010542111-0


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCC-CCCCCEEE
Q ss_conf             44454422122024310113452221112544464035643721135454200368559999628332421-48786899
Q gi|254780444|r   80 GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILI  158 (223)
Q Consensus        80 ~~~~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GDSM~P~-i~~Gd~vl  158 (223)
                      ..........+|+.+...+|......      ....+.+.++...      +..+.++|+++|+||||.|. |++||+|+
T Consensus        64 ~~~~~~~~~~ipv~g~i~aG~~~~~~------~~~~~~~~~~~~~------~~~~~~~f~l~V~GdSM~~~~i~~gd~vi  131 (196)
T 3k2z_A           64 LRISKSIRNKIPLIGEIRAGEKREAI------EYLEDYIEIPESF------LSSGYDHFLLKVKGESMIEEHICDGDLVL  131 (196)
T ss_dssp             CEESSCCTTEEEEEEEEEECGGGCEE------EEEEEEEECCGGG------SCTTCCEEEEECCSSTTGGGTCCTTCEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCEEEECHHH------CCCCCCEEEEEEECCEEEEEECCCCCEEE
T ss_conf             00123444567631300258981354------4555428616143------25777508999938895345427995899


Q ss_pred             EECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEEEEEE
Q ss_conf             936897405888999971796899999997798799996858988758547865999779985
Q gi|254780444|r  159 LNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA  221 (223)
Q Consensus       159 Vd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigrVvw~  221 (223)
                      |+++.++.+|++|++.. +|++++||+.+. ++.+.|.|+||+|+|+.++.++++|+|+||++
T Consensus       132 v~~~~~~~~g~ivv~~~-~~e~t~Kr~~~~-~~~~~L~~~N~~y~~i~~~~~~~~I~G~Vv~v  192 (196)
T 3k2z_A          132 VRRQDWAQNGDIVAAMV-DGEVTLAKFYQR-GDTVELRPANREMSSMFFRAEKVKILGKVVGV  192 (196)
T ss_dssp             EEECSCCCTTCEEEEEE-TTEEEEEEEEEE-TTEEEEECSCTTSCCEEEEGGGCEEEEEEEEE
T ss_pred             EEECCCCCCCCEEEEEE-CCEEEEEEEEEE-CCEEEEECCCCCCCCEECCCCCEEEEEEEEEE
T ss_conf             97025543697999997-574538899998-99999989999999831488977999999999


No 5  
>2hnf_A Repressor protein CI101-229DM-K192A; viral protein; 1.80A {Escherichia coli} PDB: 2ho0_A 1f39_A
Probab=99.84  E-value=6.3e-20  Score=147.71  Aligned_cols=125  Identities=18%  Similarity=0.197  Sum_probs=96.6

Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCCCC------CCCCCCCCEEEE
Q ss_conf             22122024310113452221112544464035643721135454200368559999628332------421487868999
Q gi|254780444|r   86 KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM------LPLYRKGDILIL  159 (223)
Q Consensus        86 ~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GDSM------~P~i~~Gd~vlV  159 (223)
                      ....+|++++.+||.+....+. +......++...+         ...++++|+++|+||||      +|.|++||+|+|
T Consensus         3 ~~~~~Pvi~~v~AG~~~e~~~~-~~~~~~~~~~~~~---------~~~~~~~fal~V~GdSM~~~~~~ep~i~~GdiviV   72 (133)
T 2hnf_A            3 HMYEYPVFSHVQAGMFSPELRT-FTKGDAERWVSTT---------KKASDSAFWLEVEGNSMTTPTGSKTSFPDGMLILV   72 (133)
T ss_dssp             CCEEEEEECEEESSSSCTTCEE-ECSSCCCEEEEES---------CCCCTTCEEEECCSSTTCCC---CCCCCTTCEEEE
T ss_pred             CCEEECCEEEECCCCCCCCCCC-CCCCCCCCCCCCC---------CCCCCCEEEEEEECCCCCCCCCCCCCCCCCCEEEE
T ss_conf             5378466507348997123223-4433330014555---------57888869999847723576566885489999999


Q ss_pred             ECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEEEEEEEC
Q ss_conf             3689740588899997179689999999779879999685898875854786599977998529
Q gi|254780444|r  160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ  223 (223)
Q Consensus       160 d~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigrVvw~~~  223 (223)
                      |++.+..+|++|++...++++++||+.+. ++.+.|.|+||+|+++.++ ++++|||||| .||
T Consensus        73 d~~~~~~~g~~vva~~~~~~~~~k~~~~~-~~~~~L~s~Np~y~~i~~~-~~~~IiG~Vv-~~~  133 (133)
T 2hnf_A           73 DPEQAVEPGDFCIARLGGDEFTFAKLIRD-SGQVFLQPLNPQYPMIPCN-ESCSVVGKVI-ASQ  133 (133)
T ss_dssp             ETTSCCCTTSEEEEEETTTEEEEEEEEEE-TTEEEEECSSTTSCCEECS-TTEEEEEEEE-EEC
T ss_pred             ECCCCCCCCCEEEEEECCCCEEEEEEEEE-CCEEEEEECCCCCCCCCCC-CCEEEEEEEE-EEC
T ss_conf             71463465886999994687699999984-9989999799998978269-9839999999-829


No 6  
>1kca_A Repressor protein CI; gene regulation, DNA-binding, lambda repressor, protein oligomerization, DNA-looping; 2.91A {Enterobacteria phage lambda} SCOP: b.87.1.1
Probab=99.79  E-value=1.1e-18  Score=139.57  Aligned_cols=87  Identities=17%  Similarity=0.268  Sum_probs=79.6

Q ss_pred             CCCCEEEEEECCCCC------CCCCCCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEE
Q ss_conf             368559999628332------42148786899936897405888999971796899999997798799996858988758
Q gi|254780444|r  133 IQTQDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT  206 (223)
Q Consensus       133 ~~~~~~~l~V~GDSM------~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~  206 (223)
                      .++++|+++|+||||      +|.|++||+|+||++.++.+|++|+|...++++++|||.+. ++.++|.|+||+|+++.
T Consensus         9 ~~~~~F~l~V~GdSM~~~~g~ep~i~~GdiviVd~~~~~~~G~ivva~~~~~~~~~Krl~~~-~~~i~L~s~Np~y~~i~   87 (109)
T 1kca_A            9 ASDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRD-SGQVFLQPLNPQYPMIP   87 (109)
T ss_dssp             CCSSCEEEECCSSTTCCCTTCSSCCCTTCEEEEETTSCCCTTCEEEEECSTTCEEEEEEEEE-TTEEEEECSSTTSCCEE
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEECCCEEEEEEEEEE-CCEEEEEECCCCCCCEE
T ss_conf             79999999997866788866789639999999982586678999999996999999999997-99899997998989891


Q ss_pred             ECHHHEEEEEEEEEE
Q ss_conf             547865999779985
Q gi|254780444|r  207 VEMSDIEWIARILWA  221 (223)
Q Consensus       207 i~~~~i~iigrVvw~  221 (223)
                      ++ ++++|+|+|||.
T Consensus        88 ~~-~~~~IiG~Vv~~  101 (109)
T 1kca_A           88 CN-ESCSVVGKVIAS  101 (109)
T ss_dssp             CC-TTCEEEEEEEEE
T ss_pred             CC-CCCEEEEEEEEE
T ss_conf             69-984999999889


No 7  
>1umu_A UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair, beta- lactamase cleavage reaction, LEXA repressor, lambda CI; 2.50A {Escherichia coli} SCOP: b.87.1.1 PDB: 1i4v_A 1ay9_A
Probab=99.69  E-value=1.4e-16  Score=125.94  Aligned_cols=87  Identities=23%  Similarity=0.327  Sum_probs=75.8

Q ss_pred             CCCCEEEEEECCCCC-CCCCCCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHH-
Q ss_conf             368559999628332-421487868999368974058889999717968999999977987999968589887585478-
Q gi|254780444|r  133 IQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-  210 (223)
Q Consensus       133 ~~~~~~~l~V~GDSM-~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~-  210 (223)
                      .+.++|+++|+|||| +|.|.+||+|+||++.++.+|+++++... |+.++|||+. .+ .+.|.|+||+|+|+.++.+ 
T Consensus        23 ~~~~~f~lrV~GdSM~~~~I~~gD~liv~~~~~~~~g~ivv~~i~-ge~tvKrl~~-~~-~i~L~~~Np~y~pi~i~~~~   99 (116)
T 1umu_A           23 HPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVD-GEFTVKKLQL-RP-TVQLIPMNSAYSPITISSED   99 (116)
T ss_dssp             CGGGEEEEECCSSTTGGGTCCTTCEEEEETTSCCCTTCEEEEEET-TEEEEEEEEC-SS-SCEEECSSTTSCCEECCTTS
T ss_pred             CCCCEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEEC-CEEEEEEEEE-CC-CEEEECCCCCCCCEECCCCC
T ss_conf             987609999928885668668998999863678641759999978-8899999997-89-69998499999986848999


Q ss_pred             HEEEEEEEEEEE
Q ss_conf             659997799852
Q gi|254780444|r  211 DIEWIARILWAS  222 (223)
Q Consensus       211 ~i~iigrVvw~~  222 (223)
                      +++|+|+|+|+-
T Consensus       100 ~~~I~G~Vv~~i  111 (116)
T 1umu_A          100 TLDVFGVVIHVV  111 (116)
T ss_dssp             CEEEEEEEEEEE
T ss_pred             CEEEEEEEEEEE
T ss_conf             789999999999


No 8  
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15
Probab=99.31  E-value=5.8e-11  Score=89.65  Aligned_cols=67  Identities=12%  Similarity=0.233  Sum_probs=61.2

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      ..+|+++|+++|+++|||+.+||+++|++.+++++|++|...     |+.++|.+||+++++++.+|.....
T Consensus         9 ~~~ig~rir~~R~~~gls~~~lA~~~gvs~~~ls~iE~g~~~-----ps~~~l~~ia~~l~v~~~~l~~~~~   75 (192)
T 1y9q_A            9 KSQIANQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESS-----PTIATLWKIASGLEASFSAFFANDP   75 (192)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHHSSCHHHHHHHHTTCSC-----CCHHHHHHHHHHHTCCSGGGGTTST
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHCCCCC
T ss_conf             999999999999981999999999989399999999869987-----7634799999885568999547996


No 9  
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A
Probab=99.30  E-value=2.6e-10  Score=85.48  Aligned_cols=74  Identities=14%  Similarity=0.034  Sum_probs=62.7

Q ss_pred             CCCCC--HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             97755--8999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    1 MTSFS--HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         1 ~~~~~--~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      |+...  ..+++++|+++|+++|||+.+||+++|+|+++|+++++|..    ..|++.+|.|||+++++++.+|......
T Consensus         1 ms~~~~~~~~lg~rir~lR~~~gltl~eLA~~~GvS~~~lS~iE~G~~----~~psl~~L~kia~aL~v~~~~l~~~~~~   76 (198)
T 2bnm_A            1 MSNTKTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEG----GELTLTQLGRIAHVLGTSIGALTPPAGN   76 (198)
T ss_dssp             ----CHHHHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTTC----TTCBHHHHHHHHHHTTSCTGGGSCCCCC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC----CCCCHHHHHHHHHHHCCCHHHHCCCCCC
T ss_conf             987036689999999999998599999999887979999998673898----8998999999999979799998186422


No 10 
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor A3}
Probab=99.08  E-value=3.6e-10  Score=84.55  Aligned_cols=68  Identities=13%  Similarity=0.157  Sum_probs=61.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC--CCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             97755899999999999964999889999828--99879889975157887557798999998732187521000
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAG--LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~G--v~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      |++-....|+++|+.+|+++||||.+||+++|  ++++++++|++|...     |+.+.|.++|+++++++++|+
T Consensus         1 M~~~~~~~ig~rir~~R~~~gltq~elA~~~g~~is~~~is~~E~G~~~-----ps~~~l~~la~~l~v~~~~Ll   70 (71)
T 2ewt_A            1 MSSEYAKQLGAKLRAIRTQQGLSLHGVEEKSQGRWKAVVVGSYERGDRA-----VTVQRLAELADFYGVPVQELL   70 (71)
T ss_dssp             CCHHHHHHHHHHHHHHHHHTTCCHHHHHHHTTTSSCHHHHHHHHHTCSC-----CCHHHHHHHHHHHTSCGGGGC
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHC
T ss_conf             9738999999999999988499899999898887479999999859966-----768999999999896899978


No 11 
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua}
Probab=99.07  E-value=1.5e-10  Score=86.92  Aligned_cols=69  Identities=13%  Similarity=0.185  Sum_probs=61.8

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             58999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      -.++++++|+.+|+++|+||++||+++|++++++++|++|...     |+.+.|.+||++++++++||+.....
T Consensus         6 ~~~~~g~rlk~~R~~~gltq~elA~~~gvs~~~vs~~E~g~~~-----Ps~~~l~~ia~~l~vs~~~Ll~~~~~   74 (114)
T 3op9_A            6 IQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYMSGETK-----PDIEKLIRLATYFHLSIDELVGYVQE   74 (114)
T ss_dssp             CCCCHHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHHTSSC-----CCHHHHHHHHHHHTCCHHHHHTCCCC
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCCCCC
T ss_conf             9999999999999985999999976108873279999658789-----99999999999959989999288753


No 12 
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1}
Probab=98.99  E-value=1.4e-09  Score=80.80  Aligned_cols=67  Identities=21%  Similarity=0.309  Sum_probs=59.2

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             89999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .+-|.++|+.||+++|+|+.+||+++|++++++++|++|.    .+.|+.++|.+||+++++++++|....
T Consensus         5 ~~~i~~ri~~lr~~~gls~~~LA~~~Gis~~tis~~e~g~----~~~p~~~~l~kia~~l~v~~~~l~~~~   71 (78)
T 3b7h_A            5 GEFVSEHLMELITQQNLTINRVATLAGLNQSTVNAMFEGR----SKRPTITTIRKVCGTLGISVHDFFDFP   71 (78)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHCTT----CCCCCHHHHHHHHHHHTCCHHHHTCST
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCC----CCCCHHHHHHHHHHHHCCCHHHHCCCC
T ss_conf             9999999999999939989999998893999999998699----889689999999999899399990998


No 13 
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli CFT073} SCOP: a.35.1.3 PDB: 2icp_A
Probab=98.99  E-value=5.2e-10  Score=83.49  Aligned_cols=71  Identities=15%  Similarity=0.142  Sum_probs=63.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             9775589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      |+|.-|.-.++.|+.+|+++|+||++||+++|+++++|++|++|..     .|+.+.+.++++++|+++++|+...
T Consensus         1 m~~~~~~hPG~~Lk~~r~~~gltq~~lA~~lgvs~~~is~~e~G~~-----~~s~~~~~~la~~lgvs~~~ll~~q   71 (94)
T 2ict_A            1 MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKA-----ALTPEMAIKLSVVIGSSPQMWLNLQ   71 (94)
T ss_dssp             CCCTTCCCHHHHHHHHHHHHTCCHHHHHHHHTCCHHHHHHHHHTSS-----CCCHHHHHHHHHHTCSCHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHCCH
T ss_conf             9999999989999999999699999999984963899869872764-----4729999999999990999997433


No 14 
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3
Probab=98.98  E-value=7.8e-10  Score=82.33  Aligned_cols=65  Identities=25%  Similarity=0.248  Sum_probs=57.6

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      |+++|+.+|+++|||+.+||+++|+++++|++|++|..    ..|+.++|.++|++++++++||++...
T Consensus         2 iG~rlr~lR~~~g~tq~~lA~~~Gvs~~~is~~E~G~~----~~p~~~~l~~ia~~l~v~~~~l~~~~~   66 (111)
T 1b0n_A            2 IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQ----TNPSIQFLEKVSAVLDVSVHTLLDEKH   66 (111)
T ss_dssp             CHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCC----SCCCHHHHHHHHHHHTCCHHHHHCCTT
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC----CCCCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             79999999998399999998784988999999987998----999999999999998987999848986


No 15 
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile 630}
Probab=98.98  E-value=1.6e-09  Score=80.36  Aligned_cols=67  Identities=15%  Similarity=0.254  Sum_probs=60.4

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      ...|+++|+.+|+++||||.+||.++|++++++++|++|..     .|+.+.|.++|++++++++|++....
T Consensus        10 ~~~ig~rlk~~R~~~gltq~elA~~lgvs~s~is~~E~G~~-----~ps~~~l~~ia~~l~v~~~~l~~~~~   76 (126)
T 3ivp_A           10 FRALGLAIKEARKKQGLTREQVGAMIEIDPRYLTNIENKGQ-----HPSLQVLYDLVSLLNVSVDEFFLPAS   76 (126)
T ss_dssp             THHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHHSCC-----CCCHHHHHHHHHHHTCCSHHHHSCCC
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCC-----CCCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             99999999999998499999996730999879999970777-----99999999999997968999828887


No 16 
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional activator, human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A
Probab=98.95  E-value=1.2e-09  Score=81.08  Aligned_cols=67  Identities=16%  Similarity=0.170  Sum_probs=60.2

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      ++.|+++|+.+|+++|+||.+||+++|++++++++|++|...     |+.+.|.++|+++++++++|+....
T Consensus        26 ~~~iG~rLk~~R~~~glSq~~lA~~~gis~~~ls~~E~g~~~-----ps~~~l~~ia~~l~v~~~~ll~~~~   92 (117)
T 3f52_A           26 REALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKE-----VSSELLASVCHALGASVADVLIEAA   92 (117)
T ss_dssp             HHHHHHHHHHHHHHHTCCHHHHHHHTTSCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHHCCC
T ss_conf             999999999999981999999998853339999999869989-----9999999999998997999962444


No 17 
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656}
Probab=98.95  E-value=2.1e-09  Score=79.58  Aligned_cols=64  Identities=16%  Similarity=0.170  Sum_probs=57.6

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .+.++|..||+++|+||.+||+++|++++++++|++|..     .|+.+.+.+||+++++++.++....
T Consensus         9 ~f~~~Lk~lr~~~~lsq~elA~~lgvs~~~is~~e~G~~-----~ps~~~l~~la~~l~v~~~~l~~~~   72 (94)
T 2kpj_A            9 IFSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIA-----IPRMGKVQALADYFNINKSDLIEDK   72 (94)
T ss_dssp             HHHHHHHHHHTTSSSCHHHHHHHHTCCHHHHHHHHTTSC-----CCCHHHHHHHHHHHTCCTHHHHSCS
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             999999999999499899999988928836999973767-----9999999999999897899990888


No 18 
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2
Probab=98.93  E-value=1.2e-09  Score=81.14  Aligned_cols=68  Identities=18%  Similarity=0.225  Sum_probs=60.7

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             8999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      .+.|+++|+++|+++|+||.+||+++|++++++++|++|...     |+.+.|.++|++++++++|++.....
T Consensus         3 ~~~ig~rik~~R~~~glsq~~la~~~gvs~~~i~~~e~G~~~-----p~~~~l~~ia~~~~v~~~~ll~~~~~   70 (76)
T 1adr_A            3 TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALSKALQCSPDYLLKGDLS   70 (76)
T ss_dssp             SCCHHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHTTSSC-----CCHHHHHHHHHHTTSCHHHHHHTCSC
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCCCCC
T ss_conf             899999999999993999999999979699999999879989-----99999999999969889999579996


No 19 
>3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A
Probab=98.93  E-value=2.1e-08  Score=73.10  Aligned_cols=65  Identities=17%  Similarity=0.079  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      .+.|+..++++|+|..+||+++|++.+++++++|+..    ..|++.+|.|||+++++++.+|......
T Consensus       232 ~slLk~~rk~RGLTL~eLAkrTGIS~S~LSqIERngk----s~PSl~tL~KIA~AL~V~lsdLf~~~~~  296 (443)
T 3g7d_A          232 GSVLDLFLARRAHTRTSAAEAAGVPPADLEAALRSPA----SETGLTVLRTLGRALGFDYRVLLPADDQ  296 (443)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHHCTT----SHHHHHHHHHHHHHHTCCGGGGSCCCCC
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCC----CCCCHHHHHHHHHHCCCCHHHHCCCCCC
T ss_conf             8999999997188899999886989999999985688----8988999999999729999997488776


No 20 
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii}
Probab=98.92  E-value=4e-10  Score=84.24  Aligned_cols=68  Identities=21%  Similarity=0.281  Sum_probs=59.8

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             5589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      ++.+.|..+|+.+|+++|+||.+||+++|++++++++|++|...     |+.+.+.++|+++++++++|+...
T Consensus         4 m~~~~i~~rIk~~r~~~g~tq~~lA~~lgis~~~is~~e~G~~~-----p~~~~l~~ia~~~~v~~~~Ll~~~   71 (73)
T 3omt_A            4 MTERKIFNRLKSVLAEKGKTNLWLTETLDKNKTTVSKWCTNDVQ-----PSLETLFDIAEALNVDVRELIVST   71 (73)
T ss_dssp             -CCCCCCBCHHHHHHHHTCCHHHHHHHTTCCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTSCGGGGBCCC
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHCCCC
T ss_conf             34889999999999993998999999859986678999849889-----986799999999894899981657


No 21 
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A
Probab=98.92  E-value=2.4e-09  Score=79.21  Aligned_cols=70  Identities=20%  Similarity=0.205  Sum_probs=61.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             775589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .++--..|+.+|+++|+++|+||.+||+++|++++++++|++|..+     |+.+.+.++|+++++++.++....
T Consensus        22 ~~~~~~~ig~~Ik~lR~~~glsq~elA~~~gis~~~is~iE~G~~~-----ps~~~l~~ia~~l~v~~~~l~~~~   91 (99)
T 3g5g_A           22 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRN-----LTIKSLELIMKGLEVSDVVFFEML   91 (99)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCSC-----CBHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             8999999999999999981999999999979789889999869989-----999999999999699899997614


No 22 
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, bacterial persistence, serine kinase, mercury derivative, SAD; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B*
Probab=98.91  E-value=3.7e-09  Score=77.93  Aligned_cols=68  Identities=18%  Similarity=0.219  Sum_probs=60.4

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             5589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .+..+|+.+|+.+|+++||||.+||+++|+++++|++|++|..     .|+.+.|.++|++++++++++....
T Consensus         8 ~~~~~lg~~lr~~R~~~glsq~~lA~~~gvs~~~is~~E~g~~-----~ps~~~l~~ia~~lgv~~~~~~~~~   75 (88)
T 2wiu_B            8 YSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPD-----NTTLTTFFKILQSLELSMTLCDAKN   75 (88)
T ss_dssp             CSHHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHHCGG-----GCBHHHHHHHHHHTTCEEEEEC---
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCEEEEECCC
T ss_conf             8999999999999998599999997863998999999987999-----9999999999999699408645799


No 23 
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3
Probab=98.91  E-value=2.5e-09  Score=79.11  Aligned_cols=67  Identities=21%  Similarity=0.177  Sum_probs=59.8

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      .+.|+.+|+.+|+++|+||.+||+++|++++++++|++|..     .|+.+.+.++|+++++++++|....+
T Consensus         8 ~~~ig~~ir~~R~~~gltq~~lA~~~gvs~~~i~~~E~g~~-----~ps~~~l~~la~~l~v~~~~l~~~~e   74 (77)
T 2b5a_A            8 KRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDR-----NISLINIHKICAALDIPASTFFRKME   74 (77)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCS-----CCBHHHHHHHHHHTTCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             99999999999998199999999897969999999987998-----99999999999997988999854325


No 24 
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp}
Probab=98.91  E-value=9.6e-10  Score=81.77  Aligned_cols=63  Identities=10%  Similarity=0.055  Sum_probs=57.5

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             99999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      |+.+|+.||+++||||.+||+++|++++++++|++|...     |+.+.|.++|++++++++++....
T Consensus        24 ~~~~Lk~lR~~~glTq~elA~~lgvs~~tis~~E~G~~~-----Ps~~~L~kla~~l~vs~~~ll~~~   86 (111)
T 3mlf_A           24 AMKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTN-----IKDSLLSKYMSAFNVKYDDIFLGN   86 (111)
T ss_dssp             SCEEHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHHCCTT-----CCHHHHHHHHHHHTCCGGGEECCC
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHCCCC
T ss_conf             999999999985999999999969899999999849999-----999999999999894899991798


No 25 
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L*
Probab=98.89  E-value=1.9e-09  Score=79.83  Aligned_cols=65  Identities=20%  Similarity=0.095  Sum_probs=55.8

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99999999996499988999982899879889975157887557798999998732187521000011112
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD   79 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~~   79 (223)
                      |.++|+.+|+++|+||.+||+++|++++++++|++|..      |..+.|.++|++++++++||+.+....
T Consensus         4 i~~rik~~r~~~gltq~elA~~~gis~~~is~~e~g~~------~~~~~l~~ia~~l~v~~~~Ll~g~~~~   68 (71)
T 1zug_A            4 LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVT------KRPRFLFEIAMALNCDPVWLQYGTKRG   68 (71)
T ss_dssp             HHHHHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTCC------SSCSTHHHHHHHTTSCHHHHHHSCCCC
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC------CCHHHHHHHHHHHCCCHHHHHCCCCCC
T ss_conf             99999999999399999997841989999999987999------999999999999499799984199866


No 26 
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis nctc 9343}
Probab=98.88  E-value=1.2e-09  Score=81.18  Aligned_cols=66  Identities=17%  Similarity=0.155  Sum_probs=58.5

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             99999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      +.++.+|+.+|+++|+||.+||+++|++++++++|++|...     |+.+.+.++|++++++++||+....
T Consensus         9 ~~i~~rik~~r~~~gltq~~lA~~~gvs~~tis~~e~g~~~-----p~~~~l~~ia~~l~v~~~~ll~~~~   74 (76)
T 3bs3_A            9 QMMLNRIKVVLAEKQRTNRWLAEQMGKSENTISRWCSNKSQ-----PSLDMLVKVAELLNVDPRQLINGKI   74 (76)
T ss_dssp             -CCCBCHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTSCGGGGBC---
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             99999999999990998999999988899999999859999-----9999999999997997999966887


No 27 
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3
Probab=98.87  E-value=6.4e-09  Score=76.43  Aligned_cols=61  Identities=21%  Similarity=0.178  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      +|+++|+.+|+++|+||.+||+++|++++++++|++|..     .|+.+.+.++++++++++++|.
T Consensus        13 ~ig~~ik~~R~~~gltq~~lA~~~gis~~~i~~~E~g~~-----~p~~~~l~~ia~~l~v~~~~lF   73 (74)
T 1y7y_A           13 KFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQR-----NVSLVNILKLATALDIEPRELF   73 (74)
T ss_dssp             HHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTCS-----CCBHHHHHHHHHHTTSCGGGGC
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHC
T ss_conf             999999999998199999999896979999999987998-----9999999999999893999984


No 28 
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response element family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV}
Probab=98.87  E-value=4.1e-09  Score=77.67  Aligned_cols=69  Identities=10%  Similarity=0.034  Sum_probs=61.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             89999999999996499988999982899879889975157887557798999998732187521000011112
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD   79 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~~   79 (223)
                      ++.|.++|+++|+++||||.+||+++|++++++++|++|..     .|+.+.+.++|+++++++.++.......
T Consensus        12 ~~~l~~~lk~~R~~~gltq~elA~~~gvs~~~is~~E~g~~-----~~~~~~l~~la~~l~v~~~~l~~~~~~~   80 (83)
T 3f6w_A           12 YQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAER-----RLDVIEFMDFCRGIGTDPYALLSKLEAM   80 (83)
T ss_dssp             HHHHHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHTTSS-----CCCHHHHHHHHHHHTCCHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHHHHHCC
T ss_conf             99999999999998299999999897389999999987998-----9999999999999599999998530136


No 29 
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei}
Probab=98.86  E-value=6e-09  Score=76.60  Aligned_cols=68  Identities=15%  Similarity=0.105  Sum_probs=59.8

Q ss_pred             HHHHHHHHHHHHH--HCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             8999999999999--649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    6 HKKIWEAIDRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         6 ~~~i~~~i~~l~~--~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      ..+|+.+|..+|+  ++||||.+||+++|+++++|++|++|...     |+.+.|.+|+++|++++.++..+...
T Consensus        32 ~~~iG~~I~~~R~~~~kglTQ~eLA~~lgvs~~~is~~E~G~~~-----ps~~~l~kia~~L~V~L~~~~~g~p~  101 (107)
T 2jvl_A           32 GKEVGKAIEQGRQKFEPTMTQAELGKEIGETAATVASYERGTAT-----PDQNILSKMERVLNVKLRGANIGAPR  101 (107)
T ss_dssp             CHHHHHHHHHHHTTSSSCCCHHHHHHHHTCCHHHHHHHTTTCSC-----CCHHHHHHHHHTTTCBSSSSSTTBCS
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             49999999999999886998999999988789999999859978-----99999999999949967665489988


No 30 
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L
Probab=98.86  E-value=3.9e-09  Score=77.79  Aligned_cols=64  Identities=17%  Similarity=0.223  Sum_probs=58.2

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             999999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      +.|+++|+++|+++|+||.+||+++|++++++++|++|...     |+.+.+.+++++++++++||+.+
T Consensus         4 ~~ig~rlr~~R~~~glsq~~la~~~gvs~~~i~~~e~g~~~-----p~~~~l~~la~~l~v~~~~ll~g   67 (68)
T 2r1j_L            4 QLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALSKALQCSPDYLLKG   67 (68)
T ss_dssp             CCHHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHTTSSC-----CBHHHHHHHHHHTTSCHHHHHHC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHCC
T ss_conf             99999999999985999999988739999999999879989-----99999999999979979998587


No 31 
>3clc_A Regulatory protein; protein-DNA complex, transcriptional regulator, helix-turn- helix, DNA-bending, plasmid, transcription regulator/DNA complex; 2.80A {Enterobacter SP}
Probab=98.86  E-value=4.7e-09  Score=77.29  Aligned_cols=72  Identities=21%  Similarity=0.203  Sum_probs=62.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             97755899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      |..+--.+|..+|+++|+++|+||.+||+++|++++++++|++|..     .|+.+.+.++|+++++++.++.....
T Consensus         4 m~~~~~~~i~~~lk~~R~~~glsq~~lA~~~gis~~~i~~~E~G~~-----~ps~~~l~~la~~l~i~~~~l~~~~~   75 (82)
T 3clc_A            4 MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSR-----NLTIKSLELIMKGLEVSDVVFFEMLI   75 (82)
T ss_dssp             -CCHHHHHHHHHHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTCC-----CCBHHHHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHCCCH
T ss_conf             7899999999999999998399999995703998879999985998-----99999999999997988999977068


No 32 
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12
Probab=98.83  E-value=1.5e-08  Score=74.10  Aligned_cols=63  Identities=17%  Similarity=0.070  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             99999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      +|+++|+.+|+++||||.+||+++|+++++|++|++|...     |+.+.+.+++++|++++.+....
T Consensus        13 ~ig~~ik~~R~~~glsq~elA~~~gvs~~~is~~E~G~~~-----p~~~~l~kia~~L~v~L~~~~~~   75 (91)
T 1x57_A           13 EVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAI-----PNNQVLGKIERAIGLKLRGKDIG   75 (91)
T ss_dssp             HHHHHHHHHHHTTTCCHHHHHHHHTSCHHHHHHHHHTCSC-----CCHHHHHHHHHHHTBCCSSTTTT
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCCCCCCCC
T ss_conf             9999999999981998999998719899999999879988-----99999999999949986455578


No 33 
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A
Probab=98.83  E-value=3.5e-09  Score=78.12  Aligned_cols=65  Identities=15%  Similarity=0.106  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99999999996499988999982899879889975157887557798999998732187521000011112
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD   79 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~~   79 (223)
                      |.++|+++|+++|+||.+||+++|++++++++|++|..      |+.+.+.++|++++++++||+.+....
T Consensus         2 ig~rik~~R~~~gltq~elA~~~gis~~~~~~~e~g~~------~~~~~l~~ia~~l~v~~~~l~~g~~~~   66 (69)
T 1r69_A            2 ISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKT------KRPRFLPELASALGVSVDWLLNGTSDS   66 (69)
T ss_dssp             HHHHHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTSC------SSCTTHHHHHHHTTCCHHHHHHCC---
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC------CCHHHHHHHHHHHCCCHHHHHCCCCCC
T ss_conf             89999999999499999998863989999999986999------899999999999698899982899976


No 34 
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A
Probab=98.82  E-value=8.3e-09  Score=75.68  Aligned_cols=64  Identities=19%  Similarity=0.149  Sum_probs=55.5

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH--CCCCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557798999998732--187521000011
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA--TNETICQLLDLP   76 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~--~~v~~~~l~~~~   76 (223)
                      .|+++|+.+|+++||||++||+++|++++++++|++|..     .|+.+.|.+++.+  ++++..||....
T Consensus         4 ~ig~rik~~R~~~gltq~elA~~~Gis~~tis~~E~g~~-----~p~~~~l~~ia~~~~~~~~~~wll~~~   69 (99)
T 2l49_A            4 TISEKIVLMRKSEYLSRQQLADLTGVPYGTLSYYESGRS-----TPPTDVMMNILQTPQFTKYTLWFMTNQ   69 (99)
T ss_dssp             CTTHHHHHHHHHTTCCHHHHHHHHCCCHHHHHHHTTTSS-----CCCHHHHHHHHSSSSSSSSSSTTTSSC
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHCCCCCCCHHHHHCCC
T ss_conf             999999999999399999999996989999999987998-----799899999986037786478885699


No 35 
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda}
Probab=98.81  E-value=1.5e-08  Score=74.01  Aligned_cols=68  Identities=7%  Similarity=0.019  Sum_probs=58.0

Q ss_pred             CCCHHH------HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             755899------9999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r    3 SFSHKK------IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         3 ~~~~~~------i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      +||.++      +.+.|+.+|++.|+||.+||+++|++++++++|++|...     |+.+.+.+++++++++++++...
T Consensus         1 ~~t~e~~~~~~~l~~~~~~~R~~~gltq~elA~~lgvs~~~is~~E~G~~~-----p~~~~l~~ia~~l~v~~~~~~~~   74 (80)
T 3kz3_A            1 SLTQEQLEDARRLKAIWEKKKNELGLSYESVADKMGMGQSAVAALFNGINA-----LNAYNAALLAKILKVSVEEFSPS   74 (80)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHTTSCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTSCGGGTCHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHCHH
T ss_conf             989899999999999999999993999999966209889889999879978-----99999999999989889998748


No 36 
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, helix-turn-helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae TIGR4}
Probab=98.80  E-value=4.6e-10  Score=83.85  Aligned_cols=64  Identities=23%  Similarity=0.187  Sum_probs=57.7

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      |+++|+++|+++|+||++||+++|+++++|++|++|..     .|+.+.|.++|++++++++||.....
T Consensus         2 iG~rik~lR~~~glsq~eLA~~~Gis~~~is~~E~G~~-----~ps~~~l~~la~~l~v~~~~ll~~~~   65 (158)
T 2p5t_A            2 IGKNIKSLRKTHDLTQLEFARIVGISRNSLSRYENGTS-----SVSTELIDIICQKFNVSYVDIVGEDK   65 (158)
T ss_dssp             ---------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHCCCC
T ss_conf             78999999998499999999998959999999987998-----99999999999993998999836875


No 37 
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae}
Probab=98.78  E-value=4.5e-09  Score=77.44  Aligned_cols=67  Identities=16%  Similarity=0.083  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      +.++++|.+||+++||||.+||+++|++++++++|++|...     |+.+.+.++++++++++++|....+.
T Consensus        67 ~~~G~~l~~lR~~~glTQ~elA~~~gis~~~is~iE~G~~~-----ps~~~l~kia~~lgvs~~el~~~~e~  133 (141)
T 3kxa_A           67 KAGGETFVSLRMKKGFTQSELATAAGLPQPYLSRIENSKQS-----LQDKTVQKLANALGVSPLEVRAAFER  133 (141)
T ss_dssp             HHSSCCHHHHHHHTTCCHHHHHHHTTCCHHHHHHHHHTCSC-----CCHHHHHHHHHHHTCCHHHHHHHHGG
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999999999982998999999989699999999879978-----99999999999949989999865540


No 38 
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13
Probab=98.78  E-value=1.7e-08  Score=73.71  Aligned_cols=67  Identities=12%  Similarity=0.046  Sum_probs=58.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             75589999999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      |.-..++..+|.++|+++||||.+||+++|+++++|+++++|.    .+.|+.++|.++|+++|++++...
T Consensus        13 M~lr~~L~~~Ir~~R~~~glTQ~elA~~~gvs~~~is~iE~G~----~~~~s~~~L~~ia~aLg~~v~i~~   79 (83)
T 2a6c_A           13 MKMRSQLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGK----IDLFSLESLIDMITSIGLKVEINI   79 (83)
T ss_dssp             HHHHHHHHHHHHHHHHTTTCCHHHHHHHHTSCHHHHHHHHTTC----GGGCCHHHHHHHHHHTTCCCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCC----CCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             6999999999999999959999999999877899999998799----999899999999999299638872


No 39 
>1utx_A CYLR2; DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix; 1.90A {Enterococcus faecalis} SCOP: a.35.1.3 PDB: 2gzu_A
Probab=98.76  E-value=1e-08  Score=75.14  Aligned_cols=61  Identities=16%  Similarity=0.207  Sum_probs=54.7

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .+|+.+|+++|+||.+||+++|++++++++|++|..     .|+.+.+.+++++++++++++....
T Consensus         4 nri~~lR~~~g~tq~~lA~~~gis~~~is~~e~g~~-----~ps~~~l~~ia~~l~v~~~~lf~~e   64 (66)
T 1utx_A            4 NNLKLIREKKKISQSELAALLEVSRQTINGIEKNKY-----NPSLQLALKIAYYLNTPLEDIFQWQ   64 (66)
T ss_dssp             ECHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTSC-----CCCHHHHHHHHHHTTSCHHHHEEEC
T ss_pred             HHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHCCCC
T ss_conf             999999998499999998872998999999987998-----9999999999999897799982989


No 40 
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A*
Probab=98.75  E-value=2.6e-08  Score=72.44  Aligned_cols=64  Identities=6%  Similarity=0.019  Sum_probs=56.6

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             999999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      +++.+.|+++|++.|+||.+||+.+|++++++++|++|...     |+.+.|.++|++++++++++...
T Consensus        16 ~~l~~~l~~~R~~~glTQ~~lA~~lgis~~~is~~E~G~~~-----~s~~~l~~la~~l~v~~~~l~~~   79 (92)
T 1lmb_3           16 RRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINA-----LNAYNAALLAKILKVSVEEFSPS   79 (92)
T ss_dssp             HHHHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHTTSSC-----CCHHHHHHHHHHHTSCGGGTCHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCHHHHHHH
T ss_conf             99999999999992999999999884789899999779989-----99999999999989879999766


No 41 
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2}
Probab=98.69  E-value=2.4e-08  Score=72.68  Aligned_cols=64  Identities=17%  Similarity=0.281  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD   74 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~   74 (223)
                      .+.|.+.|+++|+++|+||.+||+++|++++++++|++|...     |+.+.+.++++++|+++....+
T Consensus         8 ~~~l~~~lk~~R~~~gltq~elA~~~gvs~~~is~~E~G~~~-----~s~~~l~~i~~~lg~~~~~~~d   71 (84)
T 2ef8_A            8 YRCLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERR-----LDALELFELLEVVASRLGLPMD   71 (84)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTSSC-----CBHHHHHHHHHHHHHHHTCCHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHCCCCCCCHH
T ss_conf             999999999999994999999999974799999999879999-----9999999999994898585399


No 42 
>3cec_A Putative antidote protein of plasmid maintenance system; ZP_00107635.1, structural genomics, joint center for structural genomics; HET: MSE; 1.60A {Nostoc punctiforme pcc 73102}
Probab=98.66  E-value=3.6e-08  Score=71.60  Aligned_cols=63  Identities=11%  Similarity=0.074  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             99999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      .++.|+.+|+++|+||++||+++|++++++++|++|..     .|+.+.+.++++++++++++++...
T Consensus        19 PGe~Lke~~~~~gisq~eLA~~lGvs~~~is~~e~G~~-----~~s~~~a~~La~~lgvs~~~~l~lQ   81 (104)
T 3cec_A           19 PGEVIADILDDLDINTANFAEILGVSNQTIQEVINGQR-----SITVDIAIRLGKALGNGPRLWLNLQ   81 (104)
T ss_dssp             HHHHHHHHHHHHTCCHHHHHHHHTSCHHHHHHHHTTSS-----CCCHHHHHHHHHHHTSCHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             34999999998799899999997837899999975887-----8989999999999891999998508


No 43 
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomics; 1.80A {Silicibacter pomeroyi}
Probab=98.64  E-value=8.2e-08  Score=69.24  Aligned_cols=58  Identities=16%  Similarity=0.086  Sum_probs=52.5

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET   68 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~   68 (223)
                      |..+.++|+.+|+++||||.+||+++|+++++|++|++|...     |+.+.+.++++++++.
T Consensus        12 ~~~lg~~lk~~R~~~gltq~elA~~lgvs~~~is~~E~G~~~-----~~~~~l~~i~~aL~~~   69 (86)
T 3eus_A           12 HVYLCQRLRQARLDAGLTQADLAERLDKPQSFVAKVETRERR-----LDVIEFAKWMAACEGL   69 (86)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHTTCCHHHHHHHHTTSSC-----CBHHHHHHHHHHTTCG
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHCCCC
T ss_conf             999999999999984999999999979699999999889999-----9999999999990897


No 44 
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PSI, protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3
Probab=98.63  E-value=8.1e-08  Score=69.30  Aligned_cols=66  Identities=11%  Similarity=0.077  Sum_probs=55.9

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      ++++++|+++|+  |+|+++||+++|++++++++|++|.    .+.|+.++|.+||+++++++++|+.....
T Consensus        15 ~~lG~~lr~~R~--~~s~~elA~~~gis~~~is~iE~G~----~~~~s~~~l~~ia~~L~v~~~~Ll~~~~~   80 (86)
T 2ofy_A           15 QRLGELLRSARG--DMSMVTVAFDAGISVETLRKIETGR----IATPAFFTIAAVARVLDLSLDDVAAVVTF   80 (86)
T ss_dssp             HHHHHHHHHHHT--TSCHHHHHHHHTCCHHHHHHHHTTC----CSSCBHHHHHHHHHHTTCCHHHHHTTCCC
T ss_pred             HHHHHHHHHHHH--CCCHHHHHHHHCCCHHHHHHHHCCC----CCCCHHHHHHHHHHHHCCCHHHHHHCCCC
T ss_conf             999999999998--7899999999797999999998699----78875999999999989789999624468


No 45 
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12}
Probab=98.49  E-value=5.3e-08  Score=70.50  Aligned_cols=67  Identities=19%  Similarity=0.208  Sum_probs=50.5

Q ss_pred             CCCCCHHHH-HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             977558999-9999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    1 MTSFSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         1 ~~~~~~~~i-~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      |..+..+.+ .+.|+++|+++||||.+||+++|++++|+++|++|...     |+. .+.+++.+++++++++.
T Consensus         3 m~~~~~~~~~p~~ik~~R~~~gltQ~elA~~lgvs~~ti~~~E~G~~~-----P~~-~~~~l~~~l~~~P~~l~   70 (73)
T 3fmy_A            3 MASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAX-----PHP-STIKLLRVLDKHPELLN   70 (73)
T ss_dssp             -----CCCCCHHHHHHHHHHTTCCHHHHHHHHCSCTTHHHHHHTTSSC-----CCH-HHHHHHHHHHHCGGGHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCH-HHHHHHHHHCCCHHHHH
T ss_conf             675552215999999999985999999999989799999999979979-----999-99999999877918888


No 46 
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A
Probab=98.35  E-value=6.6e-07  Score=63.40  Aligned_cols=65  Identities=14%  Similarity=0.076  Sum_probs=57.4

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             99999999999649998899998289987988997515788755779899999873218752100001111
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      +|++.|+.+|+++|+||+++|.. ++|++++++|++|...     |+.+.|.++++.++++++++......
T Consensus         3 ~iG~~~k~~R~~~~ltq~~~a~~-~~s~s~ls~~E~g~~~-----~s~~~l~~l~~~l~v~~~ef~~~~~~   67 (317)
T 2awi_A            3 KIGSVLKQIRQELNYHQIDLYSG-IMSKSVYIKVEADSRP-----ISVEELSKFSERLGVNFFEILNRAGM   67 (317)
T ss_dssp             CHHHHHHHHHHHTTCCHHHHHTT-TSCHHHHHHHHTTCSC-----CBHHHHHHHHHHHTSCHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHC-CCCHHHHHHHHCCCCC-----CCHHHHHHHHHHCCCCHHHHHHHCCC
T ss_conf             88999999999879989999662-8999999999889987-----99999999999859999999855388


No 47 
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.83A {Rhodopseudomonas palustris CGA009} SCOP: a.35.1.13
Probab=98.26  E-value=2.9e-06  Score=59.25  Aligned_cols=64  Identities=14%  Similarity=0.269  Sum_probs=54.9

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99999999999964999889999828998798899751578875577989999987321875210000
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD   74 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~   74 (223)
                      -++..+|.++++++||||.++|+++|++++.|+++++|.    -..+++++|.+++.++|..+.-...
T Consensus        39 ~~L~~~I~~~i~~~glTQ~eaA~~lGisq~~iS~l~~Gk----~~~~Sld~L~~~~~~LG~~v~i~i~  102 (120)
T 2o38_A           39 LRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYK----LEGFSVERLMTLLNALDQDVEIVIR  102 (120)
T ss_dssp             HHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTC----CTTCCHHHHHHHHHHTTEEEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCC----CCCCCHHHHHHHHHHCCCEEEEEEE
T ss_conf             999999999999869967556555088889989997588----6788899999999985993899995


No 48 
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B*
Probab=98.21  E-value=1.4e-06  Score=61.25  Aligned_cols=59  Identities=19%  Similarity=0.247  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             99999999964999889999828998798899751578875577989999987321875210
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~   71 (223)
                      .+.|+++|+++||||.+||+++|++.+|+++|++|...  |. .....|.++++..+..+.+
T Consensus        73 ~e~ir~~R~~~glsQ~elA~~lg~~~~ti~~~E~G~~~--p~-~~~~~l~~~l~~~p~~l~e  131 (133)
T 3o9x_A           73 PEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQ--PH-PSTIKLLRVLDKHPELLNE  131 (133)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHHHCSCTTHHHHHHHTSSC--CC-HHHHHHHHHHHHCGGGHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC--CC-HHHHHHHHHHCCCCHHHHH
T ss_conf             99999999984999999999959999999999869988--99-9999999998438547897


No 49 
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli}
Probab=98.19  E-value=6.6e-07  Score=63.40  Aligned_cols=64  Identities=17%  Similarity=0.068  Sum_probs=53.7

Q ss_pred             HHHHHH-HHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             999999-999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    9 IWEAID-RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         9 i~~~i~-~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      -++.|. .+++++|+||++||+.+|+++++|+.+.+|..     .++.+.+.++++++|++.++++....
T Consensus        11 PGeiL~~e~L~~~gisq~~LA~~lgvs~~~is~i~~Gk~-----~it~~~a~rL~~~fg~s~~~wl~lQ~   75 (113)
T 2eby_A           11 PGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNR-----KLTTEMAFRLAKVFDTTVDFWLNLQA   75 (113)
T ss_dssp             HHHHHHHHTTTTTTCCHHHHHHHHTSCHHHHHHHHTTSS-----CCCHHHHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCC-----CCCHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             219999998876699999999996989999999993877-----89999999999998958999998799


No 50 
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovarisraelensis atcc 35646}
Probab=98.16  E-value=1e-06  Score=62.09  Aligned_cols=67  Identities=15%  Similarity=0.195  Sum_probs=58.7

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             5899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      .-+.|++.|+.+|+++|+||.+||+.. +|++++|++++|...     |+.+.+.++++.++++++++.....
T Consensus         2 ~~~~iG~~lk~~R~~~~ltq~~la~~i-~S~s~lSkiE~g~~~-----ps~~~l~~l~~~l~i~~~~~~~~~~   68 (293)
T 2qfc_A            2 QAEKLGSEIKKIRVLRGLTQKQLSENI-CHQSEVSRIESGAVY-----PSMDILQGIAAKLQIPIIHFYEVLI   68 (293)
T ss_dssp             -CHHHHHHHHHHHHHHTCCTTTTTTTT-SCHHHHHHHHTSSSC-----CCHHHHHHHTTTSCCCTHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHCC-CCHHHHHHHHCCCCC-----CCHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             868999999999998799999985215-899999999889999-----9999999999885997899877775


No 51 
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima}
Probab=98.15  E-value=3.6e-06  Score=58.64  Aligned_cols=72  Identities=13%  Similarity=0.093  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             89999999999996499988999982899879889975157887557-7989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~-p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      -++|++.|+++|+++|||+.++|+++||+..+|++++++..+.-+.. +...-|.++|+++++++++++....
T Consensus         5 ~~~iG~~Lr~~R~~~glS~~elA~~l~Is~~~l~~iE~g~~~~~~~~~~~~g~lr~ya~~Lgld~~~l~~~~~   77 (112)
T 2wus_R            5 WKELGETFRKKREERRITLLDASLFTNINPSKLKRIEEGDLKGLDAEVYIKSYIKRYSEFLELSPDEMLKLYE   77 (112)
T ss_dssp             HHHHHHHHHHHHHTTTCCHHHHHHHSSCCHHHHHHHHHTCCTTSSCHHHHHHHHHHHHHHSSCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999999999969999999999856899999988789533765228999999999996979999999998


No 52 
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3
Probab=98.01  E-value=6.3e-06  Score=57.04  Aligned_cols=57  Identities=11%  Similarity=0.009  Sum_probs=43.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      ..|+.+|++.||||.+||+++|++++||++|++|...     |+...+. ++..+...++++.
T Consensus        33 ~~ik~~R~~~gltq~~lA~~lgvs~~ti~~~E~G~~~-----P~~~~~~-ll~~i~~~Pe~~~   89 (99)
T 2ppx_A           33 PRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSE-----PDQPARA-YLKIIAVDPEGTA   89 (99)
T ss_dssp             CHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHHTTSSC-----CCHHHHH-HHHHHHHCHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHH-HHHHHHCCHHHHH
T ss_conf             9999999995999999999969889999999889986-----9999999-9999874979999


No 53 
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp}
Probab=97.84  E-value=2.7e-05  Score=52.91  Aligned_cols=71  Identities=18%  Similarity=0.124  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999999999996499988999982899879889975157887557-79899999873218752100001111
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAATNETICQLLDLPFS   78 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~-p~~~~l~kia~~~~v~~~~l~~~~~~   78 (223)
                      .|++.|+++|+++|+|+.++|++++++.++++.+|++.-+.-|.. ....-+.++|++++++.+++......
T Consensus         3 tiG~~Lr~~R~~~glSi~eva~~l~I~~~~l~aiE~g~~~~lp~~~~~~g~lr~ya~~L~ld~~~ll~~~~~   74 (130)
T 3fym_A            3 TVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQD   74 (130)
T ss_dssp             CHHHHHHHHHHHTTCCHHHHHHHHCCCHHHHHHHHTTCGGGSSSGGGHHHHHHHHHHHTTCCHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             799999999999699999999997514999999984885456770899999999999939599999999988


No 54 
>1b12_A Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation; HET: 1PN; 1.95A {Escherichia coli BL21} SCOP: b.87.1.2 PDB: 1t7d_A* 3iiq_A* 1kn9_A*
Probab=97.62  E-value=0.00017  Score=47.74  Aligned_cols=58  Identities=17%  Similarity=0.180  Sum_probs=45.0

Q ss_pred             EEEECCCCCCCCCCCCCEEEEECC----------------CCCCCCCEEEEEEEC--CCEEEEEEEEECCCEEEEE
Q ss_conf             999628332421487868999368----------------974058889999717--9689999999779879999
Q gi|254780444|r  139 RHKTQDTSMLPLYRKGDILILNSA----------------IQVNCGDRLLIKPRT--GDIVAKVLISRRGRSIDLM  196 (223)
Q Consensus       139 ~l~V~GDSM~P~i~~Gd~vlVd~~----------------~~~~~g~~v~~~~~~--~~~~iKrl~~~~~~~~~l~  196 (223)
                      .+.|.+.||+|+|..||.|+|++-                .....||++++....  ...+|||+.-.+++.+...
T Consensus         8 ~f~IPs~SMePTL~~GD~l~V~K~~Yg~r~P~~~~~i~~~~~~~~gdivvf~~p~~~~~~~vKR~ig~pGD~i~~~   83 (248)
T 1b12_A            8 PFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYD   83 (248)
T ss_dssp             EEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSCEEEEECCCCTTCEEEEECTTCTTSEEEEEEEECTTCEEEEE
T ss_pred             EEEECCCCCHHHHCCCCEEEEEECCCCCCCCCCCCEEEECCCCCCCCEEEECCCCCCCCCEEECCCCCCCCEEEEE
T ss_conf             6892860362032069999999342586778758664004898528999986788888652223567898777874


No 55 
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein structure initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1
Probab=97.59  E-value=0.00012  Score=48.75  Aligned_cols=36  Identities=17%  Similarity=0.158  Sum_probs=32.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCC
Q ss_conf             999999996499988999982899879889975157
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI   46 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~   46 (223)
                      +.|..+|++.||||.+||+++|+++.||++|++|..
T Consensus        93 e~i~~~R~~~glsQ~~lA~~lGvs~~ti~~~E~G~r  128 (170)
T 2auw_A           93 EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHK  128 (170)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHTSCHHHHHHHHTTSS
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC
T ss_conf             999999998699999999995999999999977999


No 56 
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution; 1.40A {Xylella fastidiosa ann-1}
Probab=97.18  E-value=0.0005  Score=44.74  Aligned_cols=58  Identities=22%  Similarity=0.193  Sum_probs=43.9

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCC--CCCCCCCCC
Q ss_conf             99999999649998899998289987988997515788755779899999873218--752100001
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN--ETICQLLDL   75 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~--v~~~~l~~~   75 (223)
                      .+|++..+..| +|++||+++||++++|++|+.+..      ...+...+|.++.+  ++..+|...
T Consensus         2 ~~i~~AI~~~G-~q~~lAr~lGVsq~aVs~W~~~~~------vP~~~~~~Ie~aT~g~Vt~~eLrPD   61 (79)
T 3bd1_A            2 NAIDIAINKLG-SVSALAASLGVRQSAISNWRARGR------VPAERCIDIERVTNGAVICRELRPD   61 (79)
T ss_dssp             CHHHHHHHHHS-SHHHHHHHHTCCHHHHHHHHHHTC------CCGGGHHHHHHHTTTSSCHHHHCTT
T ss_pred             CHHHHHHHHHC-CHHHHHHHHCCCHHHHHHHHHCCC------CCHHHHHHHHHHHCCCCCHHHHCCC
T ss_conf             58999999968-999999992999999999984699------9999999999997895319984955


No 57 
>1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A
Probab=97.01  E-value=0.0013  Score=42.07  Aligned_cols=70  Identities=13%  Similarity=-0.001  Sum_probs=56.8

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             775589999999999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
                      +..+++++.+.|-+.+.++|||.++||+.+|.|+..+.....|-..     .+.+...+++.+++.+-+.+..+.
T Consensus         7 ~~~~r~elte~Il~AK~~KGlTwe~IAe~vG~S~v~vaaa~lGQ~~-----l~~e~A~~l~~~LgL~~e~~~~l~   76 (156)
T 1dw9_A            7 NRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQA-----LPADAARLVGAKLDLDEDSILLLQ   76 (156)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCHHHHHTTSSSCHHHHHHHHTTSSC-----CCHHHHHHHHHHTTCCHHHHHHTT
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCC-----CCHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             6237899999999999984999999999979799999999845777-----998999999985499999999974


No 58 
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A
Probab=96.12  E-value=0.0075  Score=37.10  Aligned_cols=54  Identities=24%  Similarity=0.388  Sum_probs=41.7

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      .|.+.++++|+|-++||+..|++++|+.+-.      ...+|+.|.+  ||+++|+.+.++-
T Consensus        13 dI~AaL~krG~sLa~lsr~~Gls~~tl~nal------~rp~pkgEri--IA~aLGv~P~eIW   66 (74)
T 1neq_A           13 DVIAGLKKRKLSLSALSRQFGYAPTTLANAL------ERHWPKGEQI--IANALETKPEVIW   66 (74)
T ss_dssp             HHHHHHHTTSCCHHHHHHHHSSCHHHHHHTT------TSSCHHHHHH--HHHHTTSCHHHHC
T ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH------CCCCCHHHHH--HHHHHCCCHHHHC
T ss_conf             9999999968969999999099889999988------2778079999--9999785988949


No 59 
>3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei}
Probab=95.61  E-value=0.027  Score=33.47  Aligned_cols=42  Identities=17%  Similarity=0.127  Sum_probs=36.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             9775589999999999996499---98899998289987988997
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+|-|+++|+++--+|..+.|+   |-.++|+++||++.++.++.
T Consensus         2 ~~~kTRe~Il~aA~~lf~~~G~~~~t~~~Ia~~agvs~~tlY~~F   46 (228)
T 3nnr_A            2 MTMKTRDKILLSSLELFNDKGERNITTNHIAAHLAISPGNLYYHF   46 (228)
T ss_dssp             --CCHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             876999999999999999739352779999998890998999887


No 60 
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A
Probab=95.10  E-value=0.11  Score=29.57  Aligned_cols=43  Identities=14%  Similarity=0.298  Sum_probs=37.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7755899999999999964999889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.++-.++|+.+.+...+++.++|+..||+.+||++|.+.
T Consensus         6 k~~t~~~K~~vi~~~~~~~~~~~~~iAk~fgv~~sTi~~~~k~   48 (131)
T 1hlv_A            6 RQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKN   48 (131)
T ss_dssp             CCCCHHHHHHHHHHHHHCTTSCHHHHHHHHTCCHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             3189999999999999778888999999989199999999924


No 61 
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C
Probab=95.01  E-value=0.025  Score=33.75  Aligned_cols=41  Identities=12%  Similarity=0.108  Sum_probs=32.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7755899999999999964999889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ..||-++|-++ .+|++ .|.|.+++|+..||+.+||.+|...
T Consensus         4 ~kLt~~q~~~a-~~l~~-~G~s~~~iA~~~gVsr~TlYrylp~   44 (52)
T 1jko_C            4 RAINKHEQEQI-SRLLE-KGHPRQQLAIIFGIGVSTLYRYFPA   44 (52)
T ss_dssp             CSSCTTHHHHH-HHHHH-TTCCHHHHHHTTSCCHHHHHHHSCT
T ss_pred             CCCCHHHHHHH-HHHHH-CCCCHHHHHHHHCCCHHHHHHHCCC
T ss_conf             87999999999-99999-7898999999979799999998513


No 62 
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A
Probab=94.98  E-value=0.041  Score=32.34  Aligned_cols=40  Identities=18%  Similarity=0.271  Sum_probs=32.2

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             58999999999999649998899998289987988997515
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +-.+++.+.++ +.+.|+||.+||.++|+|.++|+++.+-.
T Consensus         9 ~~~E~g~~~~~-l~~~g~tQ~elAe~lg~Srs~Vsr~lrl~   48 (192)
T 1zx4_A            9 SIREIGLRLMR-MKNDGMSQKDIAAKEGLSQAKVTRALQAA   48 (192)
T ss_dssp             CHHHHHHHHHH-HHHTTCCHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHH-HHHCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             69999999999-99859999999999887999999999998


No 63 
>2vke_A Tetracycline repressor protein class D; transcription, metal-binding, helix-turn-helix, transcription regulator, transcription regulation; HET: TAC; 1.62A {Escherichia coli} SCOP: a.4.1.9 a.121.1.1 PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2tct_A* 2trt_A* 1qpi_A* 1a6i_A 2vkv_A* 3fk7_A* 3fk6_A* 2ns7_A 2ns8_A
Probab=94.91  E-value=0.076  Score=30.60  Aligned_cols=41  Identities=17%  Similarity=0.286  Sum_probs=35.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             77558999999999999649---998899998289987988997
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |.+|+++|.++--++..++|   +|-.++|+++|++++|+.++.
T Consensus         1 ~~~tR~~Il~aA~~lf~~~G~~~~tv~~IA~~aGvs~~tlY~hF   44 (207)
T 2vke_A            1 SRLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHV   44 (207)
T ss_dssp             CCCSHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             90769999999999999749141789999999791976998878


No 64 
>2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A*
Probab=94.87  E-value=0.094  Score=30.02  Aligned_cols=42  Identities=17%  Similarity=0.131  Sum_probs=37.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             9775589999999999996499---98899998289987988997
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |...++++|.++-.++..+.|+   |-+++|+++|++++++.++.
T Consensus         1 mr~~rR~~Il~aA~~l~~~~G~~~~s~~~IA~~AGvs~~siY~yF   45 (185)
T 2yve_A            1 MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHF   45 (185)
T ss_dssp             CCSCHHHHHHHHHHHHHHHSCSTTCCHHHHHHHHCCCHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHCCCC
T ss_conf             977899999999999999869051779999998683853130668


No 65 
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster}
Probab=94.77  E-value=0.054  Score=31.57  Aligned_cols=40  Identities=18%  Similarity=0.279  Sum_probs=34.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .+|-+.-.++|+.+  +.|.|.+++|+..||+++||.+|.+.
T Consensus        22 ~~t~e~K~~iv~~~--e~G~s~~~vAre~gi~~stl~~W~k~   61 (87)
T 2elh_A           22 SLTPRDKIHAIQRI--HDGESKASVARDIGVPESTLRGWCKN   61 (87)
T ss_dssp             SCCHHHHHHHHHHH--HHTCCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHH--HCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             18999999999999--87999999999979799899999999


No 66 
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae}
Probab=94.71  E-value=0.056  Score=31.44  Aligned_cols=43  Identities=16%  Similarity=0.291  Sum_probs=37.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             9775589999999999996499988999982899879889975
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |+..-+.++...+-+|==..|+||+++|+++|+|.++++++-.
T Consensus         1 M~~~~~~~ll~~vA~lYY~~g~tQ~eIA~~lgiSR~~VsRlL~   43 (315)
T 2w48_A            1 MENSDDIRLIVKIAQLYYEQDMTQAQIARELGIYRTTISRLLK   43 (315)
T ss_dssp             ---CCHHHHHHHHHHHHHTSCCCHHHHHHHTTCCHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9853799999999999982499999999987959999999999


No 67 
>2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional repressor; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A*
Probab=94.57  E-value=0.13  Score=29.10  Aligned_cols=43  Identities=14%  Similarity=0.143  Sum_probs=36.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             9775589999999999996499---988999982899879889975
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |-.||+++|.++=-+|..+.|+   |-.++|+++||++++|.++..
T Consensus         3 ~~~ltR~~Il~AA~~lf~~~G~~~~T~~~IA~~aGVs~~~lY~hF~   48 (234)
T 2opt_A            3 MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVG   48 (234)
T ss_dssp             CCCCCHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9703499999999999997294427899999997858889999879


No 68 
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1
Probab=94.34  E-value=0.082  Score=30.38  Aligned_cols=41  Identities=15%  Similarity=0.290  Sum_probs=34.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .||--++..++++|+++ |+|+.++|+++|.+.++|+++.+-
T Consensus        35 ~l~~~e~A~~~~~l~~~-g~t~~~iA~~lg~s~~~V~~~l~l   75 (178)
T 1r71_A           35 ELTPREIADFIGRELAK-GKKKGDIAKEIGKSPAFITQHVTL   75 (178)
T ss_dssp             CCCHHHHHHHHHHHHHT-TCCHHHHHHHHTCCHHHHHHHHGG
T ss_pred             CCCHHHHHHHHHHHHHC-CCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             89999999999999981-788999999969999999999998


No 69 
>2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcription regulator; HET: TDC; 2.49A {Pasteurella multocida}
Probab=94.19  E-value=0.045  Score=32.07  Aligned_cols=42  Identities=14%  Similarity=0.245  Sum_probs=35.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             9775589999999999996499---98899998289987988997
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |-.+|+++|.++=.+|..+.|+   |-.++|+++|++++|+.++.
T Consensus         1 ~a~~~R~~Il~AA~~lf~~~G~~~~sv~~IA~~aGvs~~tlY~~F   45 (207)
T 2vpr_A            1 MAKLDKEQVIDNALILLNEVGIEGLTTRKLAQKIGVEQPTLYWHV   45 (207)
T ss_dssp             -CCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTCCHHHHTTTC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             984489999999999999849352789999998784876899988


No 70 
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2
Probab=93.79  E-value=0.081  Score=30.44  Aligned_cols=41  Identities=27%  Similarity=0.350  Sum_probs=34.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHC------CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             97755899999999999964------999889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERH------NLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~------gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |++-+.++.+.+|+.|....      ++|+++||+.+|++++++++.
T Consensus         1 msld~t~~~~~aLk~L~~~~~~~~~~~ls~~eLa~~l~is~~tvsr~   47 (230)
T 3cta_A            1 MSLETDDQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRI   47 (230)
T ss_dssp             ------CHHHHHHHHHHHHTTTSSEEECCHHHHHHHHTSCHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99866699999999999736415799858999999988788899999


No 71 
>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structural genomics, PSI-2; 2.20A {Streptomyces coelicolor}
Probab=93.70  E-value=0.098  Score=29.88  Aligned_cols=42  Identities=14%  Similarity=0.227  Sum_probs=34.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             977558999999999999649---998899998289987988997
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.+++++|+.+=-++..+.|   +|-.++|+++|++++++.++.
T Consensus        22 ~~~~~R~~IL~AA~~lf~e~G~~~~T~~~IA~~aGvs~~tlY~~F   66 (211)
T 3fiw_A           22 MTKMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYF   66 (211)
T ss_dssp             --CCCHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCTHHHHTTC
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             258799999999999999749453759999999892885898988


No 72 
>1j5y_A Transcriptional regulator, biotin repressor family; structural genomics, TM1602, JCSG, conserved hypothetical protein, PSI; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1
Probab=93.69  E-value=0.052  Score=31.69  Aligned_cols=41  Identities=7%  Similarity=0.203  Sum_probs=34.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             977558999999999999649-99889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+++..++...-|+.|.+..+ +|.++||+++|||..||.+-
T Consensus        15 m~~~k~eR~~~Il~~L~~~~~~vs~~eLa~~l~vS~~TIrrd   56 (187)
T 1j5y_A           15 MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQD   56 (187)
T ss_dssp             CHHHHHHHHHHHHHHHHHCSSCBCHHHHHHHHTSCHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             613099999999999998599676999999979899999999


No 73 
>2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal domain, homeodomain-like; 1.55A {Aquifex aeolicus VF5}
Probab=93.40  E-value=0.12  Score=29.39  Aligned_cols=40  Identities=13%  Similarity=0.139  Sum_probs=34.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |=|+++|.++-.++..++|+   |-+++|+++|++++|+.++.
T Consensus         1 m~TRe~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~tiY~~F   43 (179)
T 2eh3_A            1 MGTKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHF   43 (179)
T ss_dssp             -CHHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHC
T ss_conf             9699999999999999739250769999998784965214428


No 74 
>2fbq_A Probable transcriptional regulator; PA3006, APC5893, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.1.9 a.121.1.1
Probab=93.35  E-value=0.19  Score=28.03  Aligned_cols=40  Identities=15%  Similarity=0.218  Sum_probs=33.9

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -|+++|+++=-+|..+.|+   |-.++|+++|++++++.++..
T Consensus         7 ~trerIl~AA~~l~~~~G~~~~t~~~IA~~aGvs~~~lY~yF~   49 (235)
T 2fbq_A            7 ETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFG   49 (235)
T ss_dssp             HHHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999998590407799999997939889999859


No 75 
>3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A
Probab=93.30  E-value=0.25  Score=27.28  Aligned_cols=42  Identities=24%  Similarity=0.304  Sum_probs=35.7

Q ss_pred             CCCCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             77558999999999999649---9988999982899879889975
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      +..|+++|.++--+|..++|   +|-.++|+++|++.+++.++..
T Consensus         6 ~~~tre~Il~aa~~l~~~~G~~~~t~~~IA~~agvs~~t~Y~~F~   50 (195)
T 3frq_A            6 KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFT   50 (195)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTCCHHHHHHHHC
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHCC
T ss_conf             736099999999999997591307799999987898221787395


No 76 
>3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi}
Probab=93.04  E-value=0.17  Score=28.33  Aligned_cols=41  Identities=15%  Similarity=0.182  Sum_probs=32.6

Q ss_pred             CCCCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             77558999999999999649---998899998289987988997
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.-|+++|.++-.++..++|   +|-.++|+++|++++++.++.
T Consensus         6 ~a~tR~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~~~Y~~F   49 (194)
T 3dpj_A            6 QAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHF   49 (194)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHC
T ss_conf             99999999999999999749251889999998682912688875


No 77 
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D
Probab=93.02  E-value=0.15  Score=28.67  Aligned_cols=41  Identities=27%  Similarity=0.263  Sum_probs=36.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             977558999999999999649-99889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |.+-|-|+.+++|-.|.++.| .+.+++|+.+|++++|++..
T Consensus         1 m~t~s~EdYL~~I~~l~~~~~~v~~~dlA~~L~vs~~sv~~~   42 (142)
T 1on2_A            1 MTTPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKM   42 (142)
T ss_dssp             -CCHHHHHHHHHHHHHHHHHSSCCHHHHHHHHTSCHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999539999999999985379886999999969887899999


No 78 
>3mky_B Protein SOPB; partition, F plasmid, centromere, DNA binding protein- complex; HET: DNA; 2.86A {Escherichia coli} PDB: 3mkw_B* 3mkz_A*
Probab=92.94  E-value=0.2  Score=27.86  Aligned_cols=39  Identities=10%  Similarity=-0.013  Sum_probs=29.7

Q ss_pred             CHHHHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             589999999999996-499988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~-~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |--+.+.+-++|+.+ .|.||.+||+++|+|+++|+++.+
T Consensus        25 S~~E~a~~y~rlL~~~~~~tq~eLA~~lG~Srs~VS~~L~   64 (189)
T 3mky_B           25 SAYERGQRYASRLQNEFAGNISALADAENISRKIITRCIN   64 (189)
T ss_dssp             CHHHHHHHHHHHHHTTTTTCHHHHHHHHTSCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999999999864388899999997979999999998


No 79 
>2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1
Probab=92.84  E-value=0.25  Score=27.27  Aligned_cols=40  Identities=15%  Similarity=0.157  Sum_probs=33.6

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -|+++|.++--+|..+.|+   |-.++|+.+||++.+|.++..
T Consensus        40 ~tR~~Il~Aa~~l~~e~G~~~~T~~~IA~~AgvS~~tlY~yF~   82 (225)
T 2id3_A           40 RIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWG   82 (225)
T ss_dssp             HHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHCCCCC
T ss_conf             9999999999999998493407799999997909888710189


No 80 
>3bqy_A Putative TETR family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3}
Probab=92.75  E-value=0.16  Score=28.52  Aligned_cols=40  Identities=10%  Similarity=0.091  Sum_probs=35.3

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      +|+++|.++--++..+.|+   |-.++|+++|+++.|+.++..
T Consensus         2 ~~R~~Il~AA~~l~~~~G~~~~T~~~IA~~aGvs~~tlY~~F~   44 (209)
T 3bqy_A            2 HDRARTVQTALDLLNESGLDTLTMRRLAQAMDVQAGALYRYFA   44 (209)
T ss_dssp             -CHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHHHCS
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             7699999999999997294516799999997948879998879


No 81 
>2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiative, PSI, midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1
Probab=92.72  E-value=0.2  Score=27.85  Aligned_cols=40  Identities=20%  Similarity=0.199  Sum_probs=34.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .+|+++|+++-.+|..+.|+   |-.++|+.+||++++|.++.
T Consensus        18 ~~tR~~Il~AA~~lf~e~G~~~~T~~~IA~~aGvs~~tlY~hF   60 (243)
T 2g7l_A           18 ALSRRWIVDTAVALMRAEGLEKVTMRRLAQELDTGPASLYVYV   60 (243)
T ss_dssp             CCCHHHHHHHHHHHHHHHCSSSCCHHHHHHHTTSCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCHHCC
T ss_conf             7599999999999999809430789999998689955320039


No 82 
>3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua}
Probab=92.68  E-value=0.14  Score=28.87  Aligned_cols=40  Identities=15%  Similarity=0.415  Sum_probs=34.1

Q ss_pred             CCHHHHHHHHHHH-HHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999-996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRM-AERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l-~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .|.+.|..+..+| ++++|+   |-+++|+.+|++++|+.++..
T Consensus        19 ~Tk~~i~~a~~~Lf~~~kG~~~~Sv~dIa~~AgVs~~t~Y~~F~   62 (185)
T 3o60_A           19 KTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHK   62 (185)
T ss_dssp             HHHHHHHHHHHHHHHTTCCTTTCCHHHHHHHHTCCHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCHHCC
T ss_conf             99999999999999880893108799999987888666223469


No 83 
>2o7t_A Transcriptional regulator; NP_600854.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1
Probab=92.66  E-value=0.3  Score=26.77  Aligned_cols=39  Identities=15%  Similarity=0.208  Sum_probs=32.9

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .++++|.++-..+..+.|+   |..++|+++||+++||.++.
T Consensus         8 ~~R~~Il~aa~~l~~~~G~~~~t~~~IA~~agvs~~tiY~~F   49 (199)
T 2o7t_A            8 KRREHIITTTCNLYRTHHHDSLTMENIAEQAGVGVATLYRNF   49 (199)
T ss_dssp             HHHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHC
T ss_conf             999999999999999749140779999998686913177608


No 84 
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transcription regulation; NMR {Escherichia coli K12} SCOP: a.35.1.5 PDB: 1uxd_A
Probab=92.41  E-value=0.17  Score=28.28  Aligned_cols=50  Identities=16%  Similarity=0.106  Sum_probs=33.0

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCC-CCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             998899998289987988997515788-75577989999987321875210
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~~g-~~r~p~~~~l~kia~~~~v~~~~   71 (223)
                      +|..++|+++|+|.+|+|+..++..+. +-..-..+.+.++++.+|-.++.
T Consensus         1 vTlkdIA~~aGVS~sTVSrvLng~~~~~~Vs~~Tr~rV~~~a~~lgY~pn~   51 (65)
T 1uxc_A            1 MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNA   51 (65)
T ss_dssp             CCHHHHHHHHTSCHHHHHHHHHTCTTTTTCTTHHHHHHHHHHHHHTCCCC-
T ss_pred             CCHHHHHHHHCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCH
T ss_conf             979999999885999999998599987877999999999999998889799


No 85 
>2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1
Probab=92.39  E-value=0.33  Score=26.48  Aligned_cols=39  Identities=18%  Similarity=0.159  Sum_probs=32.4

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|+++|.++-.+|..+.|+   |-.++|+++|++++++.++.
T Consensus         8 ~tR~~Il~AA~~l~~e~G~~~~t~~~IA~~agvs~~tlY~~F   49 (202)
T 2d6y_A            8 ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYY   49 (202)
T ss_dssp             CHHHHHHHHHHHHHHHHTTTSCCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999759040879999999790988996886


No 86 
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi}
Probab=92.38  E-value=0.18  Score=28.16  Aligned_cols=48  Identities=10%  Similarity=0.097  Sum_probs=34.2

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCH---HHHHHHHHHCCCCCC
Q ss_conf             96499988999982899879889975157887557798---999998732187521
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST---ESIFKILAATNETIC   70 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~---~~l~kia~~~~v~~~   70 (223)
                      +++..|..++|+++|||.+|+|+.-++.+.     .+-   +.+.++++.+|--+.
T Consensus         7 ~~k~vTikdIA~~agVS~aTVSr~Ln~~~~-----vs~~tr~rV~~~a~~lgY~pn   57 (344)
T 3kjx_A            7 TKRPLTLRDVSEASGVSEMTVSRVLRNRGD-----VSDATRARVLAAAKELGYVPN   57 (344)
T ss_dssp             ---CCCHHHHHHHHCCCSHHHHHHHTTCSC-----CCHHHHHHHHHHHHHHTCCCC
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHHHHCCCCC
T ss_conf             999976999999989599999999789899-----999999999999999599748


No 87 
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2
Probab=92.30  E-value=0.34  Score=26.40  Aligned_cols=39  Identities=15%  Similarity=0.102  Sum_probs=29.4

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             55899999999999964999889999828998798899751
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ||. +....|..|. +.|+|+.++|+.+|++.+||++|.+.
T Consensus         7 lt~-~~R~~I~~l~-~~G~s~~~IAk~lg~s~stV~r~lk~   45 (141)
T 1u78_A            7 LSD-TERAQLDVMK-LLNVSLHEMSRKISRSRHCIRVYLKD   45 (141)
T ss_dssp             CCH-HHHHHHHHHH-HTTCCHHHHHHHHTCCHHHHHHHHHS
T ss_pred             CCH-HHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999-9999999999-97999999999989578999999997


No 88 
>3jsj_A Putative TETR-family transcriptional regulator; NP_821317.1, putative transcriptional regulator, structural genomics; 2.10A {Streptomyces avermitilis ma-4680}
Probab=92.08  E-value=0.4  Score=25.90  Aligned_cols=38  Identities=18%  Similarity=0.290  Sum_probs=32.5

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-.++..++|+  |-.++|+++|++++++.++.
T Consensus        10 ~R~~il~aa~~l~~~~G~~~t~~~IA~~agvs~~tlY~~F   49 (190)
T 3jsj_A           10 PRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLF   49 (190)
T ss_dssp             HHHHHHHHHHHHHHHHCTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999976978879999999790999996774


No 89 
>1zs4_A Regulatory protein CII; helix-turn-helix, transcription activator, transcription/DNA complex; HET: DNA; 1.70A {Enterobacteria phage lambda} SCOP: a.35.1.9
Probab=92.04  E-value=0.38  Score=26.07  Aligned_cols=39  Identities=18%  Similarity=0.150  Sum_probs=30.4

Q ss_pred             CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             988999982899879889975157887557798999998732187521
Q gi|254780444|r   23 TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC   70 (223)
Q Consensus        23 s~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~   70 (223)
                      .|...|+..|++.++||+|+++         -.+..++++.+++....
T Consensus        26 Gq~~vA~~~Gv~eStISRwK~~---------~~~k~a~lLA~Le~~v~   64 (83)
T 1zs4_A           26 GTEKTAEAVGVDKSQISRWKRD---------WIPKFSMLLAVLEWGVV   64 (83)
T ss_dssp             CHHHHHHHHTSCHHHHHHHHHH---------THHHHHHHHHHHTTCCC
T ss_pred             CCHHHHHHHCCCHHHHHHHCCC---------HHHHHHHHHHHHCCCCC
T ss_conf             5299999969989998730134---------79999999999737999


No 90 
>3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4}
Probab=92.02  E-value=0.44  Score=25.68  Aligned_cols=39  Identities=18%  Similarity=0.118  Sum_probs=33.4

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             589999999999996499---988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |+++|+++-.+|..++|+   |-.++|+++|++++|+.++..
T Consensus        18 tr~~Il~aA~~lf~~~G~~~~s~~~IA~~agvs~~tlY~~F~   59 (218)
T 3gzi_A           18 NRDKLILAARNLFIERPYAQVSIREIASLAGTDPGLIRYYFG   59 (218)
T ss_dssp             HHHHHHHHHHHHHHTSCCSCCCHHHHHHHHTSCTHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             999999999999997491416499999987919768887458


No 91 
>2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TETR family, PSI-2, protein structure initiative; 1.70A {Streptomyces coelicolor A3}
Probab=92.00  E-value=0.39  Score=26.00  Aligned_cols=40  Identities=20%  Similarity=0.256  Sum_probs=35.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ..|.++|.++=.++..++|+   |-.++|+++||++.++.++.
T Consensus        28 ~~tre~Il~AA~~l~~e~G~~~~t~~~IA~~aGVs~~tlY~yF   70 (241)
T 2hxi_A           28 RWSTEQILDAAAELLLAGDAETFSVRKLAASLGTDSSSLYRHF   70 (241)
T ss_dssp             CCCHHHHHHHHHHHHSSSSCCCCCHHHHHHHTTSCHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             1189999999999999729130539999999790888999987


No 92 
>2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1}
Probab=91.73  E-value=0.5  Score=25.29  Aligned_cols=39  Identities=15%  Similarity=0.204  Sum_probs=32.1

Q ss_pred             CCHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499--98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|+++-.++..+.|+  |-.++|+.+|++++|+.++.
T Consensus        13 ~tRe~Il~aA~~l~~~~G~~~t~~~IA~~aGvs~~tlY~~F   53 (196)
T 2qwt_A           13 RNRARVLEVAYDTFAAEGLGVPMDEIARRAGVGAGTVYRHF   53 (196)
T ss_dssp             HHHHHHHHHHHHHHHHTCTTSCHHHHHHHTTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999986978889999999694999998784


No 93 
>2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, protein structure initiative; HET: MSE; 1.52A {Rhodococcus SP}
Probab=91.66  E-value=0.54  Score=25.09  Aligned_cols=40  Identities=23%  Similarity=0.163  Sum_probs=33.2

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             558999999999999649---9988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -|+++|.++--+|..++|   +|-.++|+++||+++|+.++..
T Consensus        39 ~tR~~Il~AA~~l~~e~G~~~~T~~~Ia~~AGvs~~t~Y~~F~   81 (214)
T 2guh_A           39 QSRSLIVDAAGRAFATRPYREITLKDIAEDAGVSAPLIIKYFG   81 (214)
T ss_dssp             HHHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTSCHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999998392407799999997919879999878


No 94 
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19
Probab=91.66  E-value=0.23  Score=27.50  Aligned_cols=35  Identities=9%  Similarity=0.117  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             99999999964999889999828998798899751
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ..+++-.+...|.|.+++|+..||+++||++|.+.
T Consensus        12 ~~aV~l~~~~~g~s~~~vA~~~GIs~~tl~~W~k~   46 (97)
T 2jn6_A           12 RDAVALYENSDGASLQQIANDLGINRVTLKNWIIK   46 (97)
T ss_dssp             HHHHHHHTTGGGSCHHHHHHHHTSCHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHHHH
T ss_conf             99999999849985999999978995744689999


No 95 
>1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, structural genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1
Probab=91.59  E-value=0.3  Score=26.78  Aligned_cols=40  Identities=23%  Similarity=0.341  Sum_probs=34.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ..|+++|.++-.++..+.|+   |-.++|+++|++.+|+.++.
T Consensus         7 ~~tr~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~tlY~~F   49 (183)
T 1zk8_A            7 GLTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHV   49 (183)
T ss_dssp             CCCHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             6289999999999999749250769999998891988998886


No 96 
>2dg8_A Putative TETR-family transcriptional regulatory protein; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor A3}
Probab=91.51  E-value=0.43  Score=25.72  Aligned_cols=38  Identities=16%  Similarity=0.222  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--+|..+.|+   |-.++|+++||+++++.++.
T Consensus        10 ~R~~Il~aA~~l~~e~G~~~~si~~Ia~~agvs~~t~Y~~F   50 (193)
T 2dg8_A           10 RRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHF   50 (193)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCTHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999759040769999999890999998780


No 97 
>2wui_A MEXZ, transcriptional regulator; gene regulation, transcription regulation, TETR, DNA-binding transcription; 2.90A {Pseudomonas aeruginosa}
Probab=91.49  E-value=0.31  Score=26.64  Aligned_cols=38  Identities=18%  Similarity=0.239  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++-.++..+.|+   |-.++|+++|++++|+.++.
T Consensus        12 tr~~Il~aA~~l~~~~G~~~~si~~Ia~~agvs~~tiY~~F   52 (210)
T 2wui_A           12 TRDGILDAAERVFLEKGVGTTAMADLADAAGVSRGAVYGHY   52 (210)
T ss_dssp             HHHHHHHHHHHHHHHSCTTTCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999999999759161759999998787977444478


No 98 
>1t33_A Putative transcriptional repressor (TETR/ACRR family); structural genomics, TETR/CCRR family, helix turn helix DNA binding domain; 2.20A {Salmonella typhimurium LT2} SCOP: a.4.1.9 a.121.1.1
Probab=91.46  E-value=0.44  Score=25.66  Aligned_cols=38  Identities=16%  Similarity=0.070  Sum_probs=31.3

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|+++--++..+.|+  |-.++|+.+|++++++.++.
T Consensus        13 tr~~Il~aA~~lf~~~G~~~T~~~IA~~aGvs~~~iY~~F   52 (224)
T 1t33_A           13 AKSQLIAAALAQFGEYGLHATTRDIAALAGQNIAAITYYF   52 (224)
T ss_dssp             HHHHHHHHHHHHHHHHGGGSCHHHHHHHHTSCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             9999999999999987927579999998099802123578


No 99 
>3g7r_A Putative transcriptional regulator; TETR, all-helical, structural genomics, PSI-2, protein structure initiative; 1.38A {Streptomyces coelicolor A3}
Probab=91.35  E-value=0.52  Score=25.18  Aligned_cols=38  Identities=5%  Similarity=0.128  Sum_probs=31.4

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|+.+=.++..++|+   |-.++|+++|+++++|.++.
T Consensus        36 tR~~IL~AA~~l~~~~G~~~~T~~~IA~~aGvs~~tiY~yF   76 (221)
T 3g7r_A           36 ARARLLGTATRIFYAEGIHSVGIDRITAEAQVTRATLYRHF   76 (221)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTSCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999829140879999999891998999883


No 100
>3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A
Probab=91.29  E-value=0.53  Score=25.12  Aligned_cols=38  Identities=13%  Similarity=0.203  Sum_probs=31.8

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |.++|.++-.+|..++|+   |-.++|+++|++..|+.++.
T Consensus        15 tr~~Il~aA~~lf~~~G~~~~si~~Ia~~agvs~~t~Y~~F   55 (220)
T 3lhq_A           15 TRQHILDVALRLFSQQGVSATSLAEIANAAGVTRGAIYWHF   55 (220)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749140659999999793988999886


No 101
>2iu5_A DHAS, hypothetical protein YCEG; synthase, activator, TETR family, dihydroxyacetone; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1
Probab=91.27  E-value=0.13  Score=29.16  Aligned_cols=40  Identities=15%  Similarity=0.202  Sum_probs=35.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ..|.+.|.+|-.+|..+.|+   |-.++|+++|++.+|+.++.
T Consensus        12 ~~tr~~Il~Aa~~l~~~~G~~~~Tv~~Ia~~agvs~~t~Y~yF   54 (195)
T 2iu5_A           12 IITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYF   54 (195)
T ss_dssp             SHHHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTSCGGGGGGTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999999769630689999998688861798877


No 102
>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1
Probab=91.24  E-value=0.55  Score=25.04  Aligned_cols=38  Identities=18%  Similarity=0.161  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--.+..+.|+   |-.++|+++|++++|+.++.
T Consensus        13 ~r~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~t~Y~~F   53 (192)
T 2fq4_A           13 TQKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWW   53 (192)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999839440779999999891998885347


No 103
>2hyt_A TETR-family transcriptional regulator; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.64A {Pectobacterium atrosepticum}
Probab=91.22  E-value=0.52  Score=25.19  Aligned_cols=39  Identities=8%  Similarity=0.118  Sum_probs=30.5

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |+++|.++--+|..+.|   +|-.++|+.+|++++|+.++..
T Consensus        13 tR~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~yF~   54 (197)
T 2hyt_A           13 TRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFG   54 (197)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCTTHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHCCC
T ss_conf             999999999999998691518799999983859240655089


No 104
>3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A
Probab=91.06  E-value=0.65  Score=24.56  Aligned_cols=37  Identities=11%  Similarity=0.099  Sum_probs=30.9

Q ss_pred             HHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             89999999999996499---98899998289987988997
Q gi|254780444|r    6 HKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +++|.++-..|..+.|+   |-.++|+++||+.+|+.++.
T Consensus        19 r~~Il~aA~~l~~~~G~~~~ti~~IA~~agvs~~t~Y~yF   58 (206)
T 3kz9_A           19 KQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYF   58 (206)
T ss_dssp             HHHHHHHHHHHHHHSCCSSCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999729441779999998790998996980


No 105
>1ui5_A A-factor receptor homolog; helix-turn-helix, alpha-helix-bundle, antibiotic; 2.40A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 1ui6_A
Probab=91.02  E-value=0.33  Score=26.44  Aligned_cols=40  Identities=18%  Similarity=0.145  Sum_probs=32.3

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             558999999999999649---9988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .|+++|.++-..+..++|   +|-.++|+++|||+.++.++..
T Consensus         9 ~tr~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~tiY~~F~   51 (215)
T 1ui5_A            9 QTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFA   51 (215)
T ss_dssp             THHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHCC
T ss_conf             9999999999999998591518799999986878211876169


No 106
>2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3}
Probab=90.98  E-value=0.69  Score=24.39  Aligned_cols=38  Identities=24%  Similarity=0.325  Sum_probs=31.4

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--++..++|+  |-.++|+.+|++++||.++.
T Consensus        16 ~R~~Il~aa~~l~~~~G~~~T~~~IA~~agvs~~tiY~~F   55 (194)
T 2q24_A           16 NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNF   55 (194)
T ss_dssp             CHHHHHHHHHHHHHHHCTTCCHHHHHHHTTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999986966769999998398874698876


No 107
>3bjb_A Probable transcriptional regulator, TETR family protein; APC7331, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; 2.50A {Rhodococcus SP}
Probab=90.78  E-value=0.74  Score=24.20  Aligned_cols=38  Identities=18%  Similarity=0.281  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..+..+.|   +|-.++|+.+|++++++.++.
T Consensus        23 ~r~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~t~Y~~F   63 (207)
T 3bjb_A           23 RHVRMLEAAIELATEKELARVQMHEVAKRAGVAIGTLYRYF   63 (207)
T ss_dssp             HHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHCC
T ss_conf             99999999999999749352779999999890998861318


No 108
>3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp}
Probab=90.78  E-value=0.56  Score=24.98  Aligned_cols=39  Identities=8%  Similarity=0.170  Sum_probs=32.3

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|.++|.++-.++..++|+   |-.++|+++|++.+++.++.
T Consensus        10 ~tr~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   51 (191)
T 3on4_A           10 NTKERILAVAEALIQKDGYNAFSFKDIATAINIKTASIHYHF   51 (191)
T ss_dssp             CHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHCC
T ss_conf             999999999999999739563779999998782944687606


No 109
>3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281, TETR transcriptional regulator, PSI-2; HET: PG4; 2.30A {Streptomyces coelicolor A3}
Probab=90.72  E-value=0.66  Score=24.53  Aligned_cols=38  Identities=13%  Similarity=0.129  Sum_probs=32.3

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |.++|.++-.+|..+.|+   |-.++|+++|++.+++.++.
T Consensus        44 tr~~Il~AA~~l~~~~G~~~~ti~~IA~~aGvS~~tlY~yF   84 (229)
T 3bni_A           44 RLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFF   84 (229)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999849010679999999596999999986


No 110
>2hxo_A Putative TETR-family transcriptional regulator; TETR transcriptional regulator, structural genomics, PSI-2; 2.40A {Streptomyces coelicolor A3}
Probab=90.60  E-value=0.4  Score=25.95  Aligned_cols=40  Identities=18%  Similarity=0.140  Sum_probs=33.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .+|.++|.++=-++..++|+   |-.++|+++||++++|.++.
T Consensus        15 ~~tr~~Il~aA~~lf~e~G~~~~t~~~IA~~aGvs~~tlY~~F   57 (237)
T 2hxo_A           15 PLSRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHI   57 (237)
T ss_dssp             -CCHHHHHHHHHHHHHHTTTTTCCHHHHHHHHTSCGGGGGGTC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             6599999999999999839352779999998784956530108


No 111
>3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structure initiative; 2.30A {Rhodobacter sphaeroides 2}
Probab=90.59  E-value=0.45  Score=25.62  Aligned_cols=40  Identities=15%  Similarity=0.103  Sum_probs=32.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ..|+++|.++=-.+..++|+   |-.++|+++|+++.++.++.
T Consensus        29 ~~tr~~Il~AA~~l~~~~G~~~~si~~IA~~agvs~~tiY~~F   71 (222)
T 3bru_A           29 SLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYF   71 (222)
T ss_dssp             GGHHHHHHHHHHHHHHHSCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHC
T ss_conf             8899999999999999859040779999998689902698856


No 112
>1umq_A Photosynthetic apparatus regulatory protein; DNA-binding protein, response regulator, DNA binding domain, helix-turn-helix; NMR {Rhodobacter sphaeroides} SCOP: a.4.1.12
Probab=90.57  E-value=0.57  Score=24.95  Aligned_cols=39  Identities=23%  Similarity=0.426  Sum_probs=31.9

Q ss_pred             CCHHHH-HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999-999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i-~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++-+++ .+.|.+.+++.+.+.++.|+.+||+.+|+.+-.
T Consensus        36 ~~L~~~Er~~I~~aL~~~~GN~s~AAr~LGIsR~TLyrkl   75 (81)
T 1umq_A           36 MSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRIL   75 (81)
T ss_dssp             SCHHHHHHHHHHHHHHHTTSCHHHHHHHHTSCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHH
T ss_conf             8999999999999999972779999999798999999999


No 113
>2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1
Probab=90.53  E-value=0.87  Score=23.74  Aligned_cols=38  Identities=16%  Similarity=0.126  Sum_probs=31.6

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.++|.++--.|..++|+   |-.++|+++|++++|+.++.
T Consensus         8 rr~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~y~~F   48 (197)
T 2gen_A            8 RKDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHF   48 (197)
T ss_dssp             CHHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCCHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHCC
T ss_conf             99999999999999759251779999998583921134507


No 114
>2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp}
Probab=90.50  E-value=0.45  Score=25.57  Aligned_cols=39  Identities=21%  Similarity=0.193  Sum_probs=33.4

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ++++|.++--+|..+.|   +|-.++|+++|++.+|+.++..
T Consensus        11 rr~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~t~Y~~F~   52 (197)
T 2f07_A           11 KYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFS   52 (197)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTSCHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHCC
T ss_conf             999999999999997391407699999987869115888649


No 115
>3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* 1rpw_A* ...
Probab=90.47  E-value=0.67  Score=24.47  Aligned_cols=38  Identities=8%  Similarity=0.052  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..|..+.|+   |-.++|+.+|++.+|+.++.
T Consensus         3 ~Re~Il~aA~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   43 (194)
T 3bqz_B            3 LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHF   43 (194)
T ss_dssp             -CHHHHHHHHHHHHHHTTTTCCHHHHHHHTTCCHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999769330679999999790999881437


No 116
>1vi0_A Transcriptional regulator; structural genomics; HET: MSE DCC; 1.65A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1
Probab=90.42  E-value=0.62  Score=24.71  Aligned_cols=38  Identities=16%  Similarity=0.142  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--.+..+.|+   |-.++|+.+|++.+|+.++.
T Consensus         9 rr~~Il~aa~~lf~~~G~~~~s~~~Ia~~agvs~~t~Y~~F   49 (206)
T 1vi0_A            9 KYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYF   49 (206)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999999999998739030679999999794999999991


No 117
>2nx4_A Transcriptional regulator, TETR family protein; HTH DNA binding motif, structural genomics, PSI-2, protein structure initiative; 1.70A {Rhodococcus SP}
Probab=90.41  E-value=0.73  Score=24.25  Aligned_cols=38  Identities=16%  Similarity=0.183  Sum_probs=30.5

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.++|.++--++..+.|+   |-.++|+++|++++|+.++.
T Consensus        11 ~r~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~t~Y~~F   51 (194)
T 2nx4_A           11 RRRSITAAAWRLIAARGIEAANMRDIATEAGYTNGALSHYF   51 (194)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999759141659999998790999994306


No 118
>2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=90.38  E-value=0.37  Score=26.12  Aligned_cols=40  Identities=20%  Similarity=0.236  Sum_probs=32.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .-|.++|.++--+|..++|+   |-.++|+.+|++++++.++.
T Consensus         8 ~~~re~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   50 (203)
T 2np5_A            8 STSPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHF   50 (203)
T ss_dssp             -CHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             2899999999999999729030779999999790988770106


No 119
>2zcx_A SCO7815, TETR-family transcriptional regulator; helix-turn-helix, DNA-binding, transcription regulation; 2.22A {Streptomyces coelicolor}
Probab=90.36  E-value=0.71  Score=24.30  Aligned_cols=38  Identities=13%  Similarity=0.274  Sum_probs=31.4

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|+++=.+|..++|+   |-.++|+.+|+|+.++.++.
T Consensus        24 ~R~~IL~AA~~lf~~~G~~~~T~~~IA~~aGvs~~tlY~~F   64 (231)
T 2zcx_A           24 REEAILDAARELGTERGIREITLTDIAATVGMHKSALLRYF   64 (231)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749240679999999791988997875


No 120
>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10
Probab=90.36  E-value=0.42  Score=25.82  Aligned_cols=31  Identities=16%  Similarity=0.325  Sum_probs=26.9

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999999649998899998289987988997
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -++.++++..+|.++||+.+|+|++|+++..
T Consensus        44 il~~i~~~g~iSR~ela~~tgLS~~Tvs~iv   74 (429)
T 1z05_A           44 VYKLIDQKGPISRIDLSKESELAPASITKIT   74 (429)
T ss_dssp             HHHHHHHHCSBCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9999998499189999988795999999999


No 121
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2
Probab=90.31  E-value=0.16  Score=28.47  Aligned_cols=44  Identities=11%  Similarity=0.289  Sum_probs=30.1

Q ss_pred             HHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             99649998899998289987988997515788755779899999873218752
Q gi|254780444|r   17 AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI   69 (223)
Q Consensus        17 ~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~   69 (223)
                      .+..| +++.||+.+||++++|++|..  .      .......+|....+-.+
T Consensus         7 I~~fG-~~~~lA~~lgIs~~aVsqWg~--~------VP~~ra~~iE~~T~G~l   50 (61)
T 1rzs_A            7 IDHFG-TQRAVAKALGISDAAVSQWKE--V------IPEKDAYRLEIVTAGAL   50 (61)
T ss_dssp             HHHHS-SHHHHHHHHTCCHHHHHHCCS--B------CCHHHHHHHHHHTTSCS
T ss_pred             HHHHC-CHHHHHHHHCCCHHHHHHCCC--C------CCHHHHHHHHHHHCCCE
T ss_conf             99968-999999996999999987477--7------98999999999959954


No 122
>3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170}
Probab=90.29  E-value=0.66  Score=24.53  Aligned_cols=38  Identities=21%  Similarity=0.324  Sum_probs=29.9

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--++..+.|   +|-.++|+.+|+|++|+.++.
T Consensus        18 ~R~~Il~aA~~l~~~~G~~~~si~~IA~~agvs~~tlY~~F   58 (208)
T 3cwr_A           18 VRESIVGAAQRLLSSGGAAAMTMEGVASEAGIAKKTLYRFA   58 (208)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999999999869150779999999489966403589


No 123
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A
Probab=90.26  E-value=0.29  Score=26.85  Aligned_cols=32  Identities=22%  Similarity=0.201  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..-++.++++.++|.++||+.+|++++|+++.
T Consensus        19 ~~Il~~i~~~g~iSR~ela~~~gls~~Tvs~i   50 (406)
T 1z6r_A           19 GAVYRLIDQLGPVSRIDLSRLAQLAPASITKI   50 (406)
T ss_dssp             HHHHHHHHSSCSCCHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999859918999998879599999999


No 124
>3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans}
Probab=90.22  E-value=0.37  Score=26.16  Aligned_cols=38  Identities=16%  Similarity=0.203  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++-..|..+.|+   |-.++|+++|++.+|+.++.
T Consensus        27 tr~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~tiY~yF   67 (217)
T 3mvp_A           27 KRNKILQVAKDLFSDKTYFNVTTNEIAKKADVSVGTLYAYF   67 (217)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999998719342789999998890988999988


No 125
>3dew_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.75A {Geobacter sulfurreducens}
Probab=90.21  E-value=0.38  Score=26.09  Aligned_cols=39  Identities=13%  Similarity=0.142  Sum_probs=31.6

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|+++|+++=-++..++|   +|-.++|+++|++++|+.++.
T Consensus         8 ~tr~~Il~aA~~lf~~~G~~~~s~~~IA~~agvs~~tlY~yF   49 (206)
T 3dew_A            8 DCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHF   49 (206)
T ss_dssp             CHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999859241789999999695988998881


No 126
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus}
Probab=90.16  E-value=0.4  Score=25.93  Aligned_cols=38  Identities=11%  Similarity=0.175  Sum_probs=29.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             755899999999999964999889999828998798899
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .||..+ +.-|..|.+..++|+++||+.+|++++|+++.
T Consensus       149 ~ls~~~-~~iL~~L~~~~~~s~~ela~~l~~s~~tv~r~  186 (244)
T 2wte_A          149 DYSREE-MKLLNVLYETKGTGITELAKMLDKSEKTLINK  186 (244)
T ss_dssp             CCCHHH-HHHHHHHHHHTCBCHHHHHHHHTCCHHHHHHH
T ss_pred             CCCHHH-HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999-99999999779989999999979798899999


No 127
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus}
Probab=90.05  E-value=0.45  Score=25.59  Aligned_cols=41  Identities=17%  Similarity=0.243  Sum_probs=33.1

Q ss_pred             CCCCC--HHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             97755--8999999999999649-99889999828998798899
Q gi|254780444|r    1 MTSFS--HKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~--~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+.||  .++-+++|..|.++.+ .+.+++|+.+|++++|+++.
T Consensus         8 m~~ls~~ee~YL~aI~~l~~~~~~v~~~~iA~~L~vs~~svt~~   51 (139)
T 2x4h_A            8 MSNLSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEE   51 (139)
T ss_dssp             ---CCHHHHHHHHHHHHHHTTTSCBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHH
T ss_conf             30378899999999999997599866999999968890799999


No 128
>2rek_A Putative TETR-family transcriptional regulator; sulfur, SAD, structural genomics, PSI-2, protein structure initiative; 1.86A {Streptomyces coelicolor A3}
Probab=90.03  E-value=0.61  Score=24.74  Aligned_cols=38  Identities=24%  Similarity=0.382  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHHHCCC--CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499--98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL--TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl--s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..|..++|+  |-.++|+.+|++..|+.++.
T Consensus        17 ~R~~Il~aA~~l~~~~G~~~T~~~IA~~aGvs~~tlY~~F   56 (199)
T 2rek_A           17 NYDRIIEAAAAEVARHGADASLEEIARRAGVGSATLHRHF   56 (199)
T ss_dssp             HHHHHHHHHHHHHHHHGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999986978889999999791999998775


No 129
>3ni7_A Bacterial regulatory proteins, TETR family; transcriptional regulator, structural genomics, PSI-2, structure initiative; HET: MSE; 2.78A {Nitrosomonas europaea}
Probab=90.01  E-value=0.9  Score=23.65  Aligned_cols=38  Identities=8%  Similarity=0.028  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|..+--+|..+.|+   |-.++|+++|++++++..+.
T Consensus         8 ~R~~Il~AA~~lf~e~G~~~~s~~~IA~~AGvs~~~iy~yF   48 (213)
T 3ni7_A            8 MRDAIVDTAVELAAHTSWEAVRLYDIAARLAVSLDEIRLYF   48 (213)
T ss_dssp             HHHHHHHHHHHHHHHSCSTTCCHHHHHHHTTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999869768789999999099999998746


No 130
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A
Probab=90.00  E-value=0.48  Score=25.39  Aligned_cols=44  Identities=11%  Similarity=0.070  Sum_probs=29.8

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHH---HHHHHHCCCCC
Q ss_conf             99988999982899879889975157887557798999---99873218752
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI---FKILAATNETI   69 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l---~kia~~~~v~~   69 (223)
                      .+|-.++|+++|||.+|+|+.-++..  +   .+.++-   .++++-+|-.+
T Consensus         2 ~vTi~dIA~~aGVS~~TVSr~Ln~~~--~---vs~~tr~kV~~~a~elgY~p   48 (332)
T 2hsg_A            2 NVTIYDVAREASVSMATVSRVVNGNP--N---VKPSTRKKVLETIERLGYRP   48 (332)
T ss_dssp             CCCHHHHHHHTTSCHHHHHHHHTTCT--T---SCHHHHHHHHHHHHHHTCCS
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHCCCC--C---CCHHHHHHHHHHHHHHCCCC
T ss_conf             76799999998979999999978959--9---99999999999999968986


No 131
>3bhq_A Transcriptional regulator; bacterial RE proteins, structural genomics, joint center for structural JCSG; HET: MSE; 1.54A {Mesorhizobium loti MAFF303099}
Probab=89.98  E-value=0.97  Score=23.44  Aligned_cols=38  Identities=18%  Similarity=0.166  Sum_probs=31.5

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..+.|+   |-.++|+++|+|.+++.++.
T Consensus        13 ~r~~Il~aa~~lf~~~G~~~~ti~~Ia~~agvs~~~~Y~~F   53 (211)
T 3bhq_A           13 KDREIIQAATAAFISKGYDGTSMEEIATKAGASKQTVYKHF   53 (211)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999859150779999998588840587778


No 132
>3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator of TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824}
Probab=89.91  E-value=0.53  Score=25.16  Aligned_cols=38  Identities=11%  Similarity=0.041  Sum_probs=30.4

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--.|..++|+   |-.++|+++||+.+++.++.
T Consensus        12 ~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~yF   52 (203)
T 3b81_A           12 KRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYF   52 (203)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999729241779999999790999997646


No 133
>1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} SCOP: a.4.1.9 a.121.1.1 PDB: 3loc_A*
Probab=89.89  E-value=0.84  Score=23.84  Aligned_cols=38  Identities=18%  Similarity=0.102  Sum_probs=30.2

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..+..++|+   |-.++|+++|++.+++.++.
T Consensus        19 ~r~~Il~aA~~lf~~~G~~~~si~~IA~~agvs~~tiY~yF   59 (212)
T 1pb6_A           19 KKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYF   59 (212)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHTTSCHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999859152889999999791987897877


No 134
>3knw_A Putative transcriptional regulator (TETR/ACRR family); TETR-like protein, MCSG, PSI, structural genomics, protein structure initiative; 2.45A {Acinetobacter SP}
Probab=89.88  E-value=0.47  Score=25.45  Aligned_cols=38  Identities=13%  Similarity=0.176  Sum_probs=30.7

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--.+..++|   +|-.++|+++|++++|+.++.
T Consensus        15 ~R~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~t~Y~~F   55 (212)
T 3knw_A           15 KRQHILDSGFHLVLRKGFVGVGLQEILKTSGVPKGSFYHYF   55 (212)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999999999999719463879999999790999998883


No 135
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor A3}
Probab=89.86  E-value=0.48  Score=25.44  Aligned_cols=41  Identities=20%  Similarity=0.242  Sum_probs=33.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             75589999999999996499---988999982899879889975
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .-|+++|.++--+|..+.|+   |-.++|+++|+++.|+.++..
T Consensus         6 ~~tr~~Il~AA~~l~~~~G~~~~tl~~IA~~agvs~~t~Y~~F~   49 (195)
T 2dg7_A            6 PGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFP   49 (195)
T ss_dssp             TTHHHHHHHHHHHHHHHSCGGGCCHHHHHHHTTCCHHHHHHHCS
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             46999999999999998590406699999997909889977779


No 136
>3c07_A Putative TETR-family transcriptional regulator; APC6322, structural genomics, PSI-2, protein structure initiative; 2.70A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1 PDB: 2ofl_A*
Probab=89.71  E-value=0.98  Score=23.41  Aligned_cols=39  Identities=18%  Similarity=0.124  Sum_probs=31.0

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|++.|+++=-+|..++|   +|-.++|+++|++++++..+.
T Consensus        41 ~tR~~IldaA~~lf~~~G~~~~sv~~IA~~AGvs~~t~Y~hF   82 (273)
T 3c07_A           41 QTRALILETAMRLFQERGYDRTTMRAIAQEAGVSVGNAYYYF   82 (273)
T ss_dssp             HHHHHHHHHHHHHHHHTCSTTCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999729441789999999891999999995


No 137
>1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1
Probab=89.70  E-value=0.29  Score=26.83  Aligned_cols=43  Identities=21%  Similarity=0.238  Sum_probs=33.8

Q ss_pred             CCCC--CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             9775--589999999999996499---988999982899879889975
Q gi|254780444|r    1 MTSF--SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         1 ~~~~--~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |++.  |+++|.++--++..++|+   |-.++|+++|++++++.++..
T Consensus         1 M~~~~~tR~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~~~y~~F~   48 (191)
T 1sgm_A            1 MTSRGDSREKILHTASRLSQLQGYHATGLNQIVKESGAPKGSLYHFFP   48 (191)
T ss_dssp             ----CCHHHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCCSCHHHHSTT
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             998279999999999999998392507799999986919889978849


No 138
>1t56_A EThr repressor; helix-turn-helix, TETR family, dimer, transcription; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: a.4.1.9 a.121.1.1 PDB: 3g1m_A* 1u9n_A* 1u9o_A*
Probab=89.61  E-value=0.6  Score=24.81  Aligned_cols=38  Identities=18%  Similarity=0.261  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|   +|-.++|+++|++.+|+.++.
T Consensus        25 ~r~~Il~aA~~l~~~~G~~~~ti~~IA~~agvs~~tlY~yF   65 (216)
T 1t56_A           25 RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYF   65 (216)
T ss_dssp             HHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCHHHHHHHC
T ss_conf             99999999999999709240789999988399999995763


No 139
>3c2b_A Transcriptional regulator, TETR family; structural genomics, APC5923, PSI-2, protein structure initiative; 2.10A {Agrobacterium tumefaciens str}
Probab=89.57  E-value=0.97  Score=23.43  Aligned_cols=39  Identities=26%  Similarity=0.208  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             589999999999996499---988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ++++|+++--+|..++|+   |-.++|+++|+|.+++.++..
T Consensus        16 rr~~Il~aA~~lf~~~G~~~~ti~~Ia~~agvs~~t~Y~~F~   57 (221)
T 3c2b_A           16 RQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFG   57 (221)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             999999999999997591307799999997949889998879


No 140
>3lwj_A Putative TETR-family transcriptional regulator; structural genomics, joint center for structural genomics, JCSG; 2.07A {Syntrophomonas wolfei subsp}
Probab=89.48  E-value=0.53  Score=25.16  Aligned_cols=38  Identities=8%  Similarity=0.037  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--++..++|+   |-.++|+++|++.+++.++.
T Consensus        13 ~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   53 (202)
T 3lwj_A           13 RRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYF   53 (202)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHHCSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999998709551759999998792999998866


No 141
>3hta_A EBRA repressor; TETR family, DNA binding protein, multidrug resistance, MULT binding protein, DNA-binding, transcription; 2.30A {Streptomyces lividans} PDB: 3hth_A* 3hti_A* 3htj_A* 3iuv_A
Probab=89.45  E-value=0.83  Score=23.88  Aligned_cols=37  Identities=19%  Similarity=0.170  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             8999999999999649---998899998289987988997
Q gi|254780444|r    6 HKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +++|.++--+|..+.|   +|-.++|+++|++..++.++.
T Consensus        30 R~~Il~aa~~l~~~~G~~~~t~~~IA~~aGvs~~tlY~~F   69 (217)
T 3hta_A           30 RQRIIDAAIRVVGQKGIAGLSHRTVAAEADVPLGSTTYHF   69 (217)
T ss_dssp             HHHHHHHHHHHHHHHTGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999859040779999999488831487616


No 142
>3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; 2.40A {Rhodococcus SP}
Probab=89.42  E-value=0.53  Score=25.12  Aligned_cols=38  Identities=11%  Similarity=0.093  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..+.|   +|-.++|+++||++.|+.++.
T Consensus        15 rr~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~t~Y~~F   55 (203)
T 3f1b_A           15 REQQMLDAAVDVFSDRGFHETSMDAIAAKAEISKPMLYLYY   55 (203)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHTTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999739352879999999890988887881


No 143
>3e7q_A Transcriptional regulator; structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomics; 2.20A {Pseudomonas aeruginosa}
Probab=89.42  E-value=0.71  Score=24.32  Aligned_cols=38  Identities=18%  Similarity=0.181  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..+.|   +|-+++|+++|++.+|+.++.
T Consensus        15 ~R~~Il~aA~~l~~~~G~~~~s~~~Ia~~agvs~~tlY~~F   55 (215)
T 3e7q_A           15 RKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHY   55 (215)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749040779999999793988999886


No 144
>2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genomics, PSI-2, RHA08332, MCSG; 2.20A {Rhodococcus SP}
Probab=89.28  E-value=0.64  Score=24.61  Aligned_cols=41  Identities=10%  Similarity=0.106  Sum_probs=34.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             75589999999999996499---988999982899879889975
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..++++|.++--+|..++|+   |-.++|+.+||+.+|+.++..
T Consensus        16 ~~~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F~   59 (207)
T 2rae_A           16 STTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFP   59 (207)
T ss_dssp             CCHHHHHHHHHHHHHHHHCTTTSCHHHHHHHTTSCHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             98999999999999997291306799999997919889988879


No 145
>2of7_A Putative TETR-family transcriptional regulator; APC7240, streptomyces coelicolor A3, structural genomics, PSI-2; 2.30A {Streptomyces coelicolor}
Probab=89.28  E-value=0.55  Score=25.04  Aligned_cols=40  Identities=15%  Similarity=0.185  Sum_probs=31.8

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -|+++|+++--+|..+.|+   |-.++|+++||++++|..+..
T Consensus        48 ~tR~~Il~AA~~lf~e~G~~~vS~~~IA~~AGVS~~t~Y~~F~   90 (260)
T 2of7_A           48 RTREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFP   90 (260)
T ss_dssp             HHHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999998394528799999996967979999859


No 146
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A
Probab=89.25  E-value=1  Score=23.31  Aligned_cols=41  Identities=10%  Similarity=0.123  Sum_probs=34.4

Q ss_pred             CCCCC--HHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             97755--8999999999999649-99889999828998798899
Q gi|254780444|r    1 MTSFS--HKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~--~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+.||  -|+-+++|..|.++.+ .+.++||+.+|++++|++..
T Consensus         1 m~~ls~~~E~YL~~Iy~l~~~~~~~~~~~lA~~L~vs~~sv~~~   44 (230)
T 1fx7_A            1 MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQT   44 (230)
T ss_dssp             CCTTSSHHHHHHHHHHHHHHHTSCCCHHHHHHHHTCCHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             98665679999999999986499761999999878892899999


No 147
>2zcm_A Biofilm operon icaabcd HTH-type negative transcriptional regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis RP62A} PDB: 2zcn_A
Probab=89.24  E-value=0.64  Score=24.62  Aligned_cols=37  Identities=11%  Similarity=0.134  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             8999999999999649---998899998289987988997
Q gi|254780444|r    6 HKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +++|.++-.++..+.|   +|-.++|+.+|++.+++.++.
T Consensus         9 R~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~~lY~~F   48 (192)
T 2zcm_A            9 KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHY   48 (192)
T ss_dssp             HHHHHHHHHHHHHHHCTTTCCHHHHHHHTTCCHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999749262779999998890988997887


No 148
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens}
Probab=89.18  E-value=0.84  Score=23.86  Aligned_cols=38  Identities=16%  Similarity=0.319  Sum_probs=32.9

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999999649998899998289987988997515
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .+...|+..+.+.|++|..++..+|+++++|+++.+..
T Consensus        31 ~~a~eIk~~L~~~~i~q~~~~~~~g~SqSsiS~~L~~~   68 (221)
T 2h8r_A           31 RAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKG   68 (221)
T ss_dssp             HHHHHHHHHHHHHTCCHHHHHHHHTCCHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHCCCCHHHHHCCCCCCHHHHHHHHCCC
T ss_conf             99999999998669845553001244443788987189


No 149
>2i10_A Putative TETR transcriptional regulator; structural genomics, APC5890, TETR family, PSI-2, protein structure initiative; HET: MSE NPO PGE; 2.05A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=89.17  E-value=1.1  Score=23.05  Aligned_cols=41  Identities=15%  Similarity=0.268  Sum_probs=32.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             75589999999999996499---988999982899879889975
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .+++++|+++=-+|..+.|+   |-.++|+++|++.+++.++..
T Consensus        10 ~~~re~Il~aA~~l~~~~G~~~~ti~~IA~~agvs~~t~Y~~F~   53 (202)
T 2i10_A           10 GFDDQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFG   53 (202)
T ss_dssp             --CCHHHHHHHHHHHHHHTTTTCCHHHHHHHHTCCHHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             86199999999999998691407699999997909999977618


No 150
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum}
Probab=89.16  E-value=0.4  Score=25.94  Aligned_cols=45  Identities=18%  Similarity=0.151  Sum_probs=31.5

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHH---HHHHHHHHCCC
Q ss_conf             964999889999828998798899751578875577989---99998732187
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE---SIFKILAATNE   67 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~---~l~kia~~~~v   67 (223)
                      +++..|..++|+++|||.+|+++.-++...     -+.+   .+.++++.+|-
T Consensus         6 ~~~~~Tl~diA~~agVS~~TVsraLn~~~~-----vs~~tr~rV~~~a~~lgY   53 (366)
T 3h5t_A            6 KQQYGTLASIAAKLGISRTTVSNAYNRPEQ-----LSAELRQRILDTAEDMGY   53 (366)
T ss_dssp             -CCTTHHHHHHHHHTSCHHHHHHHHHCGGG-----SCHHHHHHHHHHHHHTTC
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHCCCCC-----CCHHHHHHHHHHHHHHCC
T ss_conf             999863999999988799999999689899-----999999999999998399


No 151
>3he0_A Transcriptional regulator, TETR family; ACRR, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Vibrio parahaemolyticus}
Probab=89.06  E-value=0.43  Score=25.74  Aligned_cols=39  Identities=15%  Similarity=0.227  Sum_probs=31.9

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      =++++|.++-.+|..++|+   |-.++|+++|++..|+.++.
T Consensus        11 ~~R~~Il~aa~~l~~~~G~~~~si~~Ia~~agvs~~tiY~~F   52 (196)
T 3he0_A           11 DKRDQILAAAEQLIAESGFQGLSMQKLANEAGVAAGTIYRYF   52 (196)
T ss_dssp             CCHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTSCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             999999999999999739563779999998689977540218


No 152
>2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3}
Probab=89.06  E-value=0.36  Score=26.25  Aligned_cols=40  Identities=15%  Similarity=0.145  Sum_probs=33.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             75589999999999996499---98899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ..|+++|+++-.++..++|+   |-.++|+.+|++.++|.++.
T Consensus        29 ~~tR~~il~AA~~lf~~~G~~~~T~~~IA~~aGvs~~tlY~~F   71 (226)
T 2pz9_A           29 DSTRQRIVAAAKEEFARHGIAGARVDRIAKQARTSKERVYAYF   71 (226)
T ss_dssp             -CCHHHHHHHHHHHHHHHHHHHCCHHHHHHHTTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999999859241889999999693875797885


No 153
>3egq_A TETR family transcriptional regulator; NP_070644.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus}
Probab=89.00  E-value=0.43  Score=25.71  Aligned_cols=38  Identities=18%  Similarity=0.107  Sum_probs=32.3

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.++|.++--+|..+.|+   |-.++|+++||+++|+.++.
T Consensus         5 ~r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~Y~~F   45 (170)
T 3egq_A            5 QSVRIIEAALRLYMKKPPHEVSIEEIAREAKVSKSLIFYHF   45 (170)
T ss_dssp             HHHHHHHHHHHHHTTSCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCHHHC
T ss_conf             99999999999999749240679999998489968706428


No 154
>3crj_A Transcription regulator; APC88200, TETR, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.60A {Haloarcula marismortui atcc 43049}
Probab=88.98  E-value=0.37  Score=26.13  Aligned_cols=38  Identities=18%  Similarity=0.186  Sum_probs=30.6

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.++|.++-.++..++|+   |-.++|+++|++++++.++.
T Consensus        15 ~r~~Il~aA~~lf~~~G~~~~t~~~IA~~agvs~~tiY~~F   55 (199)
T 3crj_A           15 QTEEIMQATYRALREHGYADLTIQRIADEYGKSTAAVHYYY   55 (199)
T ss_dssp             HHHHHHHHHHHHHHHHTTTTCCHHHHHHHHTSCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749040779999999791999998885


No 155
>1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.40A {Enterococcus faecalis V583} SCOP: a.4.1.9 a.121.1.1
Probab=88.94  E-value=0.48  Score=25.43  Aligned_cols=40  Identities=15%  Similarity=0.196  Sum_probs=32.2

Q ss_pred             CCCHHHHHHH-HHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             7558999999-999999649---998899998289987988997
Q gi|254780444|r    3 SFSHKKIWEA-IDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~-i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .+|+++|..+ ++-+.+++|   +|-.++|+.+||++++|.++.
T Consensus         4 ~ltr~~Il~aA~~lf~~~~G~~~~T~~~IA~~aGvs~~~lY~hF   47 (220)
T 1z0x_A            4 KLSKDTIIAAAFSLLEKSPTLEQLSMRKVAKQLGVQAPAIYWYF   47 (220)
T ss_dssp             CCSHHHHHHHHHHHHHHSCCGGGCCHHHHHHHHTSCHHHHHTTC
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             25599999999999988089531679999999696787899996


No 156
>2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structure initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=88.93  E-value=0.51  Score=25.22  Aligned_cols=40  Identities=18%  Similarity=0.282  Sum_probs=31.7

Q ss_pred             CCCHHHHHHH-HHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             7558999999-999999649998899998289987988997
Q gi|254780444|r    3 SFSHKKIWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~-i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .+|+++|+++ .+-+.++-++|-.++|+++||++.|+.+|.
T Consensus        10 ~~tR~~Il~aA~~lf~e~G~~S~~~IA~~aGvs~~tlY~yF   50 (213)
T 2g7g_A           10 RLDRERIAEAALELVDRDGDFRMPDLARHLNVQVSSIYHHA   50 (213)
T ss_dssp             -CCHHHHHHHHHHHHHHHSSCCHHHHHHHTTSCHHHHHTTS
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             02499999999999998298629999999696877899887


No 157
>3cjd_A Transcriptional regulator, TETR family; YP_510936.1, putative TETR transcriptional regulator, structural genomics; HET: STE; 1.79A {Jannaschia SP}
Probab=88.92  E-value=0.53  Score=25.14  Aligned_cols=38  Identities=18%  Similarity=0.173  Sum_probs=31.6

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-.+|..++|+   |-.++|+++|++.+++.++.
T Consensus        13 ~R~~Il~aA~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   53 (198)
T 3cjd_A           13 LREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHF   53 (198)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHCC
T ss_conf             99999999999999709340579999998288932102307


No 158
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A*
Probab=88.86  E-value=0.65  Score=24.57  Aligned_cols=37  Identities=11%  Similarity=0.191  Sum_probs=29.6

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|..+ |..|..+.++.|+|+++||+.+|++++++++.
T Consensus        27 lt~~q-~~vL~~i~~~~~~t~~eLa~~~~~~~~~vs~~   63 (138)
T 3bpv_A           27 LTDAQ-VACLLRIHREPGIKQDELATFFHVDKGTIART   63 (138)
T ss_dssp             CCHHH-HHHHHHHHHSTTCBHHHHHHHHTCCHHHHHHH
T ss_pred             CCHHH-HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             89999-99999998589979999999989798799999


No 159
>2oi8_A Putative regulatory protein SCO4313; TETR, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1
Probab=88.79  E-value=0.72  Score=24.28  Aligned_cols=39  Identities=10%  Similarity=0.124  Sum_probs=31.3

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|+++|.++--+|..+.|   +|-.++|+.+|++++++.++.
T Consensus        16 ~~R~~Il~aA~~l~~~~G~~~~t~~~IA~~aGvs~~~lY~~F   57 (216)
T 2oi8_A           16 QVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYF   57 (216)
T ss_dssp             HHHHHHHHHHHHHHHHHCTTSCCHHHHHHHTTCCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999709653889999999797988999887


No 160
>2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor}
Probab=88.75  E-value=0.56  Score=24.96  Aligned_cols=38  Identities=18%  Similarity=0.202  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..+.|+   |-.++|+++|++.+++.++.
T Consensus        24 ~R~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~tlY~~F   64 (214)
T 2zb9_A           24 VRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWW   64 (214)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHCCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999859350879999999792988874508


No 161
>3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii atcc 33406}
Probab=88.70  E-value=0.65  Score=24.56  Aligned_cols=38  Identities=16%  Similarity=0.089  Sum_probs=30.8

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..+..++|   +|-.++|+.+|++++|+.++.
T Consensus        12 ~re~Il~aA~~lf~~~G~~~~s~~~IA~~aGvs~~tlY~yF   52 (216)
T 3f0c_A           12 KLELIINAAQKRFAHYGLCKTTMNEIASDVGMGKASLYYYF   52 (216)
T ss_dssp             HHHHHHHHHHHHHHHHCSSSCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749030789999998598852798757


No 162
>2qib_A TETR-family transcriptional regulator; HTH DNA binding, structural genomics, MCSG, PSI-2, protein structure initiative; HET: P6G; 1.70A {Streptomyces coelicolor A3}
Probab=88.69  E-value=0.74  Score=24.20  Aligned_cols=38  Identities=11%  Similarity=0.125  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|   +|-.++|+++|++.+++.+|.
T Consensus        14 rR~~Il~AA~~l~~~~G~~~~t~~~IA~~aGvs~~tlY~~F   54 (231)
T 2qib_A           14 RRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYF   54 (231)
T ss_dssp             HHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999739450779999999793988998884


No 163
>2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, TETR family, transcription; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A
Probab=88.69  E-value=0.34  Score=26.39  Aligned_cols=39  Identities=10%  Similarity=0.077  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |+++|.++=.+|..+.|   .|-.++|+.+|++++++.++..
T Consensus         8 tre~Il~aA~~lf~~~G~~~~ti~~IA~~agvs~~tiY~~F~   49 (186)
T 2jj7_A            8 TMENILKAAKKKFGERGYEGTSIQEIAKEAKVNVAMASYYFN   49 (186)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTSCHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             999999999999998591417799999986969889977878


No 164
>3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1}
Probab=88.58  E-value=0.64  Score=24.59  Aligned_cols=38  Identities=13%  Similarity=0.236  Sum_probs=31.4

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..+.|   +|-.++|+++|++++|+.++.
T Consensus        11 ~r~~Il~aa~~l~~~~G~~~~si~~Ia~~agvs~~tiY~yF   51 (196)
T 3col_A           11 KQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYF   51 (196)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999759140779999999691998885876


No 165
>3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.90A {Marinobacter aquaeolei}
Probab=88.56  E-value=0.87  Score=23.76  Aligned_cols=38  Identities=24%  Similarity=0.289  Sum_probs=31.3

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..|..++|   +|-.++|+.+|++.+|+.++.
T Consensus         9 ~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   49 (195)
T 3pas_A            9 KRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYY   49 (195)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHCC
T ss_conf             99999999999999739340759999998691914103429


No 166
>3cdl_A Transcriptional regulator AEFR; APC88582, TETR, pseudomonas syringae PV. tomato STR. DC3000, structural genomics, PSI-2; HET: MSE; 2.36A {Pseudomonas syringae PV}
Probab=88.50  E-value=0.42  Score=25.77  Aligned_cols=38  Identities=11%  Similarity=0.059  Sum_probs=31.2

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|+   |-.++|+++|++++++.++.
T Consensus        10 ~R~~Il~aA~~lf~~~G~~~~ti~~Ia~~agvs~~tiY~~F   50 (203)
T 3cdl_A           10 KRESIVQAAIAEFGDRGFEITSMDRIAARAEVSKRTVYNHF   50 (203)
T ss_dssp             HHHHHHHHHHHHHHHHCTTTCCHHHHHHHTTSCHHHHHTTS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHC
T ss_conf             99999999999999759050789999998685955255218


No 167
>1rkt_A Protein YFIR; transcription regulator, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1
Probab=88.49  E-value=0.77  Score=24.10  Aligned_cols=38  Identities=16%  Similarity=0.200  Sum_probs=30.2

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.++|.++-..+..+.|+   |-+++|+++|++++|+.++.
T Consensus        13 ~r~~Il~aA~~lf~~~G~~~~t~~~Ia~~agvs~~tlY~~F   53 (205)
T 1rkt_A           13 RQAEILEAAKTVFKRKGFELTTMKDVVEESGFSRGGVYLYF   53 (205)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999999999749151879999998689857411578


No 168
>2g3b_A Putative TETR-family transcriptional regulator; transcription regulator, structural genomics, P protein structure initiative; HET: MSE; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=88.43  E-value=1.1  Score=23.19  Aligned_cols=39  Identities=18%  Similarity=0.219  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ++++|.++--+|..++|   +|-.++|+++|+++.++.++..
T Consensus         4 rR~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~yF~   45 (208)
T 2g3b_A            4 RRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFK   45 (208)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTSCHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             999999999999997591507799999997929999988869


No 169
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens}
Probab=88.40  E-value=0.65  Score=24.58  Aligned_cols=37  Identities=14%  Similarity=0.215  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             99999999999964999889999828998798899751
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .++...|=+|.+ .|+++.++|+.+||+.+++++|.+.
T Consensus        28 ~~lR~rIv~l~~-~G~s~r~IArrl~VS~stV~kil~R   64 (159)
T 2k27_A           28 EVVRQRIVDLAH-QGVRPCDISRQLRVSHGCVSKILGR   64 (159)
T ss_dssp             HHHHHHHHHHHH-HTCCHHHHHHHHTCCSHHHHHHHCC
T ss_pred             HHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999999999998-6999999999889599999999999


No 170
>3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX}
Probab=88.37  E-value=0.81  Score=23.95  Aligned_cols=38  Identities=8%  Similarity=0.138  Sum_probs=31.6

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|+   |-.++|+.+|+++.|+.++.
T Consensus        32 ~R~~Il~aA~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   72 (218)
T 3dcf_A           32 RRTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYF   72 (218)
T ss_dssp             HHHHHHHHHHHHHHHTCTTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCHHHC
T ss_conf             99999999999999849351789999998198934102414


No 171
>3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus}
Probab=88.35  E-value=0.43  Score=25.75  Aligned_cols=39  Identities=18%  Similarity=0.270  Sum_probs=31.6

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|.++--++..+.|   +|-.++|+.+|++++++.++.
T Consensus        14 ~tr~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~tlY~~F   55 (156)
T 3ljl_A           14 ITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHF   55 (156)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999998719030779999998698886998987


No 172
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1
Probab=88.33  E-value=1.1  Score=23.12  Aligned_cols=41  Identities=17%  Similarity=0.233  Sum_probs=32.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .||--+...++.++. +.|+|+.++|+++|++.++++++.+-
T Consensus       117 ~lsp~e~a~~~~~l~-~~g~t~~~iA~~lg~s~~~V~~~l~L  157 (230)
T 1vz0_A          117 DLSPVEEARGYQALL-EMGLTQEEVARRVGKARSTVANALRL  157 (230)
T ss_dssp             TCCHHHHHHHHHHHH-HTTCCHHHHHHHHTCCHHHHHHHHHG
T ss_pred             CCCHHHHHHHHHHHH-HHCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             898899999999998-84189999998809999999999987


No 173
>2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A*
Probab=88.25  E-value=0.57  Score=24.93  Aligned_cols=38  Identities=21%  Similarity=0.223  Sum_probs=29.8

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++--++..+.|+   |-.++|+++|+|++++..+.
T Consensus        12 tR~~Il~aa~~l~~~~G~~~~s~~~Ia~~agvs~~tiY~~F   52 (210)
T 2xdn_A           12 TRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHF   52 (210)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCTTHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999759140779999999792988998886


No 174
>2qtq_A Transcriptional regulator, TETR family; YP_496351.1, predicted DNA-binding transcriptional regulator; HET: MSE; 1.85A {Novosphingobium aromaticivorans DSM12444} PDB: 2rha_A*
Probab=88.18  E-value=0.75  Score=24.18  Aligned_cols=39  Identities=10%  Similarity=0.192  Sum_probs=32.0

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             58999999999999649---9988999982899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ++++|..+-.++..++|   +|-.++|+++|++.+++.++..
T Consensus        17 ~Re~Il~aA~~lf~~~G~~~~si~~Ia~~agvs~~tiy~yF~   58 (213)
T 2qtq_A           17 ARDLLLQTASNIMREGDVVDISLSELSLRSGLNSALVKYYFG   58 (213)
T ss_dssp             HHHHHHHHHHHHHHHHTSSCCCHHHHHHHHCCCHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             999999999999997393417899999997949999999879


No 175
>2v57_A TETR family transcriptional repressor LFRR; DNA-binding, transcription regulation; HET: PRL; 1.90A {Mycobacterium smegmatis} PDB: 2wgb_A
Probab=88.14  E-value=1.1  Score=23.05  Aligned_cols=39  Identities=15%  Similarity=0.248  Sum_probs=30.3

Q ss_pred             CCHHHHHHH-HHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999-999999649998899998289987988997
Q gi|254780444|r    4 FSHKKIWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~-i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|.++ ++-+.++-+.|-+++|+++|++..|+.++.
T Consensus        14 ~tr~~Il~aA~~l~~~~G~~T~~~IA~~agvs~~t~Y~~F   53 (190)
T 2v57_A           14 RTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYY   53 (190)
T ss_dssp             HHHHHHHHHHHHHHTTCTTCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             9999999999999998699739999999890999997773


No 176
>3ccy_A Putative TETR-family transcriptional regulator; APC88698, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.01A {Bordetella parapertussis 12822}
Probab=88.10  E-value=0.6  Score=24.78  Aligned_cols=38  Identities=16%  Similarity=0.138  Sum_probs=32.3

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|+   |-.++|+++|++++|+.++.
T Consensus        15 ~r~~Il~aa~~lf~e~G~~~~t~~~Ia~~agvs~~tlY~~F   55 (203)
T 3ccy_A           15 IRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYF   55 (203)
T ss_dssp             HHHHHHHHHHHHHHHTCTTTSCHHHHHHHTTCCGGGGTTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCHHCC
T ss_conf             99999999999999849452789999998589867730248


No 177
>2ras_A Transcriptional regulator, TETR family; YP_495839.1, predicted transcriptional regulator of TETR/ACRR family; 1.80A {Novosphingobium aromaticivorans DSM12444}
Probab=88.07  E-value=0.71  Score=24.32  Aligned_cols=37  Identities=19%  Similarity=0.296  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             89999999999996499---98899998289987988997
Q gi|254780444|r    6 HKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +++|.++-.+|..+.|+   |-.++|+++|++.+++.++.
T Consensus        13 R~~Il~aa~~l~~~~G~~~~s~~~IA~~agvs~~t~Y~~F   52 (212)
T 2ras_A           13 RARLVDVAQAIVEERGGAGLTLSELAARAGISQANLSRYF   52 (212)
T ss_dssp             HHHHHHHHHHHHHHHTSSCCCHHHHHHHHTSCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             9999999999999849140779999998388945441129


No 178
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A
Probab=88.01  E-value=0.92  Score=23.60  Aligned_cols=34  Identities=15%  Similarity=0.272  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             99999999999649998899998289987988997
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++..+|=.+. +.|+|+.++|+..||+.+++++|.
T Consensus        36 dlR~rIV~~~-~~G~s~r~IArrf~VS~stV~kii   69 (149)
T 1k78_A           36 VVRQRIVELA-HQGVRPCDISRQLRVSHGCVSKIL   69 (149)
T ss_dssp             HHHHHHHHHH-HTTCCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9999999999-969999999998894999999999


No 179
>3g1l_A Transcriptional regulatory repressor protein (TETR-family) EThr; DNA-binding, transcription regulation; HET: RF2; 1.70A {Mycobacterium tuberculosis} PDB: 3g1o_A*
Probab=87.97  E-value=0.82  Score=23.90  Aligned_cols=38  Identities=21%  Similarity=0.272  Sum_probs=32.5

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|+   |-.++|+++|++.+++.++.
T Consensus        45 rr~~Il~AA~~l~~e~G~~~~Tl~~IA~~aGvs~~tlY~~F   85 (256)
T 3g1l_A           45 RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYF   85 (256)
T ss_dssp             HHHHHHHHHHHHTTTSCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999839451769999999890999998882


No 180
>3npi_A TETR family regulatory protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.96A {Corynebacterium diphtheriae}
Probab=87.84  E-value=0.57  Score=24.95  Aligned_cols=41  Identities=10%  Similarity=0.146  Sum_probs=33.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             75589999999999996499---988999982899879889975
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..|.++|+++=.+|..++|+   |-.++|+.+|++.++|.++..
T Consensus        17 e~~~e~IL~aA~~lf~~~G~~~~s~~~IA~~aGvs~~sly~~F~   60 (251)
T 3npi_A           17 EVSTDTVLDIALSLFSELGFSDAKLEAIAKKSGMSKRMIHYHFG   60 (251)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             64799999999999998692528899999997949667888679


No 181
>2oer_A Probable transcriptional regulator; helix-turn-helix, alpha-beta, structural genomics, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa}
Probab=87.76  E-value=0.81  Score=23.94  Aligned_cols=38  Identities=21%  Similarity=0.170  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |.++|.++-.+|..+.|+   |-.++|+.+|++++++.++.
T Consensus        25 tr~~Il~aA~~l~~~~G~~~~t~~~Ia~~agvs~~t~Y~~F   65 (214)
T 2oer_A           25 LVASILEAAVQVLASEGAQRFTTARVAERAGVSIGSLYQYF   65 (214)
T ss_dssp             HHHHHHHHHHHC------CCCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749451779999999890998999881


No 182
>3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V}
Probab=87.56  E-value=0.31  Score=26.66  Aligned_cols=39  Identities=13%  Similarity=0.184  Sum_probs=32.8

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|++.|.++.-.|..++|+   |-.++|+.+||+++|+.++.
T Consensus        12 ~tr~~I~~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F   53 (177)
T 3kkc_A           12 KTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHY   53 (177)
T ss_dssp             HHHHHHHHHHHHHTTTSCTTTCCHHHHHHHHCCCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999998869740769999999797877743658


No 183
>2w53_A Repressor, SMet; antibiotic resistance, multi-drug efflux pump, transcription regulation, transcriptional repressor, DNA binding; 2.00A {Stenotrophomonas maltophilia}
Probab=87.54  E-value=1.1  Score=23.11  Aligned_cols=38  Identities=16%  Similarity=0.149  Sum_probs=29.6

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|.++=-++..++|   +|-.++|+++|+++.++.++.
T Consensus        12 tr~~Il~aA~~l~~~~G~~~~t~~~Ia~~Agvs~g~lY~~F   52 (219)
T 2w53_A           12 TREGILDAAEACFHEHGVARTTLEMIGARAGYTRGAVYWHF   52 (219)
T ss_dssp             CHHHHHHHHHHHHHHHCTTTCCHHHHHHHHTSCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999999999859240889999998488955420478


No 184
>2qko_A Possible transcriptional regulator, TETR family protein; structural genomics, PSI-2, protein structure initiative; 2.35A {Rhodococcus SP}
Probab=87.36  E-value=0.96  Score=23.46  Aligned_cols=38  Identities=11%  Similarity=0.013  Sum_probs=31.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|+.+--++..++|+   |-+++|+.+|++++++.++.
T Consensus        29 rR~~Il~AA~~l~~~~G~~~~Ti~~IA~~Agvs~~tlY~~F   69 (215)
T 2qko_A           29 RRAALVNAAIEVLAREGARGLTFRAVDVEANVPKGTASNYF   69 (215)
T ss_dssp             HHHHHHHHHHHHHHHTCTTTCCHHHHHHHSSSTTTCHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999859140789999998786840698884


No 185
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription/DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A
Probab=87.33  E-value=1.5  Score=22.30  Aligned_cols=41  Identities=12%  Similarity=0.131  Sum_probs=35.0

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHH-HCCCHHHHHHHHHC
Q ss_conf             558999999999999649998899998-28998798899751
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARK-AGLDPTSFNKSKRF   44 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~-~Gv~~~ti~~~~~~   44 (223)
                      |--.+|.+.|..-+++++++|+.+|++ +|.++++++.+-+.
T Consensus         4 ldT~~ia~~Ik~~L~~~~I~Q~~fa~~vlg~SQ~tLS~lL~~   45 (164)
T 2d5v_A            4 INTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRN   45 (164)
T ss_dssp             CCHHHHHHHHHHHHHHTTCCHHHHHHHHTSCCHHHHHHHHHS
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHCC
T ss_conf             179999999999998879978999999845788899998718


No 186
>2fd5_A Transcriptional regulator; DNA-binding protein, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1
Probab=87.18  E-value=0.73  Score=24.25  Aligned_cols=39  Identities=15%  Similarity=0.123  Sum_probs=32.1

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|.++-..+..++|+   |-.++|+++|++.+++.++.
T Consensus         7 ~~R~~il~aa~~l~~~~G~~~~si~~Ia~~agvs~~~~Y~~F   48 (180)
T 2fd5_A            7 QTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHF   48 (180)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSCCHHHHHHHTTCCGGGGGGTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHC
T ss_conf             999999999999998709440679999998688976176765


No 187
>2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. RHA1, structural genomics, PSI-2; 1.50A {Rhodococcus SP}
Probab=87.18  E-value=0.9  Score=23.65  Aligned_cols=38  Identities=13%  Similarity=0.146  Sum_probs=29.8

Q ss_pred             CHHHHHHHHHHHHHHC---CCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             5899999999999964---9998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERH---NLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~---gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--++..++   |+|-.++|+++||+++|+.++.
T Consensus        15 rr~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~Y~~F   55 (204)
T 2ibd_A           15 RRTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHF   55 (204)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHTTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHC
T ss_conf             99999999999999749240779999998688926599982


No 188
>2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1
Probab=87.12  E-value=0.82  Score=23.91  Aligned_cols=39  Identities=10%  Similarity=0.176  Sum_probs=31.9

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -++++|.++-.++..+.|   +|-.++|+++|++.+++.++.
T Consensus         8 ~~r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~Y~~F   49 (194)
T 2g7s_A            8 SKADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIHHHF   49 (194)
T ss_dssp             HHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHCCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHCCC
T ss_conf             999999999999999749574779999998782921331158


No 189
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ...
Probab=87.11  E-value=1  Score=23.31  Aligned_cols=42  Identities=10%  Similarity=0.105  Sum_probs=34.9

Q ss_pred             CCCCC--HHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             97755--8999999999999649-998899998289987988997
Q gi|254780444|r    1 MTSFS--HKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~--~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.||  -|+-+++|-.|.++.+ .+.+++|+.+|++++|++..-
T Consensus         1 m~~l~~~~E~YL~~Iy~L~e~~~~v~~~~iA~~L~vs~~svt~~l   45 (226)
T 2qq9_A            1 MKDLVATTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTV   45 (226)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHTCCCBHHHHHHHHTCCHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             986761399999999999964996519999999689917999999


No 190
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ...
Probab=87.09  E-value=0.98  Score=23.41  Aligned_cols=47  Identities=9%  Similarity=0.049  Sum_probs=30.5

Q ss_pred             CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             9889999828998798899751578875577989999987321875210
Q gi|254780444|r   23 TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus        23 s~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~   71 (223)
                      |-.++|+++|||.+|+|+.-++...  -+.-..+.+.++++-+|-.++.
T Consensus         2 Ti~DIA~~aGVS~~TVSraLn~~~~--vs~~tr~rV~~~a~elgY~pn~   48 (340)
T 1qpz_A            2 TIKDVAKRANVSTTTVSHVINKTRF--VAEETRNAVWAAIKELHYSPSA   48 (340)
T ss_dssp             CHHHHHHHHTSCHHHHHHHHHTCSC--CCHHHHHHHHHHHHHHTCCCCH
T ss_pred             CHHHHHHHHCCCHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHCCCCCH
T ss_conf             6899999989699999999679799--9999999999999995898898


No 191
>2id6_A Transcriptional regulator, TETR family; 1.75A {Thermotoga maritima} SCOP: a.4.1.9 a.121.1.1 PDB: 3ih2_A 3ih3_A 3ih4_A 1zkg_A* 2iek_A* 1z77_A*
Probab=86.82  E-value=0.97  Score=23.44  Aligned_cols=38  Identities=18%  Similarity=0.170  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             8999999999999649---9988999982899879889975
Q gi|254780444|r    6 HKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      +++|.++--+|..+.|   +|-.++|+.+|++++|+.++..
T Consensus         7 R~~Il~aA~~l~~~~G~~~~s~~~Ia~~agvs~~t~Y~~F~   47 (202)
T 2id6_A            7 RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFK   47 (202)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHTCCTHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHCCC
T ss_conf             99999999999987290416499999987909999984089


No 192
>2gfn_A HTH-type transcriptional regulator PKSA related protein; transcriptional regulator TETR, PSI-2, regulatory protein, structural genomics; 1.90A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=86.73  E-value=0.87  Score=23.73  Aligned_cols=38  Identities=16%  Similarity=0.268  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             89999999999996499---988999982899879889975
Q gi|254780444|r    6 HKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .++|.++-..+..++|+   |-.++|+.+|++++++.++..
T Consensus        11 r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~Y~~F~   51 (209)
T 2gfn_A           11 RRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFG   51 (209)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCCHHHHHHHHSSCHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             99999999999997291307699999997909999974348


No 193
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structural genomics; 1.99A {Neisseria meningitidis MC58} PDB: 2p6s_A 2p6t_A
Probab=86.71  E-value=0.64  Score=24.61  Aligned_cols=40  Identities=20%  Similarity=0.339  Sum_probs=29.6

Q ss_pred             CCCCCHHHH-HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             977558999-9999999996499988999982899879889
Q gi|254780444|r    1 MTSFSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus         1 ~~~~~~~~i-~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      |..++=+++ .+-|+.|.+...+|.++||+++|++++++.+
T Consensus         3 m~~~~LD~~D~~Il~~L~~d~R~s~~eiA~~~gls~~tv~~   43 (162)
T 2p5v_A            3 MPQLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLR   43 (162)
T ss_dssp             --CCCCCHHHHHHHHHHHHCTTCCHHHHHHHHTSCHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             89898089999999999983799999999998929999999


No 194
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution; 1.70A {Pseudomonas fluorescens pf-5}
Probab=86.41  E-value=0.96  Score=23.46  Aligned_cols=32  Identities=28%  Similarity=0.485  Sum_probs=25.9

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             999999649998899998289987988997515
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      |....++.| +|+.+|+.+||.++.|++.-+-.
T Consensus         6 L~dyv~~~G-~Q~k~A~~lGV~Q~AIsKAlrag   37 (67)
T 2pij_A            6 LSKYLEEHG-TQSALAAALGVNQSAISQMVRAG   37 (67)
T ss_dssp             HHHHHHHTC-CHHHHHHHHTSCHHHHHHHHHTT
T ss_pred             HHHHHHHHC-CHHHHHHHHCCCHHHHHHHHHCC
T ss_conf             999999838-58899999197589999999759


No 195
>2hyj_A Putative TETR-family transcriptional regulator; HTH DNA binding motif, structural genomics, PSI-2, protein structure initiative; 2.19A {Streptomyces coelicolor A3} SCOP: a.4.1.9 a.121.1.1
Probab=86.40  E-value=0.59  Score=24.82  Aligned_cols=39  Identities=18%  Similarity=0.205  Sum_probs=32.1

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|.++--.|..+.|+   |-.++|+.+|++.+++.++.
T Consensus        12 ~tr~~Il~aA~~l~~~~G~~~~t~~~IA~~aGvs~~~ly~~F   53 (200)
T 2hyj_A           12 ATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHF   53 (200)
T ss_dssp             HHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999739151889999998781978895544


No 196
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, domain, PSI, MCSG, structural genomics; 1.40A {Staphylococcus epidermidis atcc 12228}
Probab=86.09  E-value=1  Score=23.33  Aligned_cols=38  Identities=24%  Similarity=0.219  Sum_probs=28.4

Q ss_pred             HHHHHHHH-HHHHHHCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             89999999-999996499988999982899879889975
Q gi|254780444|r    6 HKKIWEAI-DRMAERHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         6 ~~~i~~~i-~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ...|+..| +-..+-..+|..+||+++|||++||.|..+
T Consensus        19 e~~Ia~yil~~~~~i~~~si~elA~~~~VS~aTi~Rf~k   57 (107)
T 3iwf_A           19 EKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSK   57 (107)
T ss_dssp             HHHHHHHHHHCHHHHTTCCHHHHHHHHTSCHHHHHHHHH
T ss_pred             HHHHHHHHHHCHHHHHHCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999999599999776599999897989989999999


No 197
>2l1p_A DNA-binding protein SATB1; PSI-2, NESG, structural genomics, protein structure initiati northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A*
Probab=85.96  E-value=1.1  Score=23.13  Aligned_cols=44  Identities=16%  Similarity=0.228  Sum_probs=36.3

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCC
Q ss_conf             5589999999999996499988999982899879889975157887
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGR   49 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~   49 (223)
                      -+|..+.-|+..|+++.  +|+.||+..-++++.|+-..+..--++
T Consensus        17 W~h~tVrnAlk~LLkem--nQS~LakecpLsQSmiSsIVNstyyan   60 (83)
T 2l1p_A           17 WSHTTVRNALKDLLKDM--NQSSLAKECPLSQSMISSIVNSTYYAN   60 (83)
T ss_dssp             CCHHHHHHHHHHHHTTS--CHHHHHHHSSSCHHHHHHHHTCSSCCC
T ss_pred             CCHHHHHHHHHHHHHHH--HHHHHHHHCCCHHHHHHHHHCCCCEEE
T ss_conf             24789999999999996--188887708818999999984400020


No 198
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10
Probab=85.83  E-value=0.83  Score=23.88  Aligned_cols=29  Identities=21%  Similarity=0.373  Sum_probs=24.1

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             999999649998899998289987988997
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.|+ +.-+|.++||+.+|+|++|+++.-
T Consensus        26 l~~l~-~gpiSR~eLa~~tgLS~~Tvs~iv   54 (380)
T 2hoe_A           26 LKRIM-KSPVSRVELAEELGLTKTTVGEIA   54 (380)
T ss_dssp             HHHHH-HSCBCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHH-HCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99998-099599999988895999999999


No 199
>3geu_A Intercellular adhesion protein R; TETR family, intercellular adhesion regulator, IDP00851, DNA-binding, repressor, transcription; HET: MSE; 1.90A {Staphylococcus aureus}
Probab=85.83  E-value=0.61  Score=24.73  Aligned_cols=39  Identities=13%  Similarity=0.096  Sum_probs=31.4

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -++++|.++--+|..++|   +|-+++|+++|++++++.++.
T Consensus         3 a~R~~Il~aa~~l~~~~G~~~~si~~Ia~~agvs~~tiY~~F   44 (189)
T 3geu_A            3 AMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHF   44 (189)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHTTCCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             899999999999999759364869999998790998870008


No 200
>2eth_A Transcriptional regulator, putative, MAR family; TM0816, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.28
Probab=85.77  E-value=0.93  Score=23.56  Aligned_cols=32  Identities=9%  Similarity=-0.130  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+.+..++|+++||+.+|++++++++.
T Consensus        47 ~~vL~~l~~~~~~t~~eLa~~l~i~~~tvs~~   78 (154)
T 2eth_A           47 LYAFLYVALFGPKKMKEIAEFLSTTKSNVTNV   78 (154)
T ss_dssp             HHHHHHHHHHCCBCHHHHHHHTTSCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999869949999999989798899999


No 201
>3him_A Probable transcriptional regulator; TETR, bacterial, RHA1, PSI-2, MCSG, structural genomics, midwest center for structural genomics; 2.20A {Rhodococcus jostii}
Probab=85.69  E-value=0.31  Score=26.67  Aligned_cols=41  Identities=17%  Similarity=0.134  Sum_probs=34.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             775589999999999996499---98899998289987988997
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +..++.+|.++--+|..++|+   |-.++|+++|++++++.++.
T Consensus        14 ~~~~r~rIl~AA~~l~~~~G~~~~s~~~Ia~~agvs~~t~Y~~F   57 (211)
T 3him_A           14 TSKAAARIRAAAIEVFAAKGYGATTTREIAASLDMSPGAVYPHY   57 (211)
T ss_dssp             CCHHHHHHHHHHHHHHHHHCSTTCCHHHHHHHTTCCTTSSTTTC
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             67999999999999999859351779999999790897884434


No 202
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DNA-binding, plasmid, transcription regulation; 2.00A {Bacillus anthracis}
Probab=85.69  E-value=0.62  Score=24.71  Aligned_cols=39  Identities=8%  Similarity=0.181  Sum_probs=29.4

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+|+.=+.-+..|.+..+++.++||..+|++++++|+.-
T Consensus        24 L~~p~Rl~Il~~L~~~~~~~v~el~~~l~~s~stvS~HL   62 (99)
T 2zkz_A           24 MAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHL   62 (99)
T ss_dssp             HCSHHHHHHHHHHHHHSCEEHHHHHHHHTCCHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             489999999999977899279998998884976999999


No 203
>3cuo_A Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12}
Probab=85.66  E-value=0.25  Score=27.23  Aligned_cols=40  Identities=18%  Similarity=0.224  Sum_probs=29.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             7558999999999999649998899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+|+.=..-|..|+++.+++.++||+.+|++++++|+.-
T Consensus        20 aL~~p~Rl~Il~~L~~~~~~~v~eLa~~l~~s~stvS~HL   59 (99)
T 3cuo_A           20 AMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHL   59 (99)
T ss_dssp             HHCSHHHHHHHHHHTTCCSEEHHHHHHHHCCCHHHHHHHH
T ss_pred             HHCCHHHHHHHHHHHCCCCEEHHHHHHHHCCCHHHHHHHH
T ss_conf             8579999999999858999079997745585987999999


No 204
>3kkd_A Transcriptional regulator; TETR, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: PGE 15P; 2.10A {Pseudomonas aeruginosa PAO1}
Probab=85.25  E-value=0.86  Score=23.77  Aligned_cols=40  Identities=15%  Similarity=0.135  Sum_probs=32.7

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHH
Q ss_conf             5589999999999996499---988999982899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .++++|.++--+|..++|+   |-.++|+++|++.+++..+..
T Consensus        35 ~~R~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~tiY~yF~   77 (237)
T 3kkd_A           35 QRRQAILDAAMRLIVRDGVRAVRHRAVAAEAQVPLSATTYYFK   77 (237)
T ss_dssp             CHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCTTTC-----
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCC
T ss_conf             9999999999999998492407799999998868577988769


No 205
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP}
Probab=84.99  E-value=1  Score=23.35  Aligned_cols=37  Identities=14%  Similarity=0.383  Sum_probs=29.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|..+ |..|..|....++|+++||+.+|++++++++.
T Consensus        38 lt~~q-~~vL~~L~~~~~~t~~~la~~l~i~~~~vsr~   74 (148)
T 3nrv_A           38 IGMTE-WRIISVLSSASDCSVQKISDILGLDKAAVSRT   74 (148)
T ss_dssp             CCHHH-HHHHHHHHHSSSBCHHHHHHHHTCCHHHHHHH
T ss_pred             CCHHH-HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             89999-99999999779979999999989699899999


No 206
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus}
Probab=84.98  E-value=1.3  Score=22.65  Aligned_cols=37  Identities=19%  Similarity=0.213  Sum_probs=28.3

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|..+ +..|..+...-|+|+++||+++|++++++++.
T Consensus        40 lt~~q-~~vL~~l~~~~~~t~~~La~~l~~~~~~vs~~   76 (150)
T 2rdp_A           40 ITPPQ-FVALQWLLEEGDLTVGELSNKMYLACSTTTDL   76 (150)
T ss_dssp             SCHHH-HHHHHHHHHHCSBCHHHHHHHHTCCHHHHHHH
T ss_pred             CCHHH-HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             79999-99999999779959999999989688789999


No 207
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens}
Probab=84.97  E-value=1.7  Score=21.81  Aligned_cols=44  Identities=23%  Similarity=0.274  Sum_probs=32.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             97755899999999999964999---889999828998798899751
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ||++|.+++..=-....+..-.+   ..+||+.+|+++..|.-|..+
T Consensus         1 ~T~FT~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqN   47 (56)
T 3a03_A            1 MTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQN   47 (56)
T ss_dssp             ---CCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99889999999999997079969999999999866986786796477


No 208
>2csf_A DNA-binding protein SATB2; CUT domain, special AT-rich sequence-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=84.94  E-value=1.6  Score=21.98  Aligned_cols=65  Identities=14%  Similarity=0.076  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHH-HCCCHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHCCCCCC
Q ss_conf             8999999999999649998899998-2899879889975157887557-798999998732187521
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARK-AGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAATNETIC   70 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~-~Gv~~~ti~~~~~~~~~g~~r~-p~~~~l~kia~~~~v~~~   70 (223)
                      -.+|...|...+++++++|+-||+. ++.+|.|++..-|...+.+|-. -..+++.++-+.++.+..
T Consensus        19 T~~ia~~i~~eL~~~~I~Q~~FAk~VL~rSQGtLSdLLr~~~~PkPw~ksgre~~~rm~~wL~lPe~   85 (101)
T 2csf_A           19 TAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFLNLPQH   85 (101)
T ss_dssp             CTHHHHHHHHHHHHHTCCHHHHHHHHTCCCHHHHHHHHHHCCCCCTTCHHHHHHHHHHHHHHTSCHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCHHH
T ss_conf             9999999999999848659999999980171179999846479997540257899999999818298


No 209
>2cyy_A Putative HTH-type transcriptional regulator PH1519; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2
Probab=84.75  E-value=0.83  Score=23.86  Aligned_cols=31  Identities=10%  Similarity=0.201  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             9999999996499988999982899879889
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      .+-|+.|.+....|.++||+++|+|++++.+
T Consensus        10 ~~IL~~L~~d~R~s~~~iA~~lglS~~tv~~   40 (151)
T 2cyy_A           10 KKIIKILQNDGKAPLREISKITGLAESTIHE   40 (151)
T ss_dssp             HHHHHHHHHCTTCCHHHHHHHHCSCHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             9999999984899999999998919999999


No 210
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bonds; 2.05A {Sulfolobus tokodaii str} SCOP: a.4.5.50
Probab=84.66  E-value=0.86  Score=23.78  Aligned_cols=32  Identities=25%  Similarity=0.245  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999649-99889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|.++.| +|+++||+.+|++++|+++.
T Consensus        24 ~~iL~~L~~~~~~~t~~eia~~~~~~~~tvs~~   56 (109)
T 2d1h_A           24 VAVLLKMVEIEKPITSEELADIFKLSKTTVENS   56 (109)
T ss_dssp             HHHHHHHHHHCSCEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999997598989999999989788589999


No 211
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, PSI; 1.90A {Porphyromonas gingivalis W83} SCOP: a.4.5.4 b.82.3.2
Probab=84.16  E-value=2.1  Score=21.31  Aligned_cols=59  Identities=12%  Similarity=0.063  Sum_probs=34.0

Q ss_pred             HHHHHHHHHHHHHHC-----------CCCHHHHHHHHCCCHHHHHHHH----HCC----CCCCCCCCCHHHHHHHHHH
Q ss_conf             899999999999964-----------9998899998289987988997----515----7887557798999998732
Q gi|254780444|r    6 HKKIWEAIDRMAERH-----------NLTPSGLARKAGLDPTSFNKSK----RFG----IEGRNRWPSTESIFKILAA   64 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~-----------gls~~~lA~~~Gv~~~ti~~~~----~~~----~~g~~r~p~~~~l~kia~~   64 (223)
                      .++|...|-.|.++.           -+|+.+||..+|+++.|+++..    +.+    ..++-+-...+.|.++|+.
T Consensus       154 ~~Rl~~~L~~l~~~~~~~~~~~~~~~~~t~~~lA~~~G~sr~tvsr~l~~l~~~g~I~~~~~~i~I~d~~~L~~~a~~  231 (232)
T 2gau_A          154 RGRLAETLLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKIIDCDRLQKTARS  231 (232)
T ss_dssp             HHHHHHHHHHHHHHHCBCTTSSBBSCCCCHHHHHHHTTSCHHHHHHHHHHHHHTTSEEEETTEEEESCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCEEEECCHHHHHHHHHC
T ss_conf             999999999999982888778764345059999988798999999999999988979970999998689999999856


No 212
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis 89}
Probab=84.09  E-value=1.2  Score=22.77  Aligned_cols=32  Identities=9%  Similarity=0.270  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|.+..|+|+++||+.++++++++++.
T Consensus        34 ~~vL~~l~~~~~~t~~~la~~l~i~~~tvs~~   65 (142)
T 3bdd_A           34 YSILQTLLKDAPLHQLALQERLQIDRAAVTRH   65 (142)
T ss_dssp             HHHHHHHHHHCSBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998779989999999989698689999


No 213
>3hef_A Gene 1 protein; bacteriophage SF6, terminase small subunit GP1, GP1 octameric assembly, GP1 channel, DNA recognition, DNA packaging; 1.65A {Enterobacteria phage SF6}
Probab=84.09  E-value=1.3  Score=22.53  Aligned_cols=40  Identities=5%  Similarity=0.057  Sum_probs=28.9

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCC-CHHHHHHHHHC
Q ss_conf             7558999999999999649998899998289-98798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGL-DPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv-~~~ti~~~~~~   44 (223)
                      .+|.+.+-..+++|  ..|.|..++|+..|| +.+|+.+|.+.
T Consensus        15 k~t~e~~e~I~~~l--~~G~sl~~i~~~~gvps~sT~~~Wl~~   55 (143)
T 3hef_A           15 DYMPEVADDICSLL--SSGESLLKVCKRPGMPDKSTVFRWLAK   55 (143)
T ss_dssp             SCCHHHHHHHHHHH--HTTCCHHHHHTSTTCCCHHHHHHHTTT
T ss_pred             CCCHHHHHHHHHHH--HCCCCHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             57999999999999--889859999870799968999999971


No 214
>3on2_A Probable transcriptional regulator; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; HET: MSE PG6; 1.96A {Rhodococcus jostii}
Probab=84.09  E-value=0.67  Score=24.47  Aligned_cols=38  Identities=21%  Similarity=0.274  Sum_probs=31.7

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..|..++|   +|-+++|+++|+|..++.++.
T Consensus        13 ~R~~Il~aa~~l~~~~G~~~~t~~~IA~~agvs~~tiY~~F   53 (199)
T 3on2_A           13 LRRVLLARAESTLEKDGVDGLSLRQLAREAGVSHAAPSKHF   53 (199)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHTC-----CCCSS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999759161659999999790986786766


No 215
>3cjn_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3}
Probab=84.01  E-value=0.83  Score=23.87  Aligned_cols=32  Identities=13%  Similarity=0.231  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+..+.|+|+++||+++|++++++++.
T Consensus        55 ~~iL~~l~~~~~~t~~~La~~~~~~~~~vsr~   86 (162)
T 3cjn_A           55 MRALAILSAKDGLPIGTLGIFAVVEQSTLSRA   86 (162)
T ss_dssp             HHHHHHHHHSCSEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998479989999999989798899999


No 216
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032}
Probab=83.64  E-value=0.18  Score=28.24  Aligned_cols=51  Identities=16%  Similarity=0.121  Sum_probs=32.5

Q ss_pred             HHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             99649998899998289987988997515788755779899999873218752
Q gi|254780444|r   17 AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI   69 (223)
Q Consensus        17 ~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~   69 (223)
                      .++...|..++|+++|||.+|+|+.-++..  +-+....+.+.++++-+|-.+
T Consensus         4 ~~k~r~Ti~dIA~~aGVS~~TVSr~Ln~~~--~Vs~~tr~rV~~~a~~lgY~p   54 (348)
T 3bil_A            4 TEKFRPTLKDVARQAGVSIATASRALADNP--AVAASTRERIQQLASDLGYRA   54 (348)
T ss_dssp             -----------------------------------------------------
T ss_pred             CCCCCCCHHHHHHHHCCCHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHCCCC
T ss_conf             789997399999998869999999968989--999999999999999958987


No 217
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28
Probab=83.60  E-value=1.5  Score=22.25  Aligned_cols=32  Identities=16%  Similarity=0.225  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999649-99889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHN-LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+.+..| +|+++||+.+|++++++++.
T Consensus        38 ~~vL~~i~~~~g~~t~~ela~~~~~~~~tvs~~   70 (147)
T 2hr3_A           38 LVVLGAIDRLGGDVTPSELAAAERMRSSNLAAL   70 (147)
T ss_dssp             HHHHHHHHHTTSCBCHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999997699989999999989798799999


No 218
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus}
Probab=83.04  E-value=1.8  Score=21.69  Aligned_cols=31  Identities=13%  Similarity=0.180  Sum_probs=27.5

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +.|..++++.+.+.++.|+.+|++.+|+.+.
T Consensus        22 ~~I~~aL~~~~gn~s~aA~~Lgi~r~tL~~k   52 (63)
T 3e7l_A           22 IFIEEKLREYDYDLKRTAEEIGIDLSNLYRK   52 (63)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999991998999999989799999999


No 219
>2qco_A CMER; transcriptional regulator protein; 2.25A {Campylobacter jejuni} PDB: 3hgg_A* 3hgy_A*
Probab=82.65  E-value=0.43  Score=25.76  Aligned_cols=38  Identities=11%  Similarity=0.042  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--+|..++|+   |-.++|+++|++.+|+.++.
T Consensus        14 ~re~Il~aA~~lf~~~G~~~~t~~~IA~~agvs~~tiY~yF   54 (210)
T 2qco_A           14 RQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGF   54 (210)
T ss_dssp             HHHHHHHHHHHHHHHTTTTTCCHHHHHHHHCTTCTTCSSST
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999749152879999998687840688868


No 220
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa}
Probab=82.64  E-value=1.6  Score=21.95  Aligned_cols=32  Identities=22%  Similarity=0.435  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+..+-|.|+++||+.++++++++++.
T Consensus        41 ~~vL~~l~~~~~~t~~eLa~~~~~~~~~vs~~   72 (140)
T 2nnn_A           41 WAALVRLGETGPCPQNQLGRLTAMDAATIKGV   72 (140)
T ss_dssp             HHHHHHHHHHSSBCHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCHHHH
T ss_conf             99999999879909999999878573529999


No 221
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus}
Probab=82.38  E-value=1.8  Score=21.71  Aligned_cols=30  Identities=17%  Similarity=0.420  Sum_probs=24.2

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             9999996499988999982899879889975
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |-+|+.+ |.|+.++|..+|+|.+||++-.|
T Consensus        68 Va~lL~~-g~syreIa~~tgvS~aTIsRV~r   97 (119)
T 3kor_A           68 VAKMIKQ-GYTYATIEQESGASTATISRVKR   97 (119)
T ss_dssp             HHHHHHH-TCCHHHHHHHHCCCHHHHHHHHH
T ss_pred             HHHHHHC-CCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999885-99999999996987454799999


No 222
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP}
Probab=82.31  E-value=1.2  Score=22.74  Aligned_cols=32  Identities=31%  Similarity=0.457  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|...-|+|+++||+.++++++++++.
T Consensus        49 ~~vL~~l~~~~~~t~~~La~~l~~~~~~vs~~   80 (162)
T 3k0l_A           49 FTALSVLAAKPNLSNAKLAERSFIKPQSANKI   80 (162)
T ss_dssp             HHHHHHHHHCTTCCHHHHHHHHTSCGGGHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999779989999999989688699999


No 223
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile}
Probab=82.03  E-value=1.7  Score=21.83  Aligned_cols=32  Identities=22%  Similarity=0.314  Sum_probs=25.1

Q ss_pred             HHHHHHHHH--HCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999--64999889999828998798899
Q gi|254780444|r   10 WEAIDRMAE--RHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~--~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+..  +.++|+++||+++|++++++++.
T Consensus        44 ~~vL~~l~~~~~~~~t~~eLa~~l~i~~stvs~~   77 (189)
T 3nqo_A           44 YMTILSILHLPEEETTLNNIARKMGTSKQNINRL   77 (189)
T ss_dssp             HHHHHHHHHSCGGGCCHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999847899909999999989688699999


No 224
>2dbb_A Putative HTH-type transcriptional regulator PH0061; ASNC family, helix-turn-helix (HTH) domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3}
Probab=81.82  E-value=1.3  Score=22.64  Aligned_cols=30  Identities=17%  Similarity=0.182  Sum_probs=25.8

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      +-|+.|.+...+|.++||+++|++++|+.+
T Consensus        13 ~Il~~L~~d~R~s~~eia~~lgls~~tv~~   42 (151)
T 2dbb_A           13 QLVKILSENSRLTYRELADILNTTRQRIAR   42 (151)
T ss_dssp             HHHHHHHHCTTCCHHHHHHHTTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999885999999999998969999999


No 225
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12
Probab=81.65  E-value=1.4  Score=22.34  Aligned_cols=30  Identities=13%  Similarity=0.250  Sum_probs=24.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +.|...+++.| +.++.|+.+|++.+|+.+-
T Consensus        24 ~~I~~aL~~~g-~~~~aA~~Lgisr~tL~rK   53 (61)
T 1g2h_A           24 QVLKLFYAEYP-STRKLAQRLGVSHTAIANK   53 (61)
T ss_dssp             HHHHHHHHHSC-SHHHHHHHTTSCTHHHHHH
T ss_pred             HHHHHHHHHCC-CHHHHHHHHCCCHHHHHHH
T ss_conf             99999999968-9999999979789999999


No 226
>1wiz_A DNA-binding protein SATB2; helix bundle, KIAA1034 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=81.63  E-value=2.6  Score=20.68  Aligned_cols=59  Identities=10%  Similarity=0.115  Sum_probs=42.1

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHH-HCCCHHHHHHHHHCCCCCCCCCCCH----HHHHHHHHHCCCC
Q ss_conf             999999999999649998899998-2899879889975157887557798----9999987321875
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARK-AGLDPTSFNKSKRFGIEGRNRWPST----ESIFKILAATNET   68 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~-~Gv~~~ti~~~~~~~~~g~~r~p~~----~~l~kia~~~~v~   68 (223)
                      .+|...|...+++++++|.-||+. +|.+|.+++...+   ..|+-|...    +...++-+-++.+
T Consensus        20 ~eI~~~v~~eL~~~~IsQ~~Fa~~vL~rSQGtlSdLL~---~PK~pw~~~~~gre~y~RM~~wL~~p   83 (101)
T 1wiz_A           20 PDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILR---KEEDPRTASQSLLVNLRAMQNFLNLP   83 (101)
T ss_dssp             TTHHHHHHHHHHHHTCCHHHHHHHHHSCCHHHHHHHHH---TCCCTTTCCHHHHHHHHHHHHHTTSC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHH---CCCCHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             99999999999995987999999997538288999995---79982555135679999999998383


No 227
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A 3mex_A
Probab=81.61  E-value=1.4  Score=22.49  Aligned_cols=30  Identities=17%  Similarity=0.276  Sum_probs=25.0

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999964999889999828998798899
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|..+.+..|+|+++||+.+|++++++++.
T Consensus        42 iL~~l~~~~~~t~~~La~~l~i~~~~vsr~   71 (142)
T 3ech_A           42 VLKLIDEQRGLNLQDLGRQMCRDKALITRK   71 (142)
T ss_dssp             HHHHHHHTTTCCHHHHHHHHC---CHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999779989999999989698799999


No 228
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR), structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str}
Probab=81.61  E-value=1.2  Score=22.88  Aligned_cols=32  Identities=9%  Similarity=0.140  Sum_probs=26.3

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|...-|+|+++||+++|++++++++.
T Consensus        44 ~~vL~~L~~~~~~t~~~La~~l~~~~~tvs~~   75 (154)
T 2qww_A           44 LAMINVIYSTPGISVADLTKRLIITGSSAAAN   75 (154)
T ss_dssp             HHHHHHHHHSTTEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999779989999999979787579999


No 229
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12
Probab=81.59  E-value=1.4  Score=22.47  Aligned_cols=29  Identities=10%  Similarity=0.095  Sum_probs=26.6

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             99999996499988999982899879889
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      .|.+.+++.+.++++.|+.+|++.+|+.+
T Consensus        55 lI~~aL~~~~Gn~~~AA~~LGI~R~TL~~   83 (91)
T 1ntc_A           55 LLTTALRHTQGHKQEAARLLGWGAATLTA   83 (91)
T ss_dssp             HHHHHHHHTTTCTTHHHHHTTCCHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHCCCHHHHHH
T ss_conf             99999999689599999997989999999


No 230
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua}
Probab=81.58  E-value=1.3  Score=22.51  Aligned_cols=32  Identities=13%  Similarity=0.343  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+...-|+|+++||+.+|++++++++.
T Consensus        40 ~~iL~~l~~~~~~t~~~La~~l~i~~~~vs~~   71 (143)
T 3oop_A           40 WSVLEGIEANEPISQKEIALWTKKDTPTVNRI   71 (143)
T ss_dssp             HHHHHHHHHHSSEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998689979999999989699799999


No 231
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A
Probab=81.44  E-value=1.2  Score=22.84  Aligned_cols=32  Identities=13%  Similarity=0.136  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..|.++.|+|+++||+.+|++++++++.
T Consensus        50 ~~vL~~l~~~~~~~~~eLa~~l~~~~~tvs~~   81 (153)
T 2pex_A           50 YLVMLVLWETDERSVSEIGERLYLDSATLTPL   81 (153)
T ss_dssp             HHHHHHHHHSCSEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998479989999999989688689999


No 232
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20
Probab=81.41  E-value=1.9  Score=21.50  Aligned_cols=40  Identities=10%  Similarity=-0.037  Sum_probs=29.0

Q ss_pred             HHHHHHHH-HHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             89999999-99999649998899998289987988997515
Q gi|254780444|r    6 HKKIWEAI-DRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         6 ~~~i~~~i-~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      ..+|...| +..-+-..+|..+||+++|+|++||.|..+.-
T Consensus        23 E~~Ia~yil~n~~~v~~~si~elA~~~~vS~aTI~Rf~kkl   63 (111)
T 2o3f_A           23 ERKLADYILAHPHXAIESTVNEISALANSSDAAVIRLCXSL   63 (111)
T ss_dssp             HHHHHHHHHHCHHHHHTCCHHHHHHHTTCCHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCHHHHHHCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999999959247643789999989798987999999992


No 233
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2
Probab=81.36  E-value=1.4  Score=22.43  Aligned_cols=30  Identities=13%  Similarity=0.308  Sum_probs=25.6

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      +-|+.|.+..-.|.++||+.+|++++|+.+
T Consensus        12 ~Il~~L~~d~R~s~~~ia~~lg~s~~tv~~   41 (152)
T 2cg4_A           12 GILEALMGNARTAYAELAKQFGVSPETIHV   41 (152)
T ss_dssp             HHHHHHHHCTTSCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999984899999999998919999999


No 234
>3nrg_A TETR family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.56A {Chloroflexus aurantiacus}
Probab=81.28  E-value=0.89  Score=23.67  Aligned_cols=38  Identities=11%  Similarity=0.226  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++-..|..++|+   |-.++|+++|++.+|+.++.
T Consensus        14 rR~~Il~aA~~l~~~~G~~~~t~~~IA~~agvs~~tiY~~F   54 (217)
T 3nrg_A           14 KRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYF   54 (217)
T ss_dssp             HHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTCCTTGGGGTC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999739240779999998588823588864


No 235
>1z91_A Organic hydroperoxide resistance transcriptional regulator; OHRR, MARR family, bacterial transcription factor, DNA binding protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A*
Probab=81.28  E-value=1.1  Score=23.09  Aligned_cols=32  Identities=19%  Similarity=0.193  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+..+.|+|+++||+.+|++++++++.
T Consensus        43 ~~vL~~l~~~~~~t~~eLa~~~~i~~~tit~~   74 (147)
T 1z91_A           43 YLALLLLWEHETLTVKKMGEQLYLDSGTLTPM   74 (147)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHTTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999779949999999979788789999


No 236
>2hku_A A putative transcriptional regulator; structural genomics, APC6040, TETR family, rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1
Probab=81.28  E-value=2.7  Score=20.60  Aligned_cols=39  Identities=13%  Similarity=0.220  Sum_probs=29.1

Q ss_pred             CCHHHHHHHHHHHHHHCC--CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649--998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN--LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g--ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|+++|.++=-+|..++|  .|-.++|+++||++.+|.++.
T Consensus        20 ~~r~~Il~aA~~lf~e~G~~~si~~IA~~aGvs~~tiY~hF   60 (215)
T 2hku_A           20 QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYY   60 (215)
T ss_dssp             CHHHHHHHHHHHHHHHHCTTSCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHC
T ss_conf             99999999999999986847829999998550633488856


No 237
>2iai_A Putative transcriptional regulator SCO3833; structural genomics, TETR, unknown function, PSI-2, protein structure initiative; 1.65A {Streptomyces coelicolor}
Probab=81.12  E-value=0.62  Score=24.71  Aligned_cols=39  Identities=10%  Similarity=0.196  Sum_probs=29.1

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|.++|.++=-.|..++|   .|-.++|+++||+++++.++.
T Consensus        30 ~tr~~Il~aA~~lf~~~G~~~~si~~IA~~Agvs~~tiY~yF   71 (230)
T 2iai_A           30 YTPETLLSVAVQVFIERGYDGTSMEHLSKAAGISKSSIYHHV   71 (230)
T ss_dssp             -CCSCHHHHHHHHHHHHCTTTCCHHHHHHHHTSCHHHHTTTC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHCCC
T ss_conf             999999999999999859262729999998582910153058


No 238
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ...
Probab=81.06  E-value=1.9  Score=21.53  Aligned_cols=29  Identities=14%  Similarity=0.140  Sum_probs=26.0

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             99999996499988999982899879889
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      .|...+++.+.++++.|+.+|++.+|+.+
T Consensus        62 ~I~~aL~~~~gn~~~aA~~LGisR~tL~~   90 (98)
T 1eto_A           62 LLDMVMQYTLGNQTRAALMMGINRGTLRK   90 (98)
T ss_dssp             HHHHHHHHTTTCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHCCCHHHHHH
T ss_conf             99999999199889999997989999999


No 239
>2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexibility; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B
Probab=81.05  E-value=1.4  Score=22.33  Aligned_cols=30  Identities=23%  Similarity=0.357  Sum_probs=24.4

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             99999964999889999828998798899751
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      |....++.|  |+..|+.+||.++.|++.-+-
T Consensus         7 L~dyv~~~G--Q~k~A~~lGV~q~AIsKAlra   36 (66)
T 2ovg_A            7 LKDYAMRFG--QTKTAKDLGVYPSSINQAIHA   36 (66)
T ss_dssp             HHHHHHHHC--HHHHHHHHTSCHHHHHHHHHH
T ss_pred             HHHHHHHHC--HHHHHHHCCCCHHHHHHHHHC
T ss_conf             999999978--599999909768999999975


No 240
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli}
Probab=81.01  E-value=2.7  Score=20.54  Aligned_cols=35  Identities=14%  Similarity=0.187  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHCCC-CHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999999996499-9889999828998798899
Q gi|254780444|r    7 KKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gl-s~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+.+++|..|.++.|- +.++||+.+|++++|++..
T Consensus        39 EdYLe~Iy~L~~~~~~vr~~dIA~~L~vs~~sVs~~   74 (155)
T 2h09_A           39 DDYVELISDLIREVGEARQVDMAARLGVSQPTVAKM   74 (155)
T ss_dssp             HHHHHHHHHHHHHHSCCCHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999999985389770999999969897899999


No 241
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2
Probab=80.94  E-value=1.5  Score=22.21  Aligned_cols=30  Identities=27%  Similarity=0.427  Sum_probs=25.1

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999964999889999828998798899
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      -|..|.+...+|.++||+++|++++++.+-
T Consensus        10 Il~~L~~n~R~s~~eiA~~~g~s~~tv~~R   39 (144)
T 2cfx_A           10 IIEELKKDSRLSMRELGRKIKLSPPSVTER   39 (144)
T ss_dssp             HHHHHHHCSCCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999838999999999989298999999


No 242
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structural genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B}
Probab=80.84  E-value=1.9  Score=21.49  Aligned_cols=31  Identities=13%  Similarity=0.115  Sum_probs=26.3

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..+..+.++|+++||+.+|++++++++.
T Consensus        35 ~iL~~l~~~~~~t~~~la~~l~~~~~~vs~~   65 (145)
T 3g3z_A           35 AVLYTLATEGSRTQKHIGEKWSLPKQTVSGV   65 (145)
T ss_dssp             HHHHHHHHHCSBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999879949999999989698899999


No 243
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, protein structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A
Probab=80.76  E-value=2.1  Score=21.31  Aligned_cols=30  Identities=17%  Similarity=0.329  Sum_probs=23.9

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             9999996499988999982899879889975
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      |-+|+.+ |.|+.++|..+|+|.+||++--|
T Consensus        51 va~lL~~-g~syreIa~~~gvS~aTIsRv~r   80 (107)
T 3frw_A           51 VAKMLTD-KRTYLDISEKTGASTATISRVNR   80 (107)
T ss_dssp             HHHHHHT-TCCHHHHHHHHCCCHHHHHHHHH
T ss_pred             HHHHHHC-CCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999886-99999999996987475899999


No 244
>1u2w_A CADC repressor, cadmium efflux system accessory protein; zinc, LEAD, SOFT metal ION resistance, ARSR/SMTB family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A
Probab=80.67  E-value=0.98  Score=23.42  Aligned_cols=39  Identities=8%  Similarity=0.081  Sum_probs=29.0

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++.=..-|..|.+...++.++||..+|++++++|+.-
T Consensus        39 Ladp~Rl~Il~~L~~~~~~~v~ela~~l~~s~s~vS~HL   77 (122)
T 1u2w_A           39 IADENRAKITYALCQDEELCVCDIANILGVTIANASHHL   77 (122)
T ss_dssp             HHSHHHHHHHHHHHHSSCEEHHHHHHHHTCCHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             589999999999987889279999999888732699999


No 245
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi}
Probab=80.63  E-value=0.27  Score=27.08  Aligned_cols=49  Identities=16%  Similarity=0.209  Sum_probs=31.3

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             964999889999828998798899751578875577989999987321875
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET   68 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~   68 (223)
                      .++..|-.++|+++|||.+|+|+.-++.+  +-+.-..+.+.++++-+|--
T Consensus         9 ~~k~vTikdIA~~aGVS~~TVSr~Ln~~~--~Vs~~Tr~rV~~~a~elgY~   57 (355)
T 3e3m_A            9 GHRPVTMRDVAKAAGVSRMTVSRALKKDS--PISSETRERILKVVKDMNYV   57 (355)
T ss_dssp             ---------------------------------------------------
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHCCC
T ss_conf             99997699999998859999999968989--99999999999999995997


No 246
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28
Probab=80.60  E-value=2  Score=21.34  Aligned_cols=31  Identities=10%  Similarity=0.168  Sum_probs=25.1

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..+....++|+++||+.+|++++++++.
T Consensus        37 ~vL~~i~~~~~~t~~ela~~~~~~~~~vs~~   67 (145)
T 2a61_A           37 DILQKIYFEGPKRPGELSVLLGVAKSTVTGL   67 (145)
T ss_dssp             HHHHHHHHHCCBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999998779989999999989798789999


No 247
>3eup_A Transcriptional regulator, TETR family; structural genomics, PSI2, MCSG, protein structure initiative; 1.99A {Cytophaga hutchinsonii atcc 33406}
Probab=80.54  E-value=0.76  Score=24.14  Aligned_cols=39  Identities=13%  Similarity=0.063  Sum_probs=31.0

Q ss_pred             CCHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649---998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+++|.++--++..+.|   +|-.++|+++|++++++.++.
T Consensus        11 ~~R~~Il~aa~~lf~~~G~~~~t~~~Ia~~agvs~~~iY~~F   52 (204)
T 3eup_A           11 RTRQFIIESTAPVFNVKGLAGTSLTDLTEATNLTKGSIYGNF   52 (204)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHTCCHHHHTTTS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999999739462889999999790999997764


No 248
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01}
Probab=80.46  E-value=2.6  Score=20.68  Aligned_cols=38  Identities=16%  Similarity=0.219  Sum_probs=29.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             97755899999999999964999889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |++++-+++...+ ++++. | |-+.-|+.++++++++++.
T Consensus         1 m~~~~l~~L~~f~-~~~~~-~-s~s~AA~~L~isq~avS~~   38 (306)
T 3fzv_A            1 MASYTLRQLKYFV-TTVEC-G-SVAEASRKLYIAQPSISTA   38 (306)
T ss_dssp             ---CCHHHHHHHH-HHHHS-S-SHHHHHHHHTCCC-CHHHH
T ss_pred             CCCCCHHHHHHHH-HHHHC-C-CHHHHHHHHCCCHHHHHHH
T ss_conf             9989999999999-99982-9-9999999988888999999


No 249
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genomics, transcription; 2.05A {Pyrococcus horikoshii OT3} SCOP: a.4.5.28
Probab=80.41  E-value=1.3  Score=22.71  Aligned_cols=32  Identities=13%  Similarity=0.155  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|...-++|.++||+.+|++++++++.
T Consensus        19 ~~IL~~L~~~~~~t~~eLa~~l~is~~~vs~~   50 (100)
T 1ub9_A           19 LGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSH   50 (100)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999985189983999999989199899999


No 250
>2e1c_A Putative HTH-type transcriptional regulator PH1519; DNA-binding; HET: DNA; 2.10A {Pyrococcus horikoshii OT3} SCOP: a.4.5.32 d.58.4.2 PDB: 1ri7_A* 2zny_A* 2znz_A*
Probab=80.23  E-value=1.6  Score=22.07  Aligned_cols=30  Identities=10%  Similarity=0.246  Sum_probs=25.9

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      +-|+.|.+..-+|.++||+++|++++++.+
T Consensus        31 ~IL~~L~~d~R~s~~~iA~~lglS~~tV~~   60 (171)
T 2e1c_A           31 KIIKILQNDGKAPLREISKITGLAESTIHE   60 (171)
T ss_dssp             HHHHHHHHCTTCCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999983899999999998919999999


No 251
>2ia0_A Putative HTH-type transcriptional regulator PF0864; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus}
Probab=80.22  E-value=1.6  Score=22.07  Aligned_cols=30  Identities=13%  Similarity=0.133  Sum_probs=25.3

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      +-|..|.+....|.+++|+++|++++|+.+
T Consensus        21 ~IL~~Lq~d~R~s~~eIA~~lgls~~tv~~   50 (171)
T 2ia0_A           21 NILRLLKKDARLTISELSEQLKKPESTIHF   50 (171)
T ss_dssp             HHHHHHHHCTTCCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999984899999999998909999999


No 252
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A
Probab=80.18  E-value=2  Score=21.40  Aligned_cols=30  Identities=27%  Similarity=0.308  Sum_probs=25.4

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      .-|+.|.+....|.++||+++|+|++|+.+
T Consensus        11 ~Il~~L~~n~R~s~~~ia~~~gls~~tv~~   40 (150)
T 2w25_A           11 ILVRELAADGRATLSELATRAGLSVSAVQS   40 (150)
T ss_dssp             HHHHHHHHCTTCCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999983899999999998929899999


No 253
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH motif, PSI, protein structure initiative; 1.55A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.50
Probab=80.17  E-value=2.3  Score=20.97  Aligned_cols=31  Identities=19%  Similarity=0.225  Sum_probs=26.7

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..+..|.+..++|+++||+.+|++++++++.
T Consensus        24 ~v~~~L~~~~~~t~~eia~~~~~~~~~v~~~   54 (109)
T 1sfx_A           24 RIYSLLLERGGMRVSEIARELDLSARFVRDR   54 (109)
T ss_dssp             HHHHHHHHHCCBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCCHHHHH
T ss_conf             9999998048887999999975670189999


No 254
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A*
Probab=80.14  E-value=0.98  Score=23.42  Aligned_cols=30  Identities=7%  Similarity=0.150  Sum_probs=25.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999996499988999982899879889
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      +-|+.|.+...+|.++||+++|+|++++.+
T Consensus         7 ~Il~~L~~d~R~s~~eia~~lg~s~~tv~~   36 (150)
T 2pn6_A            7 RILKILQYNAKYSLDEIAREIRIPKATLSY   36 (150)
T ss_dssp             HHHHHHTTCTTSCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999984899999999998939999999


No 255
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris}
Probab=80.14  E-value=2.1  Score=21.28  Aligned_cols=32  Identities=16%  Similarity=0.381  Sum_probs=26.5

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+..+-|+|+++||++++++++++++.
T Consensus        52 ~~iL~~l~~~~~~t~~~La~~l~i~~~~vs~~   83 (162)
T 2fa5_A           52 WRVITILALYPGSSASEVSDRTAMDKVAVSRA   83 (162)
T ss_dssp             HHHHHHHHHSTTCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998679989999999978787159999


No 256
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28
Probab=80.09  E-value=2.1  Score=21.23  Aligned_cols=32  Identities=13%  Similarity=0.240  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |.-|..+..+.+.|+++||+.++++++++++.
T Consensus        37 ~~vL~~l~~~~~~t~~ela~~~~~~~~~vs~~   68 (138)
T 1jgs_A           37 FKVLCSIRCAACITPVELKKVLSVDLGALTRM   68 (138)
T ss_dssp             HHHHHHHHHHSSBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998779989999999989788799999


No 257
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2
Probab=79.92  E-value=1.6  Score=21.97  Aligned_cols=29  Identities=17%  Similarity=0.320  Sum_probs=24.0

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             99999996499988999982899879889
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      -|..|.+....|.++||+++|++++++.+
T Consensus         9 Il~~L~~d~r~s~~~ia~~~gls~~tv~~   37 (141)
T 1i1g_A            9 ILEILEKDARTPFTEIAKKLGISETAVRK   37 (141)
T ss_dssp             HHHHHHHCTTCCHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             99999984898999999998929999999


No 258
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3}
Probab=79.76  E-value=1.7  Score=21.93  Aligned_cols=32  Identities=6%  Similarity=0.085  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+...-|+|+++||++.+++++++++.
T Consensus        43 ~~vL~~l~~~~~~t~~~La~~l~~~~~~is~~   74 (152)
T 3bj6_A           43 RAILEGLSLTPGATAPQLGAALQMKRQYISRI   74 (152)
T ss_dssp             HHHHHHHHHSTTEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999879989999999989698799999


No 259
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix; 1.90A {Lactococcus lactis}
Probab=79.40  E-value=0.31  Score=26.67  Aligned_cols=50  Identities=12%  Similarity=0.104  Sum_probs=31.3

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             6499988999982899879889975157887557798999998732187521
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC   70 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~   70 (223)
                      +.-.|-.++|+++|||.+|+|+.-++.+.  -+.-..+.+.++++.+|-.++
T Consensus         3 ~~~~Ti~DIA~~aGVS~~TVSraLn~~~~--vs~~tr~rV~~~a~~lgY~pn   52 (332)
T 2o20_A            3 ESTTTIYDVARVAGVSMATVSRVVNGNAN--VKEKTRQKVLEAIAELDYRPN   52 (332)
T ss_dssp             ----------------------------------------------------
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHCCCCC
T ss_conf             89876999999979799999999689699--999999999999999589768


No 260
>2oqg_A Possible transcriptional regulator, ARSR family protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP}
Probab=78.98  E-value=3  Score=20.29  Aligned_cols=29  Identities=17%  Similarity=0.281  Sum_probs=23.7

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             999999649998899998289987988997
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.| .+...+.++||+.+|++++++++.-
T Consensus        27 l~~L-~~~~~~v~eLa~~l~is~s~vS~HL   55 (114)
T 2oqg_A           27 LTEL-GRADQSASSLATRLPVSRQAIAKHL   55 (114)
T ss_dssp             HHHH-HHSCBCHHHHHHHSSSCHHHHHHHH
T ss_pred             HHHH-HHCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9999-8199289999988888988999999


No 261
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A
Probab=78.89  E-value=3.2  Score=20.11  Aligned_cols=59  Identities=8%  Similarity=0.124  Sum_probs=36.6

Q ss_pred             HHHHHHHHHHHHHHCC------------CCHHHHHHHHCCCHHHHHHH----HHCC----CCCCCCCCCHHHHHHHHHH
Q ss_conf             8999999999999649------------99889999828998798899----7515----7887557798999998732
Q gi|254780444|r    6 HKKIWEAIDRMAERHN------------LTPSGLARKAGLDPTSFNKS----KRFG----IEGRNRWPSTESIFKILAA   64 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~g------------ls~~~lA~~~Gv~~~ti~~~----~~~~----~~g~~r~p~~~~l~kia~~   64 (223)
                      .++|...|-.|..+.|            +|+.+||..+|+++.|+++.    ++.+    ..++-.-...+.|.++++-
T Consensus       150 ~~Rl~~~L~~l~~~~g~~~~~~~~i~~~lt~~~LA~~lgisr~tvsR~l~~L~~~giI~~~~~~i~I~d~~~L~~~a~~  228 (250)
T 3e6c_C          150 TIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSEQ  228 (250)
T ss_dssp             HHHHHHHHHHHHHHHCEEETTEEEEECCCCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEECSSEEEESCHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCEEEECCHHHHHHHHCC
T ss_conf             8999999999999827556788646788689999989799999999999999988989964999998789999998757


No 262
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genomics, protein structure initiative; 2.30A {Agrobacterium tumefaciens str}
Probab=78.19  E-value=1.3  Score=22.69  Aligned_cols=29  Identities=28%  Similarity=0.395  Sum_probs=24.5

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             99999996499988999982899879889
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      -|+.|.+....|.++||+++|+|++|+.+
T Consensus         8 IL~~L~~d~R~s~~eiA~~lglS~~tv~~   36 (162)
T 3i4p_A            8 ILRILQEDSTLAVADLAKKVGLSTTPCWR   36 (162)
T ss_dssp             HHHHHTTCSCSCHHHHHHHHTCCHHHHHH
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             99999984899999999998929999999


No 263
>3dbi_A Sugar-binding transcriptional regulator, LACI family; structural genomics, protein structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12}
Probab=78.11  E-value=0.36  Score=26.26  Aligned_cols=46  Identities=11%  Similarity=0.112  Sum_probs=28.9

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             998899998289987988997515788755779899999873218752
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI   69 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~   69 (223)
                      .|-.++|+++|||.+|+|+.-++..  +-+.-..+.+.++++-+|-.+
T Consensus         4 ~Ti~DIA~~aGVS~~TVSrvLn~~~--~vs~~tr~rI~~~a~elgY~p   49 (338)
T 3dbi_A            4 TTMLEVAKRAGVSKATVSRVLSGNG--YVSQETKDRVFQAVEESGYRP   49 (338)
T ss_dssp             ------------------------------------------------
T ss_pred             CCHHHHHHHHCCCHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHCCCC
T ss_conf             8899999997979999999968979--999999999999999948987


No 264
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A
Probab=78.09  E-value=1.7  Score=21.88  Aligned_cols=29  Identities=14%  Similarity=0.348  Sum_probs=23.3

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999964999889999828998798899
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|..+ .+.|+|+++||+++|++++++++.
T Consensus        43 iL~~l-~~~~~t~~~la~~l~i~~~~vs~~   71 (151)
T 3kp7_A           43 VLNML-SIEALTVGQITEKQGVNKAAVSRR   71 (151)
T ss_dssp             HHHHH-HHSCBCHHHHHHHHCSCSSHHHHH
T ss_pred             HHHHH-HCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99998-628999999999989688899999


No 265
>2nyx_A Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV}
Probab=77.87  E-value=2.3  Score=21.03  Aligned_cols=37  Identities=11%  Similarity=0.266  Sum_probs=28.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ||..+ |..|..|.+.-++++++||+.+|++++++++.
T Consensus        43 LT~~q-~~vL~~l~~~~~~~~~eLa~~l~i~~~~vs~~   79 (168)
T 2nyx_A           43 ITIPQ-FRTLVILSNHGPINLATLATLLGVQPSATGRM   79 (168)
T ss_dssp             CCHHH-HHHHHHHHHHCSEEHHHHHHHHTSCHHHHHHH
T ss_pred             CCHHH-HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             89999-99999999679969999999989698899999


No 266
>1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A
Probab=77.29  E-value=1.9  Score=21.55  Aligned_cols=38  Identities=18%  Similarity=0.228  Sum_probs=27.8

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999999649998899998289987988997515
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .+..++.....+..+|-.+||+.+|+|+.+++++.+..
T Consensus        80 ~v~~~~~~~~~~~~~sl~~la~~~g~S~~~l~R~Fk~~  117 (133)
T 1u8b_A           80 KITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKAT  117 (133)
T ss_dssp             HHHHHHHHTCSSSCCCHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             99999999704799999999426198999999999999


No 267
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum}
Probab=76.89  E-value=0.4  Score=25.90  Aligned_cols=47  Identities=13%  Similarity=0.111  Sum_probs=29.5

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             4999889999828998798899751578875577989999987321875
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET   68 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~   68 (223)
                      ...|-.++|+++|||.+|+++.-++...  -+.-..+.+.++++.+|-.
T Consensus         3 m~vTi~dIA~~aGVS~~TVSraLn~~~~--Vs~~tr~rI~~~a~~lgY~   49 (339)
T 3h5o_A            3 LGVTMHDVAKAAGVSAITVSRVLNQPQQ--VSEQLREKVMQAVDALAYV   49 (339)
T ss_dssp             -------------------------------------------------
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHCCC
T ss_conf             7311999999989799999999689899--9999999999999997897


No 268
>3lsj_A DEST; transcriptional repressor, TETR family, DNA-binding, transcription, transcription regulation; HET: PLM COA; 2.30A {Pseudomonas aeruginosa} PDB: 3lsp_A* 3lsr_A*
Probab=76.84  E-value=0.81  Score=23.94  Aligned_cols=38  Identities=16%  Similarity=0.332  Sum_probs=28.8

Q ss_pred             CHHHHHHHHHHHH-HHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5899999999999-96499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMA-ERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~-~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+++|+++=-.|. .++|+   |-.++|+.+|++.+++.++.
T Consensus        12 tR~~IL~AA~~l~~~e~G~~~~S~~~IA~~aGvs~~tlY~yF   53 (220)
T 3lsj_A           12 TRHALMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHF   53 (220)
T ss_dssp             HHHHHHHHHHHHTTTSCCGGGCCHHHHHHHHTSCGGGGTTTC
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHC
T ss_conf             999999999999987599254119999999892978888867


No 269
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A*
Probab=76.81  E-value=3.6  Score=19.72  Aligned_cols=11  Identities=0%  Similarity=0.380  Sum_probs=6.3

Q ss_pred             CCCCCCCEEEE
Q ss_conf             21487868999
Q gi|254780444|r  149 PLYRKGDILIL  159 (223)
Q Consensus       149 P~i~~Gd~vlV  159 (223)
                      .+|+.|++|+-
T Consensus        46 ~ty~kge~I~~   56 (243)
T 3la7_A           46 ETFERNKTIFF   56 (243)
T ss_dssp             EEECTTCEEEC
T ss_pred             EEECCCCEEEC
T ss_conf             79899999977


No 270
>2np3_A Putative TETR-family regulator; transcriptional regulator, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.35A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1
Probab=76.55  E-value=0.42  Score=25.79  Aligned_cols=39  Identities=15%  Similarity=0.154  Sum_probs=32.1

Q ss_pred             CCHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             5589999999999996499---98899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|+++|.++-.+|..++|+   |-.++|+.+|++++++.++.
T Consensus        30 ~tR~~Il~aA~~l~~~~G~~~~T~~~IA~~aGvs~~tlY~~F   71 (212)
T 2np3_A           30 RTREAILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFY   71 (212)
T ss_dssp             -----CHHHHHHHC---------------------------C
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             899999999999999849130679999999781975566878


No 271
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2
Probab=76.55  E-value=3.7  Score=19.68  Aligned_cols=38  Identities=21%  Similarity=0.271  Sum_probs=29.1

Q ss_pred             CHHHHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996-49998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAER-HNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~-~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |-++...-|+.+.+. .++|.++||+++|++++|+.++-
T Consensus         6 sl~Ral~IL~~~a~~~~~~tl~eia~~lglpksT~~Rll   44 (249)
T 1mkm_A            6 TLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYM   44 (249)
T ss_dssp             THHHHHHHHHHHHHCSSCBCHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             999999999999738999899999998791999999999


No 272
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structural genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3}
Probab=76.51  E-value=1.5  Score=22.27  Aligned_cols=32  Identities=9%  Similarity=0.360  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..|..+.|+|+++||+.++++++++++.
T Consensus        46 ~~iL~~l~~~~~~t~~eLa~~l~~~~~tvs~~   77 (155)
T 3cdh_A           46 WRVLACLVDNDAMMITRLAKLSLMEQSRMTRI   77 (155)
T ss_dssp             HHHHHHHSSCSCBCHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998579969999999989699889999


No 273
>1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5
Probab=76.50  E-value=1.1  Score=23.19  Aligned_cols=24  Identities=13%  Similarity=0.092  Sum_probs=21.0

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             999889999828998798899751
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .++..+||+..|||..||..|.+.
T Consensus         2 ~vNk~qlA~~fgVS~~TI~~W~~~   25 (68)
T 1j9i_A            2 EVNKKQLADIFGASIRTIQNWQEQ   25 (68)
T ss_dssp             EEEHHHHHHHTTCCHHHHHHHTTT
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHHC
T ss_conf             558999999979888999999987


No 274
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MARR), structural genomics, PSI-2; HET: MSE; 2.04A {Oenococcus oeni psu-1} SCOP: a.4.5.28
Probab=76.26  E-value=3.6  Score=19.71  Aligned_cols=31  Identities=13%  Similarity=0.210  Sum_probs=22.8

Q ss_pred             HHHHHHHHHCC--CCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999649--99889999828998798899
Q gi|254780444|r   11 EAIDRMAERHN--LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~g--ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..|.+..|  +|+++||+.++++++++++.
T Consensus        38 ~vL~~l~~~~~~~~t~~~La~~l~i~~~~vs~~   70 (141)
T 3bro_A           38 TIIDYLSRNKNKEVLQRDLESEFSIKSSTATVL   70 (141)
T ss_dssp             HHHHHHHHTTTSCCBHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999848999959999999989788589999


No 275
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum}
Probab=76.16  E-value=3.2  Score=20.04  Aligned_cols=40  Identities=18%  Similarity=0.096  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             8999999999999649998899998289987988997515
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .+.|...|++-..+..+|..+||+.+|+++.++++..+..
T Consensus         4 ~e~i~~~I~~~~~~~~l~l~~lA~~~~~s~~~l~r~fk~~   43 (103)
T 3lsg_A            4 KELIQNIIEESYTDSQFTLSVLSEKLDLSSGYLSIMFKKN   43 (103)
T ss_dssp             HHHHHHHHHHHTTCTTCCHHHHHHHTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             9999999997667999899999999892999999999998


No 276
>2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, 2Fe-2S; HET: DNA; 2.80A {Escherichia coli K12} PDB: 2zhh_A
Probab=76.10  E-value=2.4  Score=20.92  Aligned_cols=57  Identities=19%  Similarity=0.282  Sum_probs=37.2

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCC------CCCCCCCHHH-----HHHHHHHCCCCCCCCCCCC
Q ss_conf             4999889999828998798899751578------8755779899-----9998732187521000011
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRFGIE------GRNRWPSTES-----IFKILAATNETICQLLDLP   76 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~~~~------g~~r~p~~~~-----l~kia~~~~v~~~~l~~~~   76 (223)
                      .-+|.+++|+++||+..|+..|++.+--      +.-|.-+.+.     +.+.+..+|.++.++....
T Consensus        10 ~~mtIgEvA~~~gvs~~tLR~YE~~GLl~p~R~~~gyR~Y~~~dv~~l~~I~~lr~~g~sl~eI~~~l   77 (154)
T 2zhg_A           10 ALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAIIKIAQRIGIPLATIGEAF   77 (154)
T ss_dssp             CCBCHHHHHHHHTSCHHHHHHHHHTTSSCCEECTTSCEEBCTTHHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             47079999999884999999999887999971799864515688899999999999179899999999


No 277
>1qbj_A Protein (double-stranded RNA specific adenosine deaminase (ADAR1)); protein/Z-DNA complex, hydrolase/DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A
Probab=75.99  E-value=2.4  Score=20.90  Aligned_cols=33  Identities=21%  Similarity=0.331  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999964999889999828998798899
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..++..+-+-.+++..+||+.+|++...||+.
T Consensus        15 Il~~L~~~g~g~~~tA~~LAk~lg~~Kk~vN~~   47 (81)
T 1qbj_A           15 ILKFLEELGEGKATTAHDLSGKLGTPKKEINRV   47 (81)
T ss_dssp             HHHHHHHHCTTCCBCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHH
T ss_conf             999999737997521999999969888898999


No 278
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A
Probab=75.94  E-value=2.8  Score=20.47  Aligned_cols=39  Identities=15%  Similarity=0.296  Sum_probs=32.7

Q ss_pred             CCHHHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649-998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g-ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -+.|+.+++|-.|.++.+ .+.+++|+.+++++++++..-
T Consensus         2 ~~~EdyL~~i~~l~~~~~~v~~~~iA~~l~vs~~sv~~~l   41 (214)
T 3hrs_A            2 PNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMM   41 (214)
T ss_dssp             CCHHHHHHHHHHTTSSCSCCCHHHHHHHHTCCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             6299999999999704897789999998689957999999


No 279
>2di3_A Bacterial regulatory proteins, GNTR family; helix-turn-helix, transcription; 2.05A {Corynebacterium glutamicum}
Probab=75.85  E-value=3.3  Score=19.96  Aligned_cols=41  Identities=15%  Similarity=0.298  Sum_probs=33.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC------C-CHHHHHHHHCCCHHHHHHH
Q ss_conf             977558999999999999649------9-9889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHN------L-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~g------l-s~~~lA~~~Gv~~~ti~~~   41 (223)
                      ||...+++|.+.|...+....      | |..+||+..|||.+++..-
T Consensus         1 ms~~~~e~V~~~i~~~I~~g~l~pG~~LpsE~eLa~~~gVSRt~VREA   48 (239)
T 2di3_A            1 MSVKAHESVMDWVTEELRSGRLKIGDHLPSERALSETLGVSRSSLREA   48 (239)
T ss_dssp             -CHHHHHHHHHHHHHHHHHTSSCTTCBCCCHHHHHHHHTCCHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCHHHHHHH
T ss_conf             997499999999999998299998099901999999989198999999


No 280
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28
Probab=75.20  E-value=2.2  Score=21.18  Aligned_cols=32  Identities=13%  Similarity=0.227  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+...-++|+++||+.++++++++++.
T Consensus        40 ~~vL~~l~~~~~~t~~ela~~~~~~~~~vs~~   71 (155)
T 1s3j_A           40 LFVLASLKKHGSLKVSEIAERMEVKPSAVTLM   71 (155)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999869979999999989699899999


No 281
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1
Probab=74.76  E-value=4.1  Score=19.38  Aligned_cols=44  Identities=16%  Similarity=0.171  Sum_probs=33.4

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC--------HHHHHHHHCCCHHHHHHHHHCCC
Q ss_conf             7755899999999999964999--------88999982899879889975157
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLT--------PSGLARKAGLDPTSFNKSKRFGI   46 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls--------~~~lA~~~Gv~~~ti~~~~~~~~   46 (223)
                      +.+|.+++ +.|++..++.++.        ..+||+.+||++..|..|..+..
T Consensus        22 t~~t~~Q~-~~L~~~fe~~~~~~~~p~~~~~~~la~~~gl~~~~v~vWF~N~R   73 (80)
T 1wh5_A           22 TKFTAEQK-ERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNK   73 (80)
T ss_dssp             CCCCHHHH-HHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHHHHHHHS
T ss_pred             CCCCHHHH-HHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHEEEECCCCC
T ss_conf             21799999-99999999842445698999999999997898889434464477


No 282
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28
Probab=74.65  E-value=0.81  Score=23.96  Aligned_cols=33  Identities=21%  Similarity=0.261  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999964999889999828998798899
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+..|.+.....|+|+++||+.+|++++++++.
T Consensus        74 vL~~L~~~~~~~~lt~~eLa~~l~~s~~~vs~~  106 (181)
T 2fbk_A           74 LLLTLYRSAPPEGLRPTELSALAAISGPSTSNR  106 (181)
T ss_dssp             HHHHHHHHCCSSCBCHHHHHHHCSCCSGGGSSH
T ss_pred             HHHHHHHCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999998509999909999999978787579999


No 283
>2jsc_A Transcriptional regulator RV1994C/MT2050; cadmium, transcriptional repressor, solution structure, structural genomics; NMR {Mycobacterium tuberculosis H37RV}
Probab=74.57  E-value=1.7  Score=21.87  Aligned_cols=38  Identities=13%  Similarity=0.148  Sum_probs=27.8

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+|..=+.-+..|+ +...+.++|++.+|++++++++.-
T Consensus        18 L~dptRl~Il~~L~-~~~~~v~ela~~lgis~stvS~HL   55 (118)
T 2jsc_A           18 LADPTRCRILVALL-DGVCYPGQLAAHLGLTRSNVSNHL   55 (118)
T ss_dssp             HSSHHHHHHHHHHH-TTCCSTTTHHHHHSSCHHHHHHHH
T ss_pred             HCCHHHHHHHHHHH-CCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             48999999999998-199289999999892999999999


No 284
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5
Probab=74.38  E-value=4.2  Score=19.32  Aligned_cols=32  Identities=22%  Similarity=0.263  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999964999889999828998798899
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +...|=.|. +.|+++.++|+.++|+.++++++
T Consensus        22 ~R~rIv~l~-~~G~s~~~Iar~l~Vs~~~V~ki   53 (128)
T 1pdn_C           22 IRLKIVEMA-ADGIRPCVISRQLRVSHGCVSKI   53 (128)
T ss_dssp             HHHHHHHHH-HTTCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999999-86999999999889689999999


No 285
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcription regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum}
Probab=74.04  E-value=0.53  Score=25.13  Aligned_cols=48  Identities=10%  Similarity=-0.076  Sum_probs=30.5

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             49998899998289987988997515788755779899999873218752
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI   69 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~   69 (223)
                      ...|-.++|+++|||.+|+|+.-++..  +-+....+.+.++++.+|--+
T Consensus         5 ~k~Ti~diA~~aGVS~aTVSr~Ln~~~--~Vs~~tr~rV~~aae~lgY~p   52 (333)
T 3jvd_A            5 AKSSLKEVAELAGVGYATASRALSGKG--YVSPQTREKVQAAAKELNYVP   52 (333)
T ss_dssp             --------------------------------------------------
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHCCCC
T ss_conf             998799999998979999999968979--999999999999999959973


No 286
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomics, PSI, protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28
Probab=73.90  E-value=3.4  Score=19.88  Aligned_cols=32  Identities=19%  Similarity=0.313  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+....|+++++||++++++++++++.
T Consensus        39 ~~vL~~l~~~~~~~~~~la~~l~i~~~~vs~~   70 (142)
T 2fbi_A           39 WRVIRILRQQGEMESYQLANQACILRPSMTGV   70 (142)
T ss_dssp             HHHHHHHHHHCSEEHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999879979999999979898899999


No 287
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A
Probab=73.81  E-value=4  Score=19.44  Aligned_cols=37  Identities=3%  Similarity=0.117  Sum_probs=26.2

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+++.=+.-+..| .+...+.++||..+|++++++++.
T Consensus        23 L~~p~Rl~Il~~L-~~~~~~v~el~~~l~~s~s~vS~H   59 (106)
T 1r1u_A           23 LGDYNRIRIMELL-SVSEASVGHISHQLNLSQSNVSHQ   59 (106)
T ss_dssp             TCSHHHHHHHHHH-HHCCBCHHHHHHHHTCCHHHHHHH
T ss_pred             HCCHHHHHHHHHH-HCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             6999999999999-829967999999876586589999


No 288
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28
Probab=73.32  E-value=2.6  Score=20.62  Aligned_cols=32  Identities=16%  Similarity=0.236  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+.+.-|+|+++||+.++++++++++.
T Consensus        32 ~~vL~~l~~~~~~t~~~La~~l~i~~~~vs~~   63 (144)
T 1lj9_A           32 YLYLVRVCENPGIIQEKIAELIKVDRTTAARA   63 (144)
T ss_dssp             HHHHHHHHHSTTEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998489979999999989788899999


No 289
>1jhg_A Trp operon repressor; complex (regulatory protein/peptide), DNA-binding regulatory protein; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 1trr_A* 1tro_A*
Probab=73.17  E-value=4.5  Score=19.13  Aligned_cols=38  Identities=8%  Similarity=0.103  Sum_probs=25.9

Q ss_pred             CCHHHH---HHHH--HHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             558999---9999--9999964999889999828998798899
Q gi|254780444|r    4 FSHKKI---WEAI--DRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i---~~~i--~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|..++   ..++  -+++-+-.+|+.++|..+|+|.+||++-
T Consensus        36 lT~~E~~~la~R~~ia~~L~~g~~s~reI~~~~gvS~aTItR~   78 (101)
T 1jhg_A           36 LTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRG   78 (101)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHCCSCHHHHHHHHCCCHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999999999999999908957999999969865777898


No 290
>3ctp_A Periplasmic binding protein/LACI transcriptional regulator; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens qymf}
Probab=72.86  E-value=0.59  Score=24.84  Aligned_cols=46  Identities=17%  Similarity=0.103  Sum_probs=28.9

Q ss_pred             CHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             988999982899879889975157887557798999998732187521
Q gi|254780444|r   23 TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC   70 (223)
Q Consensus        23 s~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~   70 (223)
                      |-.++|+++|||.+|+|+.-++...  -+....+.+.++++.+|-.+.
T Consensus         4 tikdIA~~agVS~~TVSr~Ln~~~~--vs~~tr~rV~~~a~~lgY~pn   49 (330)
T 3ctp_A            4 NIREIAKRAGISIATVSRHLNNTGY--VSEDAREKIQKVVDELNYTPN   49 (330)
T ss_dssp             ------------------------------------------------
T ss_pred             CHHHHHHHHCCCHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHCCCCC
T ss_conf             8999999989699999999689799--999999999999999589879


No 291
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, structural genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28
Probab=72.54  E-value=3.9  Score=19.55  Aligned_cols=31  Identities=6%  Similarity=-0.095  Sum_probs=25.4

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .-|..|....|+|+++||+.++++++++++.
T Consensus        52 ~iL~~L~~~~~~s~~ela~~~~~~~stvs~~   82 (207)
T 2fxa_A           52 HILWIAYQLNGASISEIAKFGVMHVSTAFNF   82 (207)
T ss_dssp             HHHHHHHHHTSEEHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999769949999999988698799999


No 292
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28
Probab=72.51  E-value=4.6  Score=19.03  Aligned_cols=31  Identities=16%  Similarity=0.269  Sum_probs=23.7

Q ss_pred             HHHHHHHHHC-CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964-999889999828998798899
Q gi|254780444|r   11 EAIDRMAERH-NLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~-gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|-.|.... |+|+++||+.+|++++++++.
T Consensus        41 ~iL~~l~~~~~~~t~~eL~~~~~~~~~~vs~~   72 (146)
T 2fbh_A           41 LVLLHLARHRDSPTQRELAQSVGVEGPTLARL   72 (146)
T ss_dssp             HHHHHHHHCSSCCBHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999986799999999999989689899999


No 293
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28
Probab=72.36  E-value=3  Score=20.30  Aligned_cols=31  Identities=13%  Similarity=0.311  Sum_probs=23.3

Q ss_pred             HHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999-64999889999828998798899
Q gi|254780444|r   11 EAIDRMAE-RHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~-~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..|.. +.|+|+++||+.+|++++++++.
T Consensus        57 ~vL~~L~~~~~~~t~~eLa~~l~i~~stvsr~   88 (166)
T 3deu_A           57 VTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRT   88 (166)
T ss_dssp             HHHHHHHHSCSSEEHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999997698979999999979899899999


No 294
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, structural genomics; 2.38A {Bacillus cereus atcc 10987}
Probab=72.36  E-value=1.8  Score=21.67  Aligned_cols=32  Identities=19%  Similarity=0.315  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..|.+..|+|+++||+.+|++++++++.
T Consensus        36 ~~vL~~l~~~~~~t~~~La~~l~~~~~tvs~~   67 (139)
T 3bja_A           36 FGVIQVLAKSGKVSMSKLIENMGCVPSNMTTM   67 (139)
T ss_dssp             HHHHHHHHHSCSEEHHHHHHHCSSCCTTHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHH
T ss_conf             99999999869989999984708688899999


No 295
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus}
Probab=72.29  E-value=2.9  Score=20.33  Aligned_cols=30  Identities=10%  Similarity=0.184  Sum_probs=23.0

Q ss_pred             HHHHHH--HHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999--964999889999828998798899
Q gi|254780444|r   12 AIDRMA--ERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        12 ~i~~l~--~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|..+.  +..|+|+++||+.+|++++++++.
T Consensus        36 vL~~l~~~~~~~~t~~ela~~l~~~~~tvs~~   67 (139)
T 3eco_A           36 TLGYLYAHQQDGLTQNDIAKALQRTGPTVSNL   67 (139)
T ss_dssp             HHHHHHHSTTTCEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999835999969999999989688789999


No 296
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus}
Probab=72.11  E-value=4.7  Score=18.97  Aligned_cols=62  Identities=16%  Similarity=0.169  Sum_probs=37.8

Q ss_pred             HHHHHHHHHHHHHHC-----------CCCHHHHHHHHCCCHHHHHHHH----HCC----CCCCCCCCCHHHHHHHHHHCC
Q ss_conf             899999999999964-----------9998899998289987988997----515----788755779899999873218
Q gi|254780444|r    6 HKKIWEAIDRMAERH-----------NLTPSGLARKAGLDPTSFNKSK----RFG----IEGRNRWPSTESIFKILAATN   66 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~-----------gls~~~lA~~~Gv~~~ti~~~~----~~~----~~g~~r~p~~~~l~kia~~~~   66 (223)
                      .+++...|..|.++.           .+|+.+||..+|+++.|+++.-    +.+    ..++-.-...+.|.++++.-|
T Consensus       120 ~~Rl~~~l~~l~~~~~~~~~~~~~~~~~t~~~iA~~lg~sr~tv~r~l~~L~~~g~I~~~~~~i~I~d~~~L~~~a~~~g  199 (202)
T 2zcw_A          120 KNRMAAALLELSETPLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKIQLLDLKGLKELAESRG  199 (202)
T ss_dssp             HHHHHHHHHHHTTSTTEEEETTEEEEECCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEETTEEEESCHHHHHHHHTSCC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCEEEECCHHHHHHHHHHCC
T ss_conf             99999999999997366764333457887999998979889999999999998899997499999988999999998628


Q ss_pred             C
Q ss_conf             7
Q gi|254780444|r   67 E   67 (223)
Q Consensus        67 v   67 (223)
                      .
T Consensus       200 ~  200 (202)
T 2zcw_A          200 Q  200 (202)
T ss_dssp             -
T ss_pred             C
T ss_conf             9


No 297
>1yse_A DNA-binding protein SATB1; all helical, DNA-binding domain, T-cell development; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=72.01  E-value=4.4  Score=19.18  Aligned_cols=59  Identities=8%  Similarity=0.038  Sum_probs=41.5

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHH-HCCCHHHHHHHHHCCCCCCCCCCC----HHHHHHHHHHCCCC
Q ss_conf             999999999999649998899998-289987988997515788755779----89999987321875
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARK-AGLDPTSFNKSKRFGIEGRNRWPS----TESIFKILAATNET   68 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~-~Gv~~~ti~~~~~~~~~g~~r~p~----~~~l~kia~~~~v~   68 (223)
                      ++|...|...+++++++|.-||+. +|.++.+++..-+.   .|+-|..    .+...++-+-++.+
T Consensus        24 ~~i~~~v~~eL~~~~I~Q~~Fa~~vl~rsQgtlsdLL~~---PKpp~~~~~~gre~f~RM~~wL~~p   87 (141)
T 1yse_A           24 SEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRK---EEDPKTASQSLLVNLRAMQNFLQLP   87 (141)
T ss_dssp             THHHHHHHHHHHHHTCCHHHHHHHHCCSCTTHHHHHHHH---CCCGGGCCHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHC---CCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999848779999999982281889999858---9985666187789999999998281


No 298
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ...
Probab=72.00  E-value=0.64  Score=24.63  Aligned_cols=47  Identities=15%  Similarity=0.056  Sum_probs=29.3

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             9998899998289987988997515788755779899999873218752
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI   69 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~   69 (223)
                      ..|-+++|+++|||.+|+|+.-++...  -+.-..+.+.++++-+|-.+
T Consensus         3 k~Ti~dIA~~aGVS~sTVSraLn~~~~--Vs~~tr~rV~~~a~~lgY~p   49 (349)
T 1jye_A            3 PVTLYDVAEYAGVSYQTVSRVVNQASH--VSAKTREKVEAAMAELNYIP   49 (349)
T ss_dssp             -------------------------------------------------
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHCCCCC--CCHHHHHHHHHHHHHHCCCC
T ss_conf             776999999988699999999679699--99999999999999978985


No 299
>1aoy_A Arginine repressor; DNA-binding protein, expression regulation, DNA organization, winged helix; NMR {Escherichia coli K12} SCOP: a.4.5.3
Probab=71.79  E-value=3.4  Score=19.87  Aligned_cols=42  Identities=10%  Similarity=0.272  Sum_probs=31.1

Q ss_pred             CCCCC-HHHHHHHHHHHHHHCCC-CHHHHHHHH---C---CCHHHHHHHH
Q ss_conf             97755-89999999999996499-988999982---8---9987988997
Q gi|254780444|r    1 MTSFS-HKKIWEAIDRMAERHNL-TPSGLARKA---G---LDPTSFNKSK   42 (223)
Q Consensus         1 ~~~~~-~~~i~~~i~~l~~~~gl-s~~~lA~~~---G---v~~~ti~~~~   42 (223)
                      |.+-+ .+++.++|+.|.++..+ ||.+|.+.+   |   ++++|+|+--
T Consensus         1 M~~~~kq~~~l~~I~~lI~~~~i~tQ~eL~~~L~~~G~~~vTQaTiSRDL   50 (78)
T 1aoy_A            1 MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRML   50 (78)
T ss_dssp             CCCCCCSTTHHHHHHHHHHTCCCCSHHHHHHHHHHHTCSSCCHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEECHHHHHHHH
T ss_conf             98278899999999999982885679999999998298665298899999


No 300
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28
Probab=71.61  E-value=2.1  Score=21.30  Aligned_cols=32  Identities=6%  Similarity=0.124  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +..|..+..+.|+|+++||+.++++++++++.
T Consensus        40 ~~vL~~i~~~~~~t~~~la~~l~~~~~~vs~~   71 (142)
T 2bv6_A           40 FLVLTILWDESPVNVKKVVTELALDTGTVSPL   71 (142)
T ss_dssp             HHHHHHHHHSSEEEHHHHHHHTTCCTTTHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999779989999999989798799999


No 301
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus dk 1622}
Probab=71.44  E-value=2  Score=21.37  Aligned_cols=56  Identities=20%  Similarity=0.309  Sum_probs=33.5

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHC-CC------CC-CCCCCCHHHHHH------HHHHCCCCCCCCCC
Q ss_conf             64999889999828998798899751-57------88-755779899999------87321875210000
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRF-GI------EG-RNRWPSTESIFK------ILAATNETICQLLD   74 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~-~~------~g-~~r~p~~~~l~k------ia~~~~v~~~~l~~   74 (223)
                      +..++-+++|+++|+++.||..|++. .-      ++ .-|.-+.+.+.+      ++...|.++.....
T Consensus         3 ~~~y~I~eva~~~gvs~~tlR~ye~~~gl~~p~r~~~~g~R~Y~~~~i~~l~~I~~l~~~~G~si~~i~~   72 (81)
T 2jml_A            3 HMTLRIRTIARMTGIREATLRAWERRYGFPRPLRSEGNNYRVYSREEVEAVRRVARLIQEEGLSVSEAIA   72 (81)
T ss_dssp             CCCEEHHHHHHTTSTTHHHHHHHHHHTCCSCCBSSSCSSSCEECHHHHHHHHHHHHHHHHTSTHHHHHHH
T ss_pred             CCEEEHHHHHHHHCCCHHHHHHHHHHCCCCCCEEECCCCCEECCHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             7535599999998859999999998269998625689973667899999999999999986998999999


No 302
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A
Probab=71.19  E-value=3  Score=20.23  Aligned_cols=55  Identities=7%  Similarity=0.131  Sum_probs=36.1

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHCCCC-------CCCCCCCHHHHHH-----HHHHCCCCCCCCCCC
Q ss_conf             999889999828998798899751578-------8755779899999-----873218752100001
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRFGIE-------GRNRWPSTESIFK-----ILAATNETICQLLDL   75 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~~~~-------g~~r~p~~~~l~k-----ia~~~~v~~~~l~~~   75 (223)
                      .++-+++|+.+|+++.|+..|++.+.-       +.-|.-+.+.+..     .+..+|.++.++...
T Consensus         2 ~ytI~e~A~~~gvs~~tlR~Ye~~GLl~p~~r~~~gyR~Y~~~~v~~l~~I~~lr~~G~sl~ei~~~   68 (109)
T 1r8d_A            2 KYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGFRLDEIKEM   68 (109)
T ss_dssp             CBCHHHHHHHHSCCHHHHHHHHHTTSSCCSEECTTCCEEBCHHHHHHHHHHHHHHHTTCCHHHHHHH
T ss_pred             CEEHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             5109999999896999999999858948773189998306699999999999999969999999999


No 303
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus}
Probab=71.15  E-value=3.5  Score=19.83  Aligned_cols=28  Identities=7%  Similarity=0.043  Sum_probs=22.3

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999964999889999828998798899
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..+. +.++|+++||+.+|++++++++.
T Consensus        43 L~~i~-~~~~t~~~la~~~~~~~~tvs~~   70 (144)
T 3f3x_A           43 LKATS-EEPRSMVYLANRYFVTQSAITAA   70 (144)
T ss_dssp             HHHHH-HSCEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHH-HCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999-19969999999989788689999


No 304
>2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Bacillus cereus atcc 14579} SCOP: a.4.1.17
Probab=71.13  E-value=3.2  Score=20.09  Aligned_cols=25  Identities=16%  Similarity=0.224  Sum_probs=22.0

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             4999889999828998798899751
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ...|+.++|.-+||+..|+.+|+..
T Consensus        47 ~k~T~~eiAeEvGvsr~TLy~Wk~q   71 (155)
T 2ao9_A           47 EKRTQDEMANELGINRTTLWEWRTK   71 (155)
T ss_dssp             CCCCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHC
T ss_conf             3647999999957469999988605


No 305
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049}
Probab=70.93  E-value=3.3  Score=20.03  Aligned_cols=33  Identities=24%  Similarity=0.390  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCC--CHHHHHHH
Q ss_conf             8999999999999649998899998289--98798899
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGL--DPTSFNKS   41 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv--~~~ti~~~   41 (223)
                      -++|++.|   +++-..|++++|+.+|+  ++++|++.
T Consensus        15 D~rILE~L---~e~g~~t~~eIA~~lgi~~S~~~Vs~r   49 (111)
T 3b73_A           15 DDRILEII---HEEGNGSPKELEDRDEIRISKSSVSRR   49 (111)
T ss_dssp             HHHHHHHH---HHHSCBCHHHHHTSTTCCSCHHHHHHH
T ss_pred             HHHHHHHH---HHCCCCCHHHHHHHHCCCCCHHHHHHH
T ss_conf             99999999---984999999999986888479999999


No 306
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum}
Probab=69.94  E-value=5.3  Score=18.67  Aligned_cols=42  Identities=19%  Similarity=0.188  Sum_probs=31.5

Q ss_pred             CCHHHHHHHHHHHHHH--CCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             5589999999999996--49998899998289987988997515
Q gi|254780444|r    4 FSHKKIWEAIDRMAER--HNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~--~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      -+|.+|..+++-+.++  ..+|..+||+.+|+|+.++++..+..
T Consensus         4 ~~~p~l~~~~~~i~~~~~~~~~~~~lA~~~~~s~~~l~r~fk~~   47 (113)
T 3oio_A            4 GSQPKLTEAVSLMEANIEEPLSTDDIAYYVGVSRRQLERLFKQY   47 (113)
T ss_dssp             GGCHHHHHHHHHHHTCSSSCCCHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             55799999999999755899999999999891999999999860


No 307
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded) form, allostery, DNA binding; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3h3u_A*
Probab=69.87  E-value=5.3  Score=18.66  Aligned_cols=21  Identities=29%  Similarity=0.433  Sum_probs=12.3

Q ss_pred             CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999889999828998798899
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      -+|+..||..+|+++.|+++.
T Consensus       177 ~~t~~~lA~~lg~s~~tvsr~  197 (227)
T 3d0s_A          177 DLTQEEIAQLVGASRETVNKA  197 (227)
T ss_dssp             CCCHHHHHHHHTSCHHHHHHH
T ss_pred             CCCHHHHHHHHCCCHHHHHHH
T ss_conf             789999998879899999999


No 308
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36
Probab=69.74  E-value=3  Score=20.23  Aligned_cols=24  Identities=17%  Similarity=0.162  Sum_probs=20.0

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             964999889999828998798899
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ...++|+++||+++|++++++++.
T Consensus        38 ~~~p~t~~eLa~~l~is~s~vs~~   61 (152)
T 1ku9_A           38 SDKPLTISDIMEELKISKGNVSMS   61 (152)
T ss_dssp             CSSCEEHHHHHHHHTCCHHHHHHH
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             698929999999989688579999


No 309
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcriptional regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A
Probab=68.89  E-value=1.3  Score=22.54  Aligned_cols=31  Identities=13%  Similarity=0.148  Sum_probs=23.8

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..+.++.++|++++|+.+|++++++++.
T Consensus        40 ~vL~~l~~~~~~t~~ela~~l~~~~~tvs~~   70 (140)
T 3hsr_A           40 IVLMAIENDEKLNIKKLGERVFLDSGTLTPL   70 (140)
T ss_dssp             HHHHHSCTTCEEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999998679989999999989786479999


No 310
>3boq_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3}
Probab=68.87  E-value=1.8  Score=21.69  Aligned_cols=30  Identities=13%  Similarity=0.170  Sum_probs=20.1

Q ss_pred             HHHHHHHH-CCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999996-4999889999828998798899
Q gi|254780444|r   12 AIDRMAER-HNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        12 ~i~~l~~~-~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|..|.+. .|+|+++||+.+|++++++++.
T Consensus        52 vL~~L~~~~~~~t~~~La~~~~v~~~~vs~~   82 (160)
T 3boq_A           52 AMAQLARNPDGLSMGKLSGALKVTNGNVSGL   82 (160)
T ss_dssp             HHHHHHHCTTCEEHHHHHHHCSSCCSCHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999986899998999999989688589999


No 311
>3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian}
Probab=68.75  E-value=3.8  Score=19.62  Aligned_cols=59  Identities=15%  Similarity=0.104  Sum_probs=38.2

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCC-CCC------CCCHHHH-----HHHHHHCCCCCCCCC
Q ss_conf             9999649998899998289987988997515788-755------7798999-----998732187521000
Q gi|254780444|r   15 RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNR------WPSTESI-----FKILAATNETICQLL   73 (223)
Q Consensus        15 ~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g-~~r------~p~~~~l-----~kia~~~~v~~~~l~   73 (223)
                      ..+.+.-+|-+++|+.+|+++.||..|++.+--. ..|      .-+.+.+     .+.+..+|.++.++.
T Consensus        10 ~~m~~m~ytIgevA~~~gvs~~tLRyYE~~GLl~p~~r~~ngyR~Y~~~di~~l~~I~~lr~~G~sL~eIk   80 (148)
T 3gpv_A           10 KRMNDMYYTIGQVAKMQHLTISQIRYYDKQGLFPFLQRNEKGDRIFNEEALKYLEMILCLKNTGMPIQKIK   80 (148)
T ss_dssp             -----CCBCHHHHHHHTTCCHHHHHHHHHTTCCTTCEECTTCCEEBCHHHHHHHHHHHHHHTTTCCHHHHH
T ss_pred             CHHHCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             26515776599999998959999999998799184100578860164888999999999999699999999


No 312
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli}
Probab=68.67  E-value=5.6  Score=18.50  Aligned_cols=39  Identities=18%  Similarity=0.321  Sum_probs=29.9

Q ss_pred             HHHHHHHHHHHHH---CCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             9999999999996---49998899998289987988997515
Q gi|254780444|r    7 KKIWEAIDRMAER---HNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         7 ~~i~~~i~~l~~~---~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      ++|.++++-+.++   ..+|..+||+.+|+++.++++..+..
T Consensus         3 ~ri~~~~~~i~~~~~~~~~~l~~lA~~~~~s~~~l~r~fk~~   44 (107)
T 2k9s_A            3 NRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQ   44 (107)
T ss_dssp             HHHHHHHHHHHHTSSCSSCCHHHHHHHTTSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             899999999997567999799999999892999999999999


No 313
>1nr3_A MTH0916, DNA-binding protein TFX; northeast structural genomics consortium, reduced- dimensionality PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.236.1.1
Probab=68.66  E-value=0.18  Score=28.21  Aligned_cols=28  Identities=11%  Similarity=0.131  Sum_probs=23.5

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             9649998899998289987988997515
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +++|+||+++|+.+|.|.+.++-.++..
T Consensus         2 R~kG~tQ~eIA~~LgTSraNVs~IEk~A   29 (122)
T 1nr3_A            2 RERGWSQKKIARELKTTRQNVSAIERKA   29 (122)
T ss_dssp             CCCSCSSCSTHHHHHHCCSSSCCHHHHH
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             6257879999999777588999999999


No 314
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus}
Probab=67.99  E-value=2  Score=21.38  Aligned_cols=39  Identities=10%  Similarity=0.236  Sum_probs=27.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             7558999999999999649998899998289987988997
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+|+.=+.-|..| .+..++.++||..+|++++++|+.-
T Consensus        19 aL~~p~Rl~Il~~L-~~~~~~v~ela~~l~~s~~tvS~HL   57 (98)
T 3jth_A           19 AMANERRLQILCML-HNQELSVGELCAKLQLSQSALSQHL   57 (98)
T ss_dssp             HHCSHHHHHHHHHT-TTSCEEHHHHHHHHTCCHHHHHHHH
T ss_pred             HHCCHHHHHHHHHH-HCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             84999999999999-7299379999999885956788999


No 315
>2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans}
Probab=67.96  E-value=3.4  Score=19.93  Aligned_cols=54  Identities=13%  Similarity=0.102  Sum_probs=35.1

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCC-------CCCCCCHHHHH-----HHHHHCCCCCCCCCCC
Q ss_conf             998899998289987988997515788-------75577989999-----9873218752100001
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGIEG-------RNRWPSTESIF-----KILAATNETICQLLDL   75 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~~g-------~~r~p~~~~l~-----kia~~~~v~~~~l~~~   75 (223)
                      +|-+++|+.+|+++.|+..|++.+.-.       .-|.-+.+.+.     +.+..+|.++.++...
T Consensus         2 ytI~e~a~~~gvs~~tLR~Ye~~GLl~p~~r~~~gyR~Y~~~~~~~l~~I~~lr~~G~sl~eI~~~   67 (108)
T 2vz4_A            2 YSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQILFYRELGFPLDEVAAL   67 (108)
T ss_dssp             BCHHHHHHHHTCCHHHHHHHHHHTSSCCSEECSSCCEEBCHHHHHHHHHHHHHHHTTCCHHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             508999999895999999983258999872089984247879899999999999969999999999


No 316
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi}
Probab=67.88  E-value=3.8  Score=19.61  Aligned_cols=32  Identities=13%  Similarity=0.208  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|..+....+.|+++||+.++++++++++.
T Consensus        56 ~~vL~~l~~~~~~t~~~la~~l~i~~~~vs~~   87 (161)
T 3e6m_A           56 LRLLSSLSAYGELTVGQLATLGVMEQSTTSRT   87 (161)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999779989999999989788799999


No 317
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1
Probab=67.84  E-value=5.8  Score=18.39  Aligned_cols=41  Identities=12%  Similarity=0.300  Sum_probs=33.9

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             99999999999964999889999828998798899751578
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE   47 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~   47 (223)
                      ..+...|+..+.+.|+++..++..+|+++++|+++.+....
T Consensus        29 ~~~a~~Ik~~l~~~~i~q~~~~~~~~~Sqs~is~~l~~~~~   69 (194)
T 1ic8_A           29 WRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTP   69 (194)
T ss_dssp             HHHHHHHHHHHHHTTCCHHHHHHHHCCCHHHHHHHHHSBCC
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999999982899533565667786540224568998


No 318
>3dv8_A Transcriptional regulator, CRP/FNR family; RER070207001219, structural genomics, joint center for structural genomics, JCSG; 2.55A {Eubacterium rectale atcc 33656}
Probab=67.04  E-value=6  Score=18.29  Aligned_cols=19  Identities=16%  Similarity=0.270  Sum_probs=9.1

Q ss_pred             CCHHHHHHHHCCCHHHHHH
Q ss_conf             9988999982899879889
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~   40 (223)
                      +|+.+||..+|+++.|+++
T Consensus       170 ~t~~~lA~~lg~sr~tvsr  188 (220)
T 3dv8_A          170 ITHETIANHLGSHREVITR  188 (220)
T ss_dssp             CCHHHHHHHHTCCHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHH
T ss_conf             9999999997989999999


No 319
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A
Probab=66.57  E-value=3.3  Score=19.99  Aligned_cols=38  Identities=13%  Similarity=0.253  Sum_probs=25.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+|+.=+.-+..| .+..++.++||+.+|++++++|+.-
T Consensus        43 L~dp~Rl~Il~~L-~~~~~~v~ela~~l~~s~stvS~HL   80 (122)
T 1r1t_A           43 LADPNRLRLLSLL-ARSELCVGDLAQAIGVSESAVSHQL   80 (122)
T ss_dssp             HCCHHHHHHHHHH-TTCCBCHHHHHHHHTCCHHHHHHHH
T ss_pred             HCCHHHHHHHHHH-HCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             5899999999999-8299769999999891988899999


No 320
>1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A
Probab=66.39  E-value=4.6  Score=19.08  Aligned_cols=53  Identities=11%  Similarity=0.086  Sum_probs=35.7

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCC-------CCCCCCHHHHH-----HHHHHCCCCCCCCCC
Q ss_conf             998899998289987988997515788-------75577989999-----987321875210000
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGIEG-------RNRWPSTESIF-----KILAATNETICQLLD   74 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~~g-------~~r~p~~~~l~-----kia~~~~v~~~~l~~   74 (223)
                      ++-+++|+++||+..||.-|++.+.-.       .-|..+.+.+.     +.+..+|.++..+..
T Consensus         1 M~Ige~Ak~~gvs~~tlRyYe~~GLl~p~~r~~~gyR~Y~~~~v~rL~~I~~lr~~G~sl~~I~~   65 (135)
T 1q06_A            1 MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGE   65 (135)
T ss_dssp             CCHHHHHHHHTCCHHHHHHHHHTTCSCCCEECTTSCEECCHHHHHHHHHHHHHHHTTCCHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             97899999989199999999997896987668777711539899999999999883999999999


No 321
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structural genomics, protein structure initiative; HET: GOL; 2.00A {Rhodococcus jostii RHA1}
Probab=66.36  E-value=6.2  Score=18.20  Aligned_cols=31  Identities=23%  Similarity=0.382  Sum_probs=23.7

Q ss_pred             HHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999996-4999889999828998798899
Q gi|254780444|r   11 EAIDRMAER-HNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~-~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..+... .++|+++||+.++++++++++.
T Consensus        43 ~iL~~l~~~~~~~t~~ela~~l~~~~~~vsr~   74 (150)
T 3fm5_A           43 SVLVLACEQAEGVNQRGVAATMGLDPSQIVGL   74 (150)
T ss_dssp             HHHHHHHHSTTCCCSHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999998598989999999978878778899


No 322
>2o4a_A DNA-binding protein SATB1; protein-DNA complex, transcription, transcription/DNA complex; HET: DNA; 1.75A {Homo sapiens} SCOP: a.35.1.7 PDB: 2o49_A*
Probab=66.22  E-value=6.3  Score=18.19  Aligned_cols=60  Identities=8%  Similarity=0.037  Sum_probs=42.8

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHH-HCCCHHHHHHHHHCCCCCCCCCCCH----HHHHHHHHHCCCCC
Q ss_conf             999999999999649998899998-2899879889975157887557798----99999873218752
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARK-AGLDPTSFNKSKRFGIEGRNRWPST----ESIFKILAATNETI   69 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~-~Gv~~~ti~~~~~~~~~g~~r~p~~----~~l~kia~~~~v~~   69 (223)
                      ++|...|...++..+++|.-||+. +|.+|.|++..-+.   .++-|+.+    ++..++.+-++.+.
T Consensus        10 ~eI~~~i~~eL~~~~I~Q~~Fak~VL~rsQGtlSdLLr~---Pk~pw~~~~sgre~f~Rm~~wL~lPe   74 (93)
T 2o4a_A           10 SEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRK---EEDPKTASQSLLVNLRAMQNFLQLPE   74 (93)
T ss_dssp             TTHHHHHHHHHHHHTCCHHHHHHHHHSCCHHHHHHHHHH---CCCTTSCCHHHHHHHHHHHHHHTSCH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHC---CCCCHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             999999999999857649999999981070589999838---99961776523599999999982849


No 323
>2c35_A Human RPB4, DNA-directed RNA polymerase II 16 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: a.60.8.2
Probab=66.13  E-value=6.3  Score=18.17  Aligned_cols=62  Identities=21%  Similarity=0.210  Sum_probs=41.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751578875577989999987321
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT   65 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~   65 (223)
                      .++.++-..++..++++.+|++.+.|..+.+-|+++--.+--...-+.| .+-+.|.+|++.+
T Consensus        83 k~k~~esi~~v~~lL~~~~L~k~E~~qI~NL~P~t~~Eak~LIpsl~~r-~~de~L~~ILd~l  144 (152)
T 2c35_A           83 RFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGR-FEDEELQQILDDI  144 (152)
T ss_dssp             SCCSHHHHHHHHHHHHTSSCCHHHHHHHHHHCCSSHHHHHHHCGGGTTT-SCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHCC-CCHHHHHHHHHHH
T ss_conf             7898999999999861358879999998367989999999997765047-9999999999999


No 324
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum}
Probab=65.97  E-value=3.4  Score=19.88  Aligned_cols=31  Identities=19%  Similarity=0.179  Sum_probs=23.1

Q ss_pred             HHHHHHHH--HCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999--64999889999828998798899
Q gi|254780444|r   11 EAIDRMAE--RHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~--~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..|..|..  +.|+|+++||+.+|++.+++++.
T Consensus        45 ~vL~~L~~~~~~~it~~eLa~~l~~~~~~~sr~   77 (148)
T 3jw4_A           45 RMIGYIYENQESGIIQKDLAQFFGRRGASITSM   77 (148)
T ss_dssp             HHHHHHHHHTTTCCCHHHHHHC------CHHHH
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999937999939999999989778589999


No 325
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii OT3} SCOP: a.4.5.58 PDB: 2cwe_A
Probab=65.85  E-value=4.2  Score=19.33  Aligned_cols=36  Identities=14%  Similarity=0.197  Sum_probs=25.5

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             5899999999999964999889999828998798899
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|+.=..-|+.| .+..+|.++||+.+|+++++++..
T Consensus        18 ~~~~R~~IL~~L-~~~~~t~~ela~~l~~s~~~v~~H   53 (192)
T 1uly_A           18 LEDTRRKILKLL-RNKEMTISQLSEILGKTPQTIYHH   53 (192)
T ss_dssp             HSHHHHHHHHHH-TTCCBCHHHHHHHHTCCHHHHHHH
T ss_pred             CCHHHHHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999999999-829967999999989198899999


No 326
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.5
Probab=65.49  E-value=5.7  Score=18.46  Aligned_cols=25  Identities=8%  Similarity=0.216  Sum_probs=21.0

Q ss_pred             HHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99964999889999828998798899
Q gi|254780444|r   16 MAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        16 l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ++.+ +.+.++||+.+|+++++++..
T Consensus        39 ~L~~-~~~~~eLa~~lg~s~stvs~H   63 (96)
T 1y0u_A           39 MLDK-GRSEEEIMQTLSLSKKQLDYH   63 (96)
T ss_dssp             HHHT-TCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHCC-CCCHHHHHHHHCCCHHHHHHH
T ss_conf             8357-997999999989199899999


No 327
>2cpg_A REPA protein, transcriptional repressor COPG; DNA-binding protein, plasmid, gene regulation; 1.60A {Streptococcus agalactiae} SCOP: a.43.1.3 PDB: 1b01_A* 1ea4_A*
Probab=65.16  E-value=4.3  Score=19.26  Aligned_cols=25  Identities=20%  Similarity=0.392  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             8999999999999649998899998
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARK   30 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~   30 (223)
                      -+++.+++..+.++.|+|.|++-..
T Consensus        10 s~~v~~~L~~~akekGlSKSalltv   34 (45)
T 2cpg_A           10 SESVLENLEKMAREMGLSKSAMISV   34 (45)
T ss_dssp             EHHHHHHHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             0999999999999748519999999


No 328
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.30A {Rhodococcus SP}
Probab=64.83  E-value=3.2  Score=20.08  Aligned_cols=34  Identities=24%  Similarity=0.261  Sum_probs=25.5

Q ss_pred             HHHHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             999999999-9649998899998289987988997
Q gi|254780444|r    9 IWEAIDRMA-ERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         9 i~~~i~~l~-~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ...-|+.+. ...++|.++||+++|++++|+.++-
T Consensus        16 al~IL~~~~~~~~~~~~~eia~~~gl~~st~~RlL   50 (257)
T 2g7u_A           16 GFAVLLAFDAQRPNPTLAELATEAGLSRPAVRRIL   50 (257)
T ss_dssp             HHHHHHTCSSSCSSCBHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999999847999899999998793999999999


No 329
>3c57_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A
Probab=64.55  E-value=6.7  Score=17.98  Aligned_cols=23  Identities=17%  Similarity=0.148  Sum_probs=21.1

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             49998899998289987988997
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+|..++|+.+|++..|+..+.
T Consensus        41 ~G~s~~eIA~~L~iS~~TV~~~~   63 (95)
T 3c57_A           41 EGLTNKQIADRMFLAEKTVKNYV   63 (95)
T ss_dssp             TTCCHHHHHHHHTCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             07999999879497899999999


No 330
>2o0m_A Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} SCOP: c.124.1.8
Probab=64.37  E-value=1.1  Score=23.00  Aligned_cols=28  Identities=7%  Similarity=0.136  Sum_probs=24.0

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999649998899998289987988997
Q gi|254780444|r   15 RMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        15 ~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|--+.|+||+++|+++|+|.+++++.-
T Consensus        28 ~lyy~~~~~q~~IA~~lg~Sr~~V~r~l   55 (345)
T 2o0m_A           28 NIYWMQPIGRRSLSETMGITERVLRTET   55 (345)
T ss_dssp             ----------------------------
T ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9988489799999988499775999999


No 331
>2zdb_A Transcriptional regulator, CRP family; CAMP-binding domain, winged helix-turn-helix, thermus thermophilus DNA-binding, plasmid; 2.00A {Thermus thermophilus}
Probab=64.12  E-value=6.9  Score=17.93  Aligned_cols=58  Identities=14%  Similarity=0.037  Sum_probs=34.5

Q ss_pred             HHHHHHHHHHHHHH-----------CCCCHHHHHHHHCCCHHHHHHHH----HCC----CCCCCCCCCHHHHHHHHH
Q ss_conf             89999999999996-----------49998899998289987988997----515----788755779899999873
Q gi|254780444|r    6 HKKIWEAIDRMAER-----------HNLTPSGLARKAGLDPTSFNKSK----RFG----IEGRNRWPSTESIFKILA   63 (223)
Q Consensus         6 ~~~i~~~i~~l~~~-----------~gls~~~lA~~~Gv~~~ti~~~~----~~~----~~g~~r~p~~~~l~kia~   63 (223)
                      .+++...|-.|.+.           ..+|+++||..+|+++.|+++..    +.+    ..++-.-...+.|.++|+
T Consensus       113 ~~Rl~~~L~~l~~~~~~~~~~~~i~i~lt~~~lA~~lg~sr~tvsR~l~~L~~~g~I~~~~~~i~I~d~~~L~~~A~  189 (195)
T 2zdb_A          113 RARIARYLLFLADTPLSARDRQGIYVTVSHEEIADATASIRESVSKVLADLRREGLIATAYRRVYLLDLAALEREAG  189 (195)
T ss_dssp             HHHHHHHHHHHTTSTTEEEETTEEEEECCHHHHHHTTTSCHHHHHHHHHHHHHHTSEEEETTEEEECCHHHHHHHHS
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEECCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCEEEECCHHHHHHHHC
T ss_conf             79999999999874346665542224887999998879979999999999998898997099999978999999846


No 332
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19
Probab=64.10  E-value=3.8  Score=19.59  Aligned_cols=34  Identities=21%  Similarity=0.191  Sum_probs=23.8

Q ss_pred             HHHHHHHHHHHHCC----CCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999999649----99889999828998798899
Q gi|254780444|r    8 KIWEAIDRMAERHN----LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         8 ~i~~~i~~l~~~~g----ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ++-+.|-..+.+.|    .+..+||+.+|++...||+.
T Consensus        14 d~e~kIl~~L~~~g~g~~~tA~~LAk~lg~~Kk~vN~~   51 (77)
T 1qgp_A           14 DQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRV   51 (77)
T ss_dssp             HHHHHHHHHHHHHCSSSCEEHHHHHHHHCCCHHHHHHH
T ss_pred             CHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHH
T ss_conf             88999999999658987602999999969888888999


No 333
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp}
Probab=63.69  E-value=5.5  Score=18.54  Aligned_cols=25  Identities=8%  Similarity=0.044  Sum_probs=21.7

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -.|+|..++|+.+|+++.++.++..
T Consensus       122 ~~g~s~~EIA~~lgis~~~V~~~~~  146 (164)
T 3mzy_A          122 IRGYSYREIATILSKNLKSIDNTIQ  146 (164)
T ss_dssp             TTTCCHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             6238999999998919999999999


No 334
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1
Probab=63.38  E-value=5  Score=18.80  Aligned_cols=22  Identities=14%  Similarity=0.160  Sum_probs=17.1

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             4999889999828998798899
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..+|+.+||..+|+++.|+++.
T Consensus       162 ~~lt~~~lA~~lg~sr~tvsr~  183 (222)
T 1ft9_A          162 VDFTVEEIANLIGSSRQTTSTA  183 (222)
T ss_dssp             ECCCHHHHHHHHCSCHHHHHHH
T ss_pred             CCCHHHHHHHHHCCCHHHHHHH
T ss_conf             8846999999979989999999


No 335
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A
Probab=62.71  E-value=7.3  Score=17.77  Aligned_cols=25  Identities=12%  Similarity=0.236  Sum_probs=22.1

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..|+|..++|+.+|+|..|+..+.+
T Consensus        34 a~G~s~~eIA~~L~iS~~TV~~~~~   58 (82)
T 1je8_A           34 AQGLPNKMIARRLDITESTVKVHVK   58 (82)
T ss_dssp             TTTCCHHHHHHHHTSCHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9289999999897959999999999


No 336
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP}
Probab=62.52  E-value=3.6  Score=19.78  Aligned_cols=32  Identities=9%  Similarity=0.094  Sum_probs=24.7

Q ss_pred             HHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999999-9649998899998289987988997
Q gi|254780444|r   11 EAIDRMA-ERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        11 ~~i~~l~-~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .-|+.+. ...++|.++||+.+|++++|++++-
T Consensus        27 ~ILe~l~~~~~~~~l~eia~~lgl~~sT~~RlL   59 (260)
T 2o0y_A           27 DLLELFDAAHPTRSLKELVEGTKLPKTTVVRLV   59 (260)
T ss_dssp             HHHTTCBTTBSSBCHHHHHHHHCCCHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             999999747999899999999791999999999


No 337
>3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA- binding, transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str}
Probab=62.49  E-value=4.9  Score=18.91  Aligned_cols=54  Identities=19%  Similarity=0.261  Sum_probs=34.8

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHCCCC-------CCCCCCCHHHHH-----HHHHHCCCCCCCCCC
Q ss_conf             999889999828998798899751578-------875577989999-----987321875210000
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRFGIE-------GRNRWPSTESIF-----KILAATNETICQLLD   74 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~~~~-------g~~r~p~~~~l~-----kia~~~~v~~~~l~~   74 (223)
                      .+|-+++|+.+||++.||..|++.+.-       +.-|.-+.+.+.     +.+..+|.++.++..
T Consensus         2 ~msI~e~a~~~gvs~~tLRyYe~~GLl~p~~r~~~gyR~Y~~~dl~~L~~I~~lr~~G~sL~eIk~   67 (142)
T 3gp4_A            2 SLNIKEASEKSGVSADTIRYYERIGLIPPIHRNESGVRKFGAEDLRWILFTRQMRRAGLSIEALID   67 (142)
T ss_dssp             CBCHHHHHHHHTSCHHHHHHHHHHTSSCCCCBCTTSCBCBCHHHHHHHHHHHHHHHTTCCHHHHHH
T ss_pred             CEEHHHHHHHHCCCHHHHHHHHHCCCCCCHHHCCCCCEEEEHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             504999999989498999999987999725526899544109899999999999986998999999


No 338
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri}
Probab=62.13  E-value=7.5  Score=17.70  Aligned_cols=25  Identities=24%  Similarity=0.206  Sum_probs=21.7

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             4999889999828998798899751
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .|.+..++|..+||+++|+.+|.+.
T Consensus        29 ~g~~~~~va~~Lgi~~~tl~~Wv~~   53 (108)
T 2rn7_A           29 QWATICSIAPKIGCTPETLRVWVRQ   53 (108)
T ss_dssp             HHHHHHHHHHHHTSCHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             5551999999979799999999999


No 339
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli}
Probab=61.99  E-value=4.3  Score=19.28  Aligned_cols=37  Identities=19%  Similarity=0.269  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999999649998899998289987988997515
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +|.+.|+.-.. ..++..++|+.+|+++.++++..+..
T Consensus        11 ri~~~i~~~~~-~~~~l~~lA~~~~~S~~~l~r~fk~~   47 (120)
T 3mkl_A           11 RVCTVINNNIA-HEWTLARIASELLMSPSLLKKKLREE   47 (120)
T ss_dssp             HHHHHHHTSTT-SCCCHHHHHHHTTCCHHHHHHHHHHT
T ss_pred             HHHHHHHHCCC-CCCCHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             99999986758-99999999999893999999999983


No 340
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulator; 2.05A {Bacillus subtilis} SCOP: a.4.6.2
Probab=61.42  E-value=6.5  Score=18.08  Aligned_cols=25  Identities=8%  Similarity=0.057  Sum_probs=22.2

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..|+|..++|+.+|+|..|+..+.+
T Consensus        24 ~~G~s~~eIA~~L~iS~~TV~~h~~   48 (74)
T 1fse_A           24 VQDKTTKEIASELFISEKTVRNHIS   48 (74)
T ss_dssp             TTTCCHHHHHHHHTSCHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9279999999997989999999999


No 341
>3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579}
Probab=60.59  E-value=6.7  Score=18.01  Aligned_cols=56  Identities=7%  Similarity=0.143  Sum_probs=36.5

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCC-------CCCCCCCHHHH-----HHHHHHCCCCCCCCCCC
Q ss_conf             4999889999828998798899751578-------87557798999-----99873218752100001
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKRFGIE-------GRNRWPSTESI-----FKILAATNETICQLLDL   75 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~~~~~-------g~~r~p~~~~l-----~kia~~~~v~~~~l~~~   75 (223)
                      ...|-+++|+.+||++.|+.-|++.+--       +.-|.-+.+.+     .+.+..+|.++.++...
T Consensus         3 ~~Y~Igeva~~~gvs~~TLRyYe~~GLl~P~~r~~~gyR~Yt~~dl~~l~~I~~lr~~G~sl~eIk~l   70 (146)
T 3hh0_A            3 LAWLISEFASVGDVTVRALRYYDKINLLKPSDYTEGGHRLYTKDDLYVLQQIQSFKHLGFSLGEIQNI   70 (146)
T ss_dssp             CCBCHHHHHHHHTCCHHHHHHHHHTTSSCCSEECTTSCEEBCHHHHHHHHHHHHHHHTTCCHHHHHHH
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             87739999999895988999999879989770089997226899999999999999969999999999


No 342
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium}
Probab=59.41  E-value=5.9  Score=18.35  Aligned_cols=25  Identities=12%  Similarity=0.236  Sum_probs=22.0

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      -.|+|..+.|+.+|+|+.|+..+.+
T Consensus        11 ~~G~s~~eIA~~l~iS~~TV~~h~~   35 (61)
T 2jpc_A           11 DEGYTNHGISEKLHISIKTVETHRM   35 (61)
T ss_dssp             HTSCCSHHHHHHTCSCHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             8279999999896989999999999


No 343
>1y14_A B32, RPB4, DNA-directed RNA polymerase II 32 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: a.60.8.2
Probab=58.80  E-value=8.5  Score=17.33  Aligned_cols=62  Identities=18%  Similarity=0.212  Sum_probs=36.3

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751578875577989999987321
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT   65 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~   65 (223)
                      .++.++-.+++..|++..||++.++|..+.+.|.++--.+--...-+.+ .+.+.|.+|++.+
T Consensus       119 r~k~~es~~~VreLL~~~~L~efE~a~LaNL~Pet~dEaraLiPSL~~k-~sde~Lq~ILd~L  180 (187)
T 1y14_A          119 RFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNK-ISDDELERILKEL  180 (187)
T ss_dssp             SCCSHHHHHHHHHHHHTTTCCHHHHHHHHHSCCSSHHHHHHHSGGGTTT-SCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHHHHHHCCC-CCHHHHHHHHHHH
T ss_conf             6797999999999998559989999997626999999999985740346-8989999999999


No 344
>2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor A3}
Probab=58.20  E-value=8.7  Score=17.27  Aligned_cols=26  Identities=15%  Similarity=0.351  Sum_probs=21.2

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             99889999828998798899751578
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGIE   47 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~~   47 (223)
                      +.-++||+++||+..||..|.+.+.-
T Consensus         1 MrI~elA~~~Gvs~~tLR~Ye~~GLL   26 (222)
T 2dg6_A            1 MRLADLSKRSGVSTATIKYYLREGLL   26 (222)
T ss_dssp             CCHHHHHHHHTCCHHHHHHHHHHTSS
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             95899999989599999999987997


No 345
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti}
Probab=58.09  E-value=8.7  Score=17.25  Aligned_cols=26  Identities=12%  Similarity=0.187  Sum_probs=22.4

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             64999889999828998798899751
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ..|+|..++|+.+|+|+.|+..+.+.
T Consensus        29 ~~G~s~~eIA~~l~iS~~TV~~~~~~   54 (79)
T 1x3u_A           29 VAGLPNKSIAYDLDISPRTVEVHRAN   54 (79)
T ss_dssp             TTTCCHHHHHHHTTSCHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             90799999999979889899999999


No 346
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP}
Probab=58.02  E-value=4  Score=19.47  Aligned_cols=30  Identities=30%  Similarity=0.318  Sum_probs=23.8

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999999649998899998289987988997
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|..| .+..++.++||..+|++++++++.-
T Consensus        23 Il~~L-~~~~~~v~ela~~l~~s~~tvS~HL   52 (118)
T 3f6o_A           23 VLGRL-SRGPATVSELAKPFDMALPSFMKHI   52 (118)
T ss_dssp             HHHHH-HTCCEEHHHHHTTCCSCHHHHHHHH
T ss_pred             HHHHH-HHCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999-8099479999999891999999999


No 347
>2krf_A Transcriptional regulatory protein COMA; activator, competence, DNA-binding, transcription regulation component regulatory system; NMR {Bacillus subtilis}
Probab=57.89  E-value=8.8  Score=17.23  Aligned_cols=25  Identities=20%  Similarity=0.161  Sum_probs=22.0

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..|+|..++|+.+|+|..|+..+.+
T Consensus        25 ~~G~s~~eIA~~l~iS~~TV~~~~~   49 (73)
T 2krf_A           25 EKGFTNQEIADALHLSKRSIEYSLT   49 (73)
T ss_dssp             HTTSCHHHHHHHHTCCHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9589999984161888999999999


No 348
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomics, PSI-2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A*
Probab=57.24  E-value=8.3  Score=17.40  Aligned_cols=20  Identities=20%  Similarity=0.428  Sum_probs=10.3

Q ss_pred             CCHHHHHHHHCCCHHHHHHH
Q ss_conf             99889999828998798899
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|+.+||..+|++..|+++.
T Consensus       179 ~t~~~iA~~lgisr~tvsR~  198 (237)
T 3fx3_A          179 YDKMLIAGRLGMKPESLSRA  198 (237)
T ss_dssp             SCTHHHHHHTTCCHHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHHH
T ss_conf             89999998869989999999


No 349
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A*
Probab=56.55  E-value=9.3  Score=17.09  Aligned_cols=27  Identities=7%  Similarity=-0.066  Sum_probs=20.9

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             649998899998289987988997515
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      ..|+|-.++|+++|+|..|+..+.+..
T Consensus       172 ~~G~snkeIA~~L~iS~~TVk~h~~~i  198 (225)
T 3klo_A          172 GSGASNIEIADKLFVSENTVKTHLHNV  198 (225)
T ss_dssp             TTTCCHHHHHHHTTCCHHHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             339979999999788999999999999


No 350
>1xwr_A Regulatory protein CII; all-alpha fold, DNA binding protein; 2.56A {Bacteriophage lambda} SCOP: a.35.1.9 PDB: 1zpq_A
Probab=56.52  E-value=3.5  Score=19.81  Aligned_cols=23  Identities=26%  Similarity=0.356  Sum_probs=20.5

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99988999982899879889975
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      =+.|..+|+.+|+..+.||+|+.
T Consensus        23 ~~gq~~~Ak~~G~~eS~ISRwk~   45 (97)
T 1xwr_A           23 MLGTEKTAEAVGVDKSQISRWKR   45 (97)
T ss_dssp             HHCHHHHHHHHTCCTTTHHHHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             98202079984987988633222


No 351
>1wh6_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=55.79  E-value=9.5  Score=17.01  Aligned_cols=40  Identities=10%  Similarity=0.152  Sum_probs=34.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHH-CCCHHHHHHHHH
Q ss_conf             5589999999999996499988999982-899879889975
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKR   43 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~-Gv~~~ti~~~~~   43 (223)
                      |--++|...|...+++++++|.-||+.+ |.++.+++...+
T Consensus        17 ldT~~I~~~v~~eL~~~~I~Q~~Fa~~VL~rSQGtlSdLL~   57 (101)
T 1wh6_A           17 VDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLS   57 (101)
T ss_dssp             CCHHHHHHHHHHHHHTTTCCHHHHHHHTTCCCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHH
T ss_conf             57999999999999994986999999998208378999984


No 352
>1x2l_A CUT-like 2, homeobox protein CUX-2; CUT domain, human homeobox protein CUX-2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=55.72  E-value=9.5  Score=17.00  Aligned_cols=58  Identities=16%  Similarity=0.118  Sum_probs=41.6

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHH-CCCHHHHHHHHHCCCCCCC-CCC---CHHHHHHHHHHCC
Q ss_conf             89999999999996499988999982-8998798899751578875-577---9899999873218
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKRFGIEGRN-RWP---STESIFKILAATN   66 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~-Gv~~~ti~~~~~~~~~g~~-r~p---~~~~l~kia~~~~   66 (223)
                      -++|...|...+++++++|.-||+.+ |.++.+++...+.   .|| ...   ..+...++.+-++
T Consensus        19 T~~I~~~v~~eL~~~~I~Q~~Fa~~VL~rsQGtlSdLL~~---PKPW~kl~~~gR~~y~RM~~wL~   81 (101)
T 1x2l_A           19 TAEIAFQVKEQLLKHNIGQRVFGHYVLGLSQGSVSEILAR---PKPWRKLTVKGKEPFIKMKQFLS   81 (101)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHTTCSCHHHHHHHHHC---CCCGGGCCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHHC---CCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999949859999999981085889999838---99927766888899999999854


No 353
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged helix, DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64
Probab=54.31  E-value=10  Score=16.86  Aligned_cols=26  Identities=15%  Similarity=0.241  Sum_probs=22.1

Q ss_pred             HHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99964999889999828998798899
Q gi|254780444|r   16 MAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        16 l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ++.+.-.|.++||+.+|++++++++.
T Consensus        23 ~L~~~~~~~~ela~~l~is~~~v~~H   48 (202)
T 2p4w_A           23 LLTKRPYFVSELSRELGVGQKAVLEH   48 (202)
T ss_dssp             HHHHSCEEHHHHHHHHTCCHHHHHHH
T ss_pred             HHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99739998999999989099899999


No 354
>3hou_D DNA-directed RNA polymerase II subunit RPB4; RNA polymerase II, metal-binding, transcription bubble; HET: BRU; 3.20A {Saccharomyces cerevisiae} PDB: 1nt9_D 1y1w_D 1y1y_D 1y77_D* 2b63_D* 2b8k_D 2ja5_D* 2ja6_D* 2ja7_D* 2ja8_D* 2r7z_D 2r92_D 2r93_D 1y1v_D* 3fki_D 3h3v_E 2vum_D* 3hov_D* 3how_D* 3hox_D* ...
Probab=54.08  E-value=10  Score=16.83  Aligned_cols=62  Identities=18%  Similarity=0.212  Sum_probs=37.0

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751578875577989999987321
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT   65 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~   65 (223)
                      .++.++-.+++..|++..||++.+.|..+.+-|.++--.+--...-+.+ .+.+.|.+|++.+
T Consensus       153 k~k~~esv~~VreLL~~~~L~efE~aqLaNL~Pet~dEaraLIPSL~~k-~sdEeLe~ILd~L  214 (221)
T 3hou_D          153 RFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNK-ISDDELERILKEL  214 (221)
T ss_dssp             SCCCHHHHHHHHHHHTTSCCCHHHHHHHHHSCCCSHHHHHHHCTTCTTS-SCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCHHHHHHHHHHHCCC-CCHHHHHHHHHHH
T ss_conf             6898999999999997659989999995327989999999986651257-9999999999999


No 355
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A
Probab=53.46  E-value=9.3  Score=17.07  Aligned_cols=26  Identities=12%  Similarity=0.164  Sum_probs=21.9

Q ss_pred             HHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             99649998899998289987988997
Q gi|254780444|r   17 AERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        17 ~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.....+.++||..+|++++++++.-
T Consensus        34 L~~~~~~v~eLa~~l~is~s~vS~HL   59 (108)
T 2kko_A           34 LAQGERAVEAIATATGMNLTTASANL   59 (108)
T ss_dssp             HTTCCEEHHHHHHHHTCCHHHHHHHH
T ss_pred             HHCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             98099579999999890988899999


No 356
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2
Probab=53.43  E-value=10  Score=16.77  Aligned_cols=26  Identities=12%  Similarity=0.165  Sum_probs=22.4

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             64999889999828998798899751
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ..|+|..++|+.+|++..|+..+.+.
T Consensus        47 ~~G~s~~eIA~~l~iS~~TV~~~~~~   72 (99)
T 1p4w_A           47 AEGFLVTEIAKKLNRSIKTISSQKKS   72 (99)
T ss_dssp             HHTCCHHHHHHHHTSCHHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             93899999977729989999999999


No 357
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Rhodococcus SP}
Probab=53.15  E-value=4.7  Score=19.01  Aligned_cols=30  Identities=20%  Similarity=0.174  Sum_probs=23.9

Q ss_pred             HHHHHH-HCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             999999-649998899998289987988997
Q gi|254780444|r   13 IDRMAE-RHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        13 i~~l~~-~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      |+.+.+ ..++|.++||+.+|++++|+.++-
T Consensus        27 Le~la~~~~~lsl~eia~~l~l~kst~~RlL   57 (265)
T 2ia2_A           27 IRCFDHRNQRRTLSDVARATDLTRATARRFL   57 (265)
T ss_dssp             HHTCCSSCSSEEHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9999737999799999999794999999999


No 358
>2fmy_A COOA, carbon monoxide oxidation system transcription regulator COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A*
Probab=53.02  E-value=11  Score=16.73  Aligned_cols=21  Identities=14%  Similarity=0.128  Sum_probs=13.3

Q ss_pred             CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999889999828998798899
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .+|+.+||..+|+++.|+++.
T Consensus       167 ~lt~~~lA~~lg~sr~tvsr~  187 (220)
T 2fmy_A          167 GLNTEEIALMLGTTRQTVSVL  187 (220)
T ss_dssp             SSCHHHHHHHHTSCHHHHHHH
T ss_pred             CCHHHHHHHHHCCCHHHHHHH
T ss_conf             724999999979999999999


No 359
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A
Probab=52.97  E-value=11  Score=16.72  Aligned_cols=36  Identities=14%  Similarity=0.031  Sum_probs=24.6

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +|+.+. ..|..+. +.++|+++||+++|++++++++.
T Consensus        35 lt~~q~-~vL~~i~-~~~~t~~ela~~~~i~~~~vs~~   70 (146)
T 2gxg_A           35 LSYLDF-LVLRATS-DGPKTMAYLANRYFVTQSAITAS   70 (146)
T ss_dssp             CCHHHH-HHHHHHT-TSCBCHHHHHHHTTCCHHHHHHH
T ss_pred             CCHHHH-HHHHHHH-CCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             799999-9999998-59919999999989798699999


No 360
>1xd7_A YWNA; structural genomics, protein structure initiative, winged helix DNA binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55
Probab=52.83  E-value=11  Score=16.71  Aligned_cols=41  Identities=7%  Similarity=0.177  Sum_probs=29.6

Q ss_pred             CCCCCHHH-H-HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             97755899-9-99999999964999889999828998798899
Q gi|254780444|r    1 MTSFSHKK-I-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~-i-~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |.|+|-.- + ..++--|..+..+|-.++|+..|++++.+.+.
T Consensus         1 m~mis~r~~~Av~~L~~La~~~~~ss~~IAe~~~i~~~~l~kI   43 (145)
T 1xd7_A            1 MSLINSRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRM   43 (145)
T ss_dssp             -----CHHHHHHHHHHHHHTCSCCCHHHHHHHHTSCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9642279999999999986499989999998889199999999


No 361
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6
Probab=51.98  E-value=11  Score=16.62  Aligned_cols=37  Identities=5%  Similarity=0.186  Sum_probs=29.7

Q ss_pred             CHHHHHHHHHHHHHHCC------C-CHHHHHHHHCCCHHHHHHH
Q ss_conf             58999999999999649------9-9889999828998798899
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN------L-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g------l-s~~~lA~~~Gv~~~ti~~~   41 (223)
                      ..++|.+.|.+.+..-.      | |..+||+..|+|.+|+.+-
T Consensus        12 ~y~qi~~~i~~~I~~G~~~pG~~LPser~La~~~~vSr~tvr~A   55 (102)
T 1v4r_A           12 GYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRA   55 (102)
T ss_dssp             CHHHHHHHHHHHTTTTSCCTTSBCCCHHHHHHHSSSCTTHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999999998599999399837999999979877999999


No 362
>2l01_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Bacteroides vulgatus}
Probab=51.40  E-value=7.8  Score=17.56  Aligned_cols=33  Identities=18%  Similarity=0.162  Sum_probs=22.8

Q ss_pred             CCCCCHHHHHH---HHHHHHHH-CCCCHHHHHHHHCCC
Q ss_conf             97755899999---99999996-499988999982899
Q gi|254780444|r    1 MTSFSHKKIWE---AIDRMAER-HNLTPSGLARKAGLD   34 (223)
Q Consensus         1 ~~~~~~~~i~~---~i~~l~~~-~gls~~~lA~~~Gv~   34 (223)
                      |+|.+++ |+.   .|..++.+ .++|.++|.+++|++
T Consensus         1 ~kM~k~~-IG~nAG~IW~~L~e~~~~s~~eLkk~t~l~   37 (77)
T 2l01_A            1 MKMLKEK-AGALAGQIWEALNGTEGLTQKQIKKATKLK   37 (77)
T ss_dssp             CCCHHHH-HHHHHHHHHHHHTTSSCEEHHHHHHHHTCS
T ss_pred             CCCHHHH-HHHHHHHHHHHHCCCCCCCHHHHHHHHCCC
T ss_conf             9660899-988899999986558879699999997899


No 363
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C*
Probab=51.09  E-value=11  Score=16.53  Aligned_cols=39  Identities=8%  Similarity=0.144  Sum_probs=29.3

Q ss_pred             CHHHHHHHHHHHHHHCCC-CHHHHHHHH-----CCCHHHHHHHHH
Q ss_conf             589999999999996499-988999982-----899879889975
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL-TPSGLARKA-----GLDPTSFNKSKR   43 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl-s~~~lA~~~-----Gv~~~ti~~~~~   43 (223)
                      +..+=.+.|..|.++..+ ||.+|...+     -++++|+|+--+
T Consensus         2 ~K~~Rq~~I~~li~~~~i~sQ~eL~~~L~~~Gi~vTQaTlSRDL~   46 (64)
T 2p5k_A            2 NKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIK   46 (64)
T ss_dssp             CHHHHHHHHHHHHHHSCCCSHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEHHHHHHHHH
T ss_conf             889999999999985897889999999998598363899898899


No 364
>1wh8_A CUT-like 2, homeobox protein CUX-2; CUT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Homo sapiens} SCOP: a.35.1.7
Probab=50.21  E-value=12  Score=16.44  Aligned_cols=38  Identities=16%  Similarity=0.149  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHH-CCCHHHHHHHHH
Q ss_conf             89999999999996499988999982-899879889975
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKR   43 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~-Gv~~~ti~~~~~   43 (223)
                      -.+|...|...+++++++|.-||+.+ |.++.+++...+
T Consensus        29 T~~Ia~~v~~~L~~~~IsQ~~Fak~VL~rSQGtlSdLL~   67 (111)
T 1wh8_A           29 TYSITKRVKEVLTDNNLGQRLFGESILGLTQGSVSDLLS   67 (111)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHHTTCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHH
T ss_conf             999999999999985852999999998008478999983


No 365
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP}
Probab=50.06  E-value=6.8  Score=17.94  Aligned_cols=28  Identities=11%  Similarity=0.132  Sum_probs=23.1

Q ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999964999889999828998798899
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..| .+..++.++||+.+|++++++++.
T Consensus        64 L~~L-~~g~~tv~eLa~~l~is~stvS~H   91 (151)
T 3f6v_A           64 VQLL-TSGEQTVNNLAAHFPASRSAISQH   91 (151)
T ss_dssp             HHHG-GGCCEEHHHHHTTSSSCHHHHHHH
T ss_pred             HHHH-HHCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999-809938999999989199999999


No 366
>2kfs_A Conserved hypothetical regulatory protein; WHTH, DNA binding, phosphorylation, DNA-binding protein; NMR {Mycobacterium tuberculosis}
Probab=49.82  E-value=8.7  Score=17.27  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=20.7

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             998899998289987988997515
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +|..+.|+.+|++.+++.++.+..
T Consensus        32 lt~~evA~~LGvs~~~V~~~i~~~   55 (148)
T 2kfs_A           32 YDLPRVAELLGVPVSKVAQQLREG   55 (148)
T ss_dssp             EEHHHHHHHHTCCHHHHHHHHHTT
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCC
T ss_conf             489999999699889999999869


No 367
>3isp_A HTH-type transcriptional regulator RV1985C/MT2039; ROD shaped structure, DNA binding domain, regulatory domain, DNA-binding; 2.70A {Mycobacterium tuberculosis}
Probab=49.79  E-value=12  Score=16.40  Aligned_cols=31  Identities=13%  Similarity=0.197  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999964999889999828998798899
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      -++++.+..+..  |-++-|+++|++++++|+-
T Consensus        10 ~L~~f~av~~~g--S~s~AA~~L~isq~avS~~   40 (303)
T 3isp_A           10 QLAALAAVVELG--SFDAAAERLHVTPSAVSQR   40 (303)
T ss_dssp             HHHHHHHHHHHT--CHHHHHTTTTCCHHHHHHH
T ss_pred             HHHHHHHHHHHC--CHHHHHHHHCCCHHHHHHH
T ss_conf             999999999819--9999999978798999999


No 368
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua}
Probab=49.66  E-value=12  Score=16.39  Aligned_cols=37  Identities=5%  Similarity=0.046  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999999649998899998289987988997515
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +|.+.|+.=.. ..+|..++|+.+|+++.++++..+..
T Consensus         9 ~v~~~i~~~~~-~~~sl~~la~~~~~s~~~l~r~fk~~   45 (108)
T 3oou_A            9 NVLSYITEHFS-EGMSLKTLGNDFHINAVYLGQLFQKE   45 (108)
T ss_dssp             HHHHHHHHHTT-SCCCHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999998558-99999999999892999999999999


No 369
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2
Probab=49.48  E-value=12  Score=16.37  Aligned_cols=45  Identities=7%  Similarity=0.077  Sum_probs=28.1

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHCC
Q ss_conf             99988999982899879889975157887557-79899999873218
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAATN   66 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~-p~~~~l~kia~~~~   66 (223)
                      ..|..++|+..|+|..-+.+.++..-. |.|. ...+.|..+++.++
T Consensus        38 ~~Tl~eI~~~lgiSreRVRQie~~Al~-kLr~~~~~~~L~~yl~~~~   83 (87)
T 1tty_A           38 PKTLEEVGQYFNVTRERIRQIEVKALR-KLRHPSRSKYLKSLLSLMD   83 (87)
T ss_dssp             CCCHHHHHHHHTCCHHHHHHHHHHHHH-HHBTTBSSHHHHHHHHHTT
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHH-HHHCCHHHHHHHHHHHHHC
T ss_conf             657999998959889999999999999-9867078899999998634


No 370
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus}
Probab=49.39  E-value=10  Score=16.78  Aligned_cols=25  Identities=4%  Similarity=0.074  Sum_probs=22.1

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             6499988999982899879889975
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..|+|..++|+.+++++.||..+.+
T Consensus        42 ~~G~s~~eIA~~L~iS~~TV~~~~~   66 (91)
T 2rnj_A           42 AKGYSNQEIASASHITIKTVKTHVS   66 (91)
T ss_dssp             HTTCCTTHHHHHHTCCHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9289999999997889999999999


No 371
>1b9m_A Protein (mode); DNA-binding, gene regulation, winged helix turn helix, molybdate, OB fold, transcription; 1.75A {Escherichia coli} SCOP: a.4.5.8 b.40.6.2 b.40.6.2 PDB: 1b9n_A 1o7l_A 1h9s_A 1h9r_A 1h9s_B
Probab=49.36  E-value=12  Score=16.36  Aligned_cols=32  Identities=19%  Similarity=0.129  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999999964999889999828998798899
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +-.+.+.+.++. | |-++-|+++|+||+++|+.
T Consensus        23 r~l~~~~av~~~-g-S~t~AA~~L~iSq~avS~~   54 (265)
T 1b9m_A           23 RRISLLKHIALS-G-SISQGAKDAGISYKSAWDA   54 (265)
T ss_dssp             HHHHHHHHHHHH-S-SHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHH-C-CHHHHHHHHCCCHHHHHHH
T ss_conf             999999999997-9-9999999979899999999


No 372
>3bwg_A Uncharacterized HTH-type transcriptional regulator YYDK; APC85486, structural genomics, PSI-2, protein structure initiative; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2
Probab=49.25  E-value=12  Score=16.35  Aligned_cols=40  Identities=20%  Similarity=0.269  Sum_probs=32.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCC-------CHHHHHHHHCCCHHHHHHH
Q ss_conf             775589999999999996499-------9889999828998798899
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNL-------TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gl-------s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|...++|...|...+....+       |-.+||+..|||..|+.+.
T Consensus         3 ~~~ky~qI~~~l~~~I~~g~~~~G~kLPsE~~La~~~~VSR~TvR~A   49 (239)
T 3bwg_A            3 AMLKYQQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKS   49 (239)
T ss_dssp             -----CHHHHHHHHHHHHTTCCTTCBCCCHHHHHHHTTCCHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             76799999999999997499999199916999999989599999999


No 373
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3
Probab=49.22  E-value=12  Score=16.34  Aligned_cols=28  Identities=7%  Similarity=0.036  Sum_probs=23.5

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999649998899998289987988997
Q gi|254780444|r   15 RMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        15 ~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|.--.|+|.+++|..+|+|.+++...-
T Consensus        35 ~l~~~e~ls~~EIA~~lgiS~~aV~~~l   62 (113)
T 1xsv_A           35 ELFYLEDYSLSEIADTFNVSRQAVYDNI   62 (113)
T ss_dssp             HHHHTSCCCHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             9999919999999999896999999999


No 374
>3hhg_A Transcriptional regulator, LYSR family; transcription factor, structural genomics, oxford protein production facility, OPPF; 3.20A {Neisseria meningitidis serogroup B}
Probab=48.89  E-value=12  Score=16.31  Aligned_cols=32  Identities=9%  Similarity=0.110  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999999964999889999828998798899
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +-++...++++. | |-+.-|++++++|+++|+-
T Consensus         6 ~qL~~F~~v~e~-g-s~s~AA~~L~vsQpavS~~   37 (306)
T 3hhg_A            6 EELTVFVQVVES-G-SFSRAAEQLAMANSAVSRI   37 (306)
T ss_dssp             HHHHHHHHHHHS-S-SHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHC-C-CHHHHHHHHCCCHHHHHHH
T ss_conf             999999999981-9-9999999988798999999


No 375
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D
Probab=48.58  E-value=12  Score=16.28  Aligned_cols=29  Identities=7%  Similarity=0.127  Sum_probs=20.3

Q ss_pred             HHHHHHHC--CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999964--999889999828998798899
Q gi|254780444|r   13 IDRMAERH--NLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        13 i~~l~~~~--gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |..|....  ++|+++||+..+++++++++.
T Consensus        43 L~~l~~~~~~~~t~~ela~~l~~~~~~vs~~   73 (127)
T 2frh_A           43 LTYISENKEKEYYLKDIINHLNYKQPQVVKA   73 (127)
T ss_dssp             HHHHHHTCCSEEEHHHHHHHSSSHHHHHHHH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999828999878999999979887369999


No 376
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative stress, transcription regulation; 2.35A {Mycobacterium tuberculosis}
Probab=48.18  E-value=13  Score=16.24  Aligned_cols=44  Identities=9%  Similarity=0.131  Sum_probs=30.3

Q ss_pred             HHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             99964999889999828998798899751578875577989999987321875
Q gi|254780444|r   16 MAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET   68 (223)
Q Consensus        16 l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~   68 (223)
                      |.-=.|+|..++|..+|++..++.......         ...|.+.++-.|++
T Consensus        48 l~~~~g~s~~eIA~~lgis~~tV~~~l~Ra---------~~~Lr~~l~~~G~~   91 (92)
T 3hug_A           48 RSYYRGWSTAQIATDLGIAEGTVKSRLHYA---------VRALRLTLQELGVT   91 (92)
T ss_dssp             HHHTSCCCHHHHHHHHTSCHHHHHHHHHHH---------HHHHHHHHHHHTSC
T ss_pred             HHHHCCCCHHHHHHHHCCCHHHHHHHHHHH---------HHHHHHHHHHHCCC
T ss_conf             999939999999999896999999999999---------99999999983899


No 377
>1zvp_A Hypothetical protein VC0802; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Vibrio cholerae} SCOP: d.58.18.9 d.58.18.9
Probab=47.97  E-value=10  Score=16.78  Aligned_cols=15  Identities=33%  Similarity=0.434  Sum_probs=9.8

Q ss_pred             CCCCCCCCCCEEEEE
Q ss_conf             324214878689993
Q gi|254780444|r  146 SMLPLYRKGDILILN  160 (223)
Q Consensus       146 SM~P~i~~Gd~vlVd  160 (223)
                      +|.|.+.+|+++++.
T Consensus        14 ~m~p~L~~g~yvf~~   28 (133)
T 1zvp_A           14 SMSPELMAGDYVFCT   28 (133)
T ss_dssp             TCEEEECSSCEEEEE
T ss_pred             CCCEEECCCCEEEEE
T ss_conf             099888898489999


No 378
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, cytoplasm, binding, transcription; HET: PAM; 1.90A {Vibrio cholerae O395}
Probab=47.78  E-value=13  Score=16.20  Aligned_cols=23  Identities=9%  Similarity=0.039  Sum_probs=13.1

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99988999982899879889975
Q gi|254780444|r   21 NLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        21 gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .+|..++|+.+|+|+.++++..+
T Consensus       185 ~~~l~~lA~~~~~S~~~l~r~fK  207 (276)
T 3gbg_A          185 NWRWADICGELRTNRMILKKELE  207 (276)
T ss_dssp             CCCHHHHHHHHTCCHHHHHHHHH
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             99999999997989999999999


No 379
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7
Probab=47.10  E-value=7.7  Score=17.61  Aligned_cols=23  Identities=9%  Similarity=0.007  Sum_probs=19.9

Q ss_pred             CCCCHHHHHHHH------CCCHHHHHHHH
Q ss_conf             499988999982------89987988997
Q gi|254780444|r   20 HNLTPSGLARKA------GLDPTSFNKSK   42 (223)
Q Consensus        20 ~gls~~~lA~~~------Gv~~~ti~~~~   42 (223)
                      .+++|++||+..      .|+++||+++.
T Consensus        29 ~~~~Q~~la~wf~~~fg~~Is~STvs~IL   57 (144)
T 1iuf_A           29 NRSGQQDLIEWFREKFGKDISQPSVSQIL   57 (144)
T ss_dssp             SCCCHHHHHHHHHHHHSSCCSSSSTTHHH
T ss_pred             CCCCHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             98779999999999987998698999999


No 380
>2k5j_A Uncharacterized protein YIIF; structure, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri 5 str}
Probab=43.78  E-value=15  Score=15.81  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9999999999996499988999982
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      ++-.++|++|.+..|.|+++|=|.+
T Consensus        18 ee~~~~Ld~la~~~~~sRaelIReA   42 (80)
T 2k5j_A           18 NEVIKQLDDLEVQRNLPRADLLREA   42 (80)
T ss_dssp             HHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             9999999999987399999999999


No 381
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 2.20A {Oenococcus oeni psu-1}
Probab=43.76  E-value=15  Score=15.81  Aligned_cols=36  Identities=14%  Similarity=0.197  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHHHCCC-------CHHHHHHHHCCCHHHHHHH
Q ss_conf             89999999999996499-------9889999828998798899
Q gi|254780444|r    6 HKKIWEAIDRMAERHNL-------TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gl-------s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .++|...|........|       |..+||...|+|++|+.+.
T Consensus        13 y~qi~~~i~~~I~~g~l~~G~~LPser~La~~~~vSr~tVr~A   55 (126)
T 3by6_A           13 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKA   55 (126)
T ss_dssp             HHHHHHHHHHHHHTTSSCTTCEECCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999999998599999299904999999979898999999


No 382
>2gqq_A Leucine-responsive regulatory protein; helix-turn-helix, transcription; 3.20A {Escherichia coli}
Probab=43.53  E-value=2.7  Score=20.60  Aligned_cols=29  Identities=17%  Similarity=0.440  Sum_probs=24.1

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             99999996499988999982899879889
Q gi|254780444|r   12 AIDRMAERHNLTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        12 ~i~~l~~~~gls~~~lA~~~Gv~~~ti~~   40 (223)
                      -|+.|.+....|.++||+++|++++|+.+
T Consensus        18 Il~~L~~d~R~s~~~IA~~lg~S~~tV~~   46 (163)
T 2gqq_A           18 ILNELQKDGRISNVELSKRVGLSPTPCLE   46 (163)
T ss_dssp             HHHHHHHCSSCCTTGGGTSSSCCTTTSSS
T ss_pred             HHHHHHHCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             99999985899999999998909999999


No 383
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn- helix motif; 3.00A {Mycobacterium tuberculosis H37RV}
Probab=43.46  E-value=15  Score=15.78  Aligned_cols=27  Identities=11%  Similarity=0.081  Sum_probs=22.6

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             999964999889999828998798899
Q gi|254780444|r   15 RMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        15 ~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .|+--.|+|..++|+.+|++++|+...
T Consensus        25 ~l~~~~g~s~~EIA~~lgis~~tvk~~   51 (70)
T 2o8x_A           25 LLTQLLGLSYADAAAVCGCPVGTIRSR   51 (70)
T ss_dssp             HHHHTSCCCHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             989990999999999989799999999


No 384
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- plasmid, transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A
Probab=43.29  E-value=15  Score=15.76  Aligned_cols=35  Identities=11%  Similarity=0.160  Sum_probs=24.3

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             55899999999999964999889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      |.-+++ +.+-.+.+. | |-+..|++++++|+++++.
T Consensus         2 m~~~~L-~~f~~v~~~-~-s~~~AA~~L~isq~avS~~   36 (305)
T 3fxq_A            2 LKLQTL-QALICIEEV-G-SLRAAAQLLHLSQPALSAA   36 (305)
T ss_dssp             CHHHHH-HHHHHHHHH-S-CHHHHHHHTTCCHHHHHHH
T ss_pred             CCHHHH-HHHHHHHHH-C-CHHHHHHHHCCCHHHHHHH
T ss_conf             988999-999999983-9-9999999988888999999


No 385
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural genomics, PSI-2, protein structure initiative; 2.09A {Listeria innocua}
Probab=42.82  E-value=15  Score=15.71  Aligned_cols=36  Identities=14%  Similarity=0.163  Sum_probs=29.9

Q ss_pred             HHHHHHHHHHHHHHCCC-------CHHHHHHHHCCCHHHHHHH
Q ss_conf             89999999999996499-------9889999828998798899
Q gi|254780444|r    6 HKKIWEAIDRMAERHNL-------TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gl-------s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .++|...|.+.+..-.+       |-.+||+..|||.+|+.+.
T Consensus        11 Y~qi~~~i~~~I~~G~~~~G~~LPsE~eLa~~~~VSr~TvR~A   53 (236)
T 3edp_A           11 FEVIASKIKDSINRDEYKTGMLMPNETALQEIYSSSRTTIRRA   53 (236)
T ss_dssp             HHHHHHHHHHHHHTTSSCCCC--CCHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999999998199999199927999999979599999999


No 386
>1zav_U 50S ribosomal protein L7/L12; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: a.108.1.1 PDB: 1zaw_U 1zax_U 1dd3_C
Probab=42.33  E-value=13  Score=16.13  Aligned_cols=22  Identities=41%  Similarity=0.472  Sum_probs=17.4

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             5589999999999996499988999982
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      +|-++|.+||+.      ||.++||..+
T Consensus         1 m~~eeiv~aiek------ltvaelaelv   22 (30)
T 1zav_U            1 MTIDEIIEAIEK------LTVSELAELV   22 (30)
T ss_dssp             CCHHHHHHHHHH------SBHHHHHHHH
T ss_pred             CCHHHHHHHHHH------HHHHHHHHHH
T ss_conf             979999999999------6199999999


No 387
>2wv0_A YVOA, HTH-type transcriptional repressor YVOA; DNA-binding, transcription regulation, transcriptional regulator, GNTR/HUTC family; 2.40A {Bacillus subtilis}
Probab=41.47  E-value=16  Score=15.58  Aligned_cols=37  Identities=14%  Similarity=0.209  Sum_probs=30.5

Q ss_pred             CHHHHHHHHHHHHHHCCC-------CHHHHHHHHCCCHHHHHHH
Q ss_conf             589999999999996499-------9889999828998798899
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL-------TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl-------s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .+++|.+.|......-.|       |..+||+..|||.+|+.+.
T Consensus        11 ~y~~i~~~i~~~I~~G~~~~G~~LPse~~La~~~~VSr~TVR~A   54 (243)
T 2wv0_A           11 IYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQA   54 (243)
T ss_dssp             HHHHHHHHHHHHHHHTSSCTTCBCCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             89999999999998399999399937999999979699999999


No 388
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP}
Probab=40.98  E-value=16  Score=15.53  Aligned_cols=10  Identities=20%  Similarity=0.335  Sum_probs=3.7

Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999999
Q gi|254780444|r    9 IWEAIDRMAE   18 (223)
Q Consensus         9 i~~~i~~l~~   18 (223)
                      +..-|+++..
T Consensus         7 l~~li~~l~~   16 (236)
T 2q0o_A            7 LRSLIDMLEA   16 (236)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
T ss_conf             9999999984


No 389
>1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, multidrug-binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3d71_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A*
Probab=40.79  E-value=11  Score=16.61  Aligned_cols=58  Identities=5%  Similarity=0.016  Sum_probs=36.1

Q ss_pred             HHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCC--CC------------CCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9964999889999828998798899751578875--57------------79899999873218752100001
Q gi|254780444|r   17 AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRN--RW------------PSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus        17 ~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~--r~------------p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      |++.=.|-+++|+.+|+|..|+..|.+.+-- +|  +.            ...-...+.+..+|.++.+....
T Consensus         1 m~~~~ysIge~akl~giS~~tLRyYd~~GLl-~P~~~d~~ngYRyYs~~qi~~l~~I~~lr~lg~sL~eIk~~   72 (278)
T 1r8e_A            1 MKESYYSIGEVSKLANVSIKALRYYDKIDLF-KPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKA   72 (278)
T ss_dssp             --CCEEEHHHHHHHHTCCHHHHHHHHHTTSS-CCSEECTTTCCEEEETGGGGHHHHHHHHHHTTCCHHHHHHH
T ss_pred             CCCCCEEHHHHHHHHCCCHHHHHHHHHCCCC-CCCCCCCCCCCEECCHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             9988631999999988598899999968898-99788799997773999999999999999869989999999


No 390
>3ezq_A Tumor necrosis factor receptor superfamily member 6; apoptosis, DISC, FAS, membrane,receptor, transmembrane; 2.73A {Homo sapiens} PDB: 1ddf_A
Probab=39.75  E-value=17  Score=15.41  Aligned_cols=42  Identities=21%  Similarity=0.318  Sum_probs=33.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCC-HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             55899999999999964999-8899998289987988997515
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls-~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      |+-.++-+.++.++++.+.+ =..|||++|++.+.|...+...
T Consensus         2 l~d~dl~~~~~~ia~~l~~~dwk~l~r~LGls~~~I~~I~~~~   44 (115)
T 3ezq_A            2 LSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDN   44 (115)
T ss_dssp             CHHHHHHHHHHHHHHTSCHHHHHHHHHHTTCCHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHC
T ss_conf             4152099999999987799989999999398999999999878


No 391
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3
Probab=39.30  E-value=17  Score=15.37  Aligned_cols=42  Identities=17%  Similarity=0.057  Sum_probs=29.4

Q ss_pred             CC-CCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             49-9988999982899879889975157887557798999998
Q gi|254780444|r   20 HN-LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI   61 (223)
Q Consensus        20 ~g-ls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~ki   61 (223)
                      .| +|.++++++-|++++.+..|.+....+-......-.+.+.
T Consensus        48 ~G~~S~~EAcrrY~LS~eEf~~W~~a~~~hGe~aLRatr~q~y   90 (101)
T 2oa4_A           48 YGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTALKKY   90 (101)
T ss_dssp             HTTCCHHHHHHTTCSSHHHHHHHHHHHHCCCSSSSCCHHHHHH
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             3845799999883999999999999999984999988278999


No 392
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A*
Probab=39.26  E-value=17  Score=15.36  Aligned_cols=12  Identities=8%  Similarity=0.365  Sum_probs=4.4

Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999996499
Q gi|254780444|r   11 EAIDRMAERHNL   22 (223)
Q Consensus        11 ~~i~~l~~~~gl   22 (223)
                      ++++.+.+..|.
T Consensus        23 ~~l~~~~~~~Gf   34 (234)
T 1l3l_A           23 TGLADIADHFGF   34 (234)
T ss_dssp             HHHHHHHHHTTC
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999997799


No 393
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research, nysgxrc; 2.33A {Bacteroides vulgatus atcc 8482}
Probab=39.22  E-value=17  Score=15.36  Aligned_cols=31  Identities=10%  Similarity=0.116  Sum_probs=23.8

Q ss_pred             HHHHHH-CCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             999996-4999889999828998798899751
Q gi|254780444|r   14 DRMAER-HNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        14 ~~l~~~-~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.|.+. .++|.++||+++|+++..+.+|-+.
T Consensus        42 d~L~~~~~~~t~~eLa~~~g~~~~~l~rlL~~   73 (363)
T 3dp7_A           42 QLLSGKREGYTLQEISGRTGLTRYAAQVLLEA   73 (363)
T ss_dssp             HHHHTCTTCBCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             89741899989999998879099999999999


No 394
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A
Probab=39.00  E-value=17  Score=15.34  Aligned_cols=37  Identities=11%  Similarity=0.222  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHH--CCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999996--49998899998289987988997515
Q gi|254780444|r    9 IWEAIDRMAER--HNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         9 i~~~i~~l~~~--~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      |-..|+-+.+.  ..+|..+||+.+|+|+.++++..+..
T Consensus        13 i~~i~~~i~~~~~~~~sl~~lA~~~~~S~~~l~r~fk~~   51 (129)
T 1bl0_A           13 IHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKE   51 (129)
T ss_dssp             HHHHHHHHHTTTTSCCCCHHHHHHSSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             999999999824899999999999892999999999998


No 395
>2ezk_A Transposase; DNA-binding protein, transposition, transposable element; NMR {Enterobacteria phage MU} SCOP: a.4.1.2 PDB: 2ezl_A
Probab=38.93  E-value=17  Score=15.33  Aligned_cols=53  Identities=8%  Similarity=0.085  Sum_probs=35.2

Q ss_pred             HHHHHHHHHHHCCCCHH----HHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             99999999996499988----99998289987988997515788755779899999873218
Q gi|254780444|r    9 IWEAIDRMAERHNLTPS----GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN   66 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~----~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~   66 (223)
                      ++.++..| .+.|++..    ..|...|++..|+.+|..... |   .|..+-|.-+++-.+
T Consensus        38 ~l~~V~~L-~~~G~~~~~A~~~vA~~~~vs~~TL~nW~~~V~-g---~~r~DWLpaL~~~~g   94 (99)
T 2ezk_A           38 AVQAADEM-LNQGISTKTAFATVAGHYQVSASTLRDKYYQVQ-K---FAKPDWAAALVDGRG   94 (99)
T ss_dssp             HHHHHHHH-HHTTCCHHHHHHHHHHHSCSCHHHHHHHHHHHH-T---SCHHHHHHHHHSCC-
T ss_pred             HHHHHHHH-HHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHC-C---CCHHHHHHHHCCCCC
T ss_conf             99999999-985995899999999996988999999999968-9---988887998734632


No 396
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural genomics, DNA-binding protein, PSI-2; 2.30A {Agrobacterium tumefaciens str}
Probab=38.87  E-value=17  Score=15.32  Aligned_cols=37  Identities=5%  Similarity=-0.080  Sum_probs=26.7

Q ss_pred             HHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             964999889999828998798899751578875577989999987321875210
Q gi|254780444|r   18 ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus        18 ~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~   71 (223)
                      .+.| |-+..|+.+|++++++++.                +.++-+.+|+.+-.
T Consensus        36 ~~~G-Sit~AA~~L~iSq~avs~~----------------i~~LE~~lg~~Lf~   72 (135)
T 2ijl_A           36 AETG-SISAAGRAMDMSYRRAWLL----------------VDALNHMFRQPVIC   72 (135)
T ss_dssp             HHHS-CHHHHHHHTTCCHHHHHHH----------------HHHHHHHBSSCSEE
T ss_pred             HHHC-CHHHHHHHHCCCHHHHHHH----------------HHHHHHHHCCEEEE
T ss_conf             9969-9999999978898899999----------------99999982985799


No 397
>3lap_A Arginine repressor; arginine repressor, DNA binding, DNA-canavanine ternary complex; HET: GGB; 2.15A {Mycobacterium tuberculosis} PDB: 3fhz_A* 3ere_D* 3laj_A*
Probab=37.74  E-value=18  Score=15.21  Aligned_cols=34  Identities=9%  Similarity=0.127  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHCCC-CHHHHHHHHC-----CCHHHHHHHHH
Q ss_conf             9999999996499-9889999828-----99879889975
Q gi|254780444|r   10 WEAIDRMAERHNL-TPSGLARKAG-----LDPTSFNKSKR   43 (223)
Q Consensus        10 ~~~i~~l~~~~gl-s~~~lA~~~G-----v~~~ti~~~~~   43 (223)
                      .+.|.+|.++..+ ||.+|.+.+-     ++|+|+|+--+
T Consensus        22 q~~I~~lI~~~~I~tQeeL~~~L~~~Gi~vTQATiSRDlk   61 (170)
T 3lap_A           22 QARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLE   61 (170)
T ss_dssp             HHHHHHHHHHSCCCSHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEHHHHHHHHH
T ss_conf             9999999985897899999999997598541899898899


No 398
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid}
Probab=37.06  E-value=19  Score=15.14  Aligned_cols=37  Identities=14%  Similarity=0.203  Sum_probs=28.0

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      +.+++.+-...|. +.|.|-.++|..+|++-..+.+|.
T Consensus        16 seDD~~sv~hELa-~~gysvqqIa~~LGVsvrKv~~YL   52 (55)
T 2x48_A           16 SEDDLVSVAHELA-KMGYTVQQIANALGVSERKVRRYL   52 (55)
T ss_dssp             SHHHHHHHHHHHH-HTTCCHHHHHHHHTSCHHHHHHHH
T ss_pred             CCCHHHHHHHHHH-HCCCCHHHHHHHHCHHHHHHHHHH
T ss_conf             5640999999999-848729999988461199999987


No 399
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3
Probab=36.56  E-value=19  Score=15.09  Aligned_cols=28  Identities=7%  Similarity=0.129  Sum_probs=23.4

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             9999649998899998289987988997
Q gi|254780444|r   15 RMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        15 ~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      .|+--.|+|.++.|..+|+|.+++...-
T Consensus        32 ~L~~~~~ls~~EIA~~lgis~~~V~~~l   59 (113)
T 1s7o_A           32 ELYYADDYSLAEIADEFGVSRQAVYDNI   59 (113)
T ss_dssp             HHHHHTCCCHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             9999973129999999897999999999


No 400
>2v79_A DNA replication protein DNAD; primosome, DNA remodelling, oligomerization domain, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis}
Probab=36.38  E-value=19  Score=15.07  Aligned_cols=19  Identities=16%  Similarity=0.260  Sum_probs=10.2

Q ss_pred             CHHHHHHHHCCCHHHHHHH
Q ss_conf             9889999828998798899
Q gi|254780444|r   23 TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        23 s~~~lA~~~Gv~~~ti~~~   41 (223)
                      |+..||+.+|++..++.++
T Consensus        53 S~~~La~~~g~s~~~v~~~   71 (135)
T 2v79_A           53 TPNQLQEGMSISVEECTNR   71 (135)
T ss_dssp             CHHHHHTTSSSCHHHHHHH
T ss_pred             CHHHHHHHHCCCHHHHHHH
T ss_conf             9999998959499999999


No 401
>1y9i_A Low temperature requirement C protein; structural genomics, protein structure initiative, PSI; 1.80A {Listeria monocytogenes} SCOP: a.195.1.1
Probab=36.17  E-value=15  Score=15.73  Aligned_cols=31  Identities=6%  Similarity=-0.004  Sum_probs=23.4

Q ss_pred             CCCCCHHHH-HHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             977558999-9999999996499988999982
Q gi|254780444|r    1 MTSFSHKKI-WEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         1 ~~~~~~~~i-~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      |+|..++.- -++-.++++++|+|..++|+.+
T Consensus         1 ~~~~~~~~~l~~~a~~~L~eRGVtl~DIaeiv   32 (178)
T 1y9i_A            1 MSLVEKQSALESKARSWLIERGVEIDDIAELV   32 (178)
T ss_dssp             -----CCCHHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             97521466899999999998598699999999


No 402
>1rfz_A Hypothetical protein APC35681; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.80A {Geobacillus stearothermophilus} SCOP: a.195.1.1
Probab=36.11  E-value=7.1  Score=17.84  Aligned_cols=31  Identities=19%  Similarity=0.259  Sum_probs=22.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9775589999999999996499988999982
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      |+..+.+++-++..++++++|+|..++|+.+
T Consensus         4 m~~~~~~~~~~~~~~~L~eRGVtl~dIa~~v   34 (168)
T 1rfz_A            4 MSEFIMNNLEQTARRWLEERGVTVEKIAELV   34 (168)
T ss_dssp             HHHHHHTSCHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHCCHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             4234168999999999998698699999999


No 403
>3eet_A Putative GNTR-family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.97A {Streptomyces avermitilis}
Probab=35.79  E-value=19  Score=15.01  Aligned_cols=35  Identities=9%  Similarity=0.126  Sum_probs=28.0

Q ss_pred             HHHHHHHHHHHHHCC------C-CHHHHHHHHCCCHHHHHHH
Q ss_conf             999999999999649------9-9889999828998798899
Q gi|254780444|r    7 KKIWEAIDRMAERHN------L-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         7 ~~i~~~i~~l~~~~g------l-s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .+|.++|...+....      | |..+||+..|||.+|+.+.
T Consensus        32 ~qI~~~L~~~I~~G~l~pG~rLPsereLA~~~gVSR~TVR~A   73 (272)
T 3eet_A           32 LRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEA   73 (272)
T ss_dssp             HHHHHHHHHHHHHTSSCTTSBCCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999999997599999299908999999989499999999


No 404
>3hot_A Transposable element mariner, complete CDS; protein-DNA complex, synaptic complex, transposase, DNA binding protein/DNA complex, transferase; HET: 5IU; 3.25A {Drosophila mauritiana} PDB: 3hos_A*
Probab=35.16  E-value=20  Score=14.95  Aligned_cols=62  Identities=10%  Similarity=-0.044  Sum_probs=37.8

Q ss_pred             CCCCC--HHHHHHHHHHHHHHCCCCHHHHHHHH-------CCCHHHHHHHHH----CC-------CCCCCCCCCHHHHHH
Q ss_conf             97755--89999999999996499988999982-------899879889975----15-------788755779899999
Q gi|254780444|r    1 MTSFS--HKKIWEAIDRMAERHNLTPSGLARKA-------GLDPTSFNKSKR----FG-------IEGRNRWPSTESIFK   60 (223)
Q Consensus         1 ~~~~~--~~~i~~~i~~l~~~~gls~~~lA~~~-------Gv~~~ti~~~~~----~~-------~~g~~r~p~~~~l~k   60 (223)
                      |++.-  +++....|-.| -+.|.|.++.|+.+       +++..||.+|.+    |.       ..|+|+....+.+.+
T Consensus         1 ~~~~~~~~~~~R~~i~~~-~~~g~~~~e~~~~l~~~~~~~~is~~TV~rw~~~~~~g~~~l~~~~r~grp~~~~~~~~~~   79 (345)
T 3hot_A            1 MSSFVPNKEQTRTVLIFC-FHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQA   79 (345)
T ss_dssp             ----CCCHHHHHHHHHHH-HHTTCCHHHHHHHHHHHTCSCSCCHHHHHHHHHHHTTCCCCCSCCCCCCCCCSSCHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHH-HHCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             987553318899999999-9859999999999998746788878899999999965786667699998898574399999


Q ss_pred             HHH
Q ss_conf             873
Q gi|254780444|r   61 ILA   63 (223)
Q Consensus        61 ia~   63 (223)
                      +.+
T Consensus        80 ~i~   82 (345)
T 3hot_A           80 LLD   82 (345)
T ss_dssp             HHH
T ss_pred             HHH
T ss_conf             886


No 405
>2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein structure initiative, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.37 c.94.1.1
Probab=35.15  E-value=20  Score=14.95  Aligned_cols=30  Identities=10%  Similarity=0.212  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             99999999964999889999828998798899
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +....++.+. | |-+..|++++++++++|+-
T Consensus        15 L~~f~~v~e~-g-S~s~AA~~L~isq~avS~~   44 (310)
T 2esn_A           15 LLVFDALYRH-R-NVGTAASELAISASAFSHA   44 (310)
T ss_dssp             HHHHHHHHHH-S-SHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHH-C-CHHHHHHHHCCCHHHHHHH
T ss_conf             9999999980-9-9999999978798999999


No 406
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription factor, alternative splicing, developmental protein; 2.6A {Mus musculus}
Probab=35.06  E-value=20  Score=14.94  Aligned_cols=43  Identities=19%  Similarity=0.182  Sum_probs=27.0

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCH---HHHHHHHCCCHHHHHHHHHC
Q ss_conf             77558999999999999649998---89999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTP---SGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~---~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++..=-.......-.|.   .+||..+|+++..|.-|..+
T Consensus         8 t~ft~~Q~~~Le~~F~~~~yps~~~r~~LA~~lgl~~~qV~~WFqN   53 (62)
T 2vi6_A            8 TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQN   53 (62)
T ss_dssp             CCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHCCHH
T ss_conf             8989999999999998779999899999999919887782322555


No 407
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A
Probab=35.04  E-value=20  Score=14.94  Aligned_cols=42  Identities=10%  Similarity=0.097  Sum_probs=27.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCC-CC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             77558999999999999649-99---889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHN-LT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~g-ls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|++++. .|+..-+... .+   ..+||..+|+++..|.-|..+
T Consensus         7 t~ft~~Ql~-~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~vWFqN   52 (68)
T 1ahd_P            7 QTYTRYQTL-ELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQN   52 (68)
T ss_dssp             CCCCHHHHH-HHHHHHHHCSSCCTTHHHHHHHHHTCCHHHHHHHHHH
T ss_pred             CCCCHHHHH-HHHHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             989999999-9999986089999999999999969998897896488


No 408
>2o8n_A APOA-I binding protein; rossmann fold, protein binding; 2.00A {Mus musculus} PDB: 2dg2_A
Probab=35.03  E-value=20  Score=14.94  Aligned_cols=37  Identities=14%  Similarity=0.158  Sum_probs=28.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHH
Q ss_conf             9775589999999999996499988999982899879
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTS   37 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~t   37 (223)
                      |+-||.++..+.=+.++++.|+|..+|-+.+|.+-..
T Consensus        28 mk~ls~~e~~~iD~~~i~~~Gis~~~LME~AG~~va~   64 (265)
T 2o8n_A           28 VKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCAT   64 (265)
T ss_dssp             CCCBCHHHHHHHHHHHHTTTCCCHHHHHHHHHHHHHH
T ss_pred             CEECCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             4321899999999999987298999999999999999


No 409
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1
Probab=34.65  E-value=20  Score=14.90  Aligned_cols=43  Identities=12%  Similarity=0.172  Sum_probs=27.0

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7755899999999999964999---889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++..=-....+..-.|   ..+||..+|++...|.-|..+
T Consensus         5 t~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~WFqN   50 (58)
T 1ig7_A            5 TPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQN   50 (58)
T ss_dssp             CCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             8899999999999998679979999999999959698886697174


No 410
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A
Probab=34.28  E-value=20  Score=14.86  Aligned_cols=44  Identities=18%  Similarity=0.135  Sum_probs=27.7

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             7755899999999999964999---8899998289987988997515
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +++|.+++..=-....+..-.|   ..+||..+|++...|..|....
T Consensus         4 ~~FT~~Ql~~Le~~F~~n~~Ps~~~~~~LA~~lgls~~~V~~WFqNr   50 (60)
T 3a02_A            4 MTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNR   50 (60)
T ss_dssp             -CCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             88699999999999986699799999999999198999935820888


No 411
>1tlq_A Hypothetical protein YPJQ; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: a.195.1.1
Probab=33.93  E-value=21  Score=14.82  Aligned_cols=31  Identities=10%  Similarity=0.283  Sum_probs=24.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9775589999999999996499988999982
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      |+..+.+++-+.-..+++++|+|..++|+.+
T Consensus         3 ~~ky~~~e~~~~~~~~L~eRGVtl~DIaeiv   33 (189)
T 1tlq_A            3 LKKYTMNEMVDITKDMLNKRGVMIEDIARIV   33 (189)
T ss_dssp             ---CCHHHHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             5326789999999999998598699999999


No 412
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase, nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans R1}
Probab=33.81  E-value=21  Score=14.81  Aligned_cols=51  Identities=16%  Similarity=0.283  Sum_probs=36.9

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      .+++.++|+.+|++       +|+..|+.+-.|              .+-.+|..++...+.+.++|.....
T Consensus         4 d~~L~~~L~~~R~~-------~A~~~~vp~~~I--------------~~d~~L~~ia~~~P~t~~eL~~I~G   54 (77)
T 2rhf_A            4 NADLSEALRELRRE-------LMKETGYSAFVV--------------FTNATLEALAARQPRTLAELAEVPG   54 (77)
T ss_dssp             HHHHHHHHHHHHHH-------HHHHHCCCHHHH--------------CCHHHHHHHHHHCCCSHHHHTTSTT
T ss_pred             CHHHHHHHHHHHHH-------HHHHCCCCCEEE--------------ECHHHHHHHHHHCCCCHHHHHCCCC
T ss_conf             79999999999999-------998769896565--------------7899999999839789999807999


No 413
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A
Probab=33.39  E-value=21  Score=14.77  Aligned_cols=41  Identities=22%  Similarity=0.190  Sum_probs=31.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCC-------CHHHHHHHHCCCHHHHHHH
Q ss_conf             9775589999999999996499-------9889999828998798899
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAERHNL-------TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~~~gl-------s~~~lA~~~Gv~~~ti~~~   41 (223)
                      |++=--++|...|........+       |..+||+..|+|.+|+.+.
T Consensus         1 m~~PlY~qI~~~I~~~I~~g~~~pG~~LPse~~La~~~gVSr~tVR~A   48 (129)
T 2ek5_A            1 MTVPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNG   48 (129)
T ss_dssp             --CCHHHHHHHHHHHHHHTTSSCTTSCBCCHHHHHHHTTCCHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             998799999999999998599999699878999998929999999999


No 414
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris}
Probab=33.31  E-value=21  Score=14.76  Aligned_cols=37  Identities=16%  Similarity=0.111  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             99999999999649998899998289987988997515
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +|.+.|+.=.. ..+|..+||+.+|+|+.++++..+..
T Consensus         6 ri~~~i~~~~~-~~~~~~~la~~~~~S~~~l~r~fk~~   42 (108)
T 3mn2_A            6 QVEEYIEANWM-RPITIEKLTALTGISSRGIFKAFQRS   42 (108)
T ss_dssp             HHHHHHHHHTT-SCCCHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCC-CCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999987328-99999999999891999999999999


No 415
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1
Probab=32.48  E-value=19  Score=15.03  Aligned_cols=24  Identities=13%  Similarity=0.189  Sum_probs=18.5

Q ss_pred             CCCCCHHHHHHHHHHHHH-HCCCCH
Q ss_conf             977558999999999999-649998
Q gi|254780444|r    1 MTSFSHKKIWEAIDRMAE-RHNLTP   24 (223)
Q Consensus         1 ~~~~~~~~i~~~i~~l~~-~~gls~   24 (223)
                      ||++|.++|.+.|+++.. ..|+..
T Consensus         1 mt~~t~~~l~~~lr~~~~~~~~vd~   25 (95)
T 1nq4_A            1 MTLLTLSDLLTLLRECAGEEESIDL   25 (95)
T ss_dssp             CCCCCHHHHHHHHHHHHTCSSTTCS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCH
T ss_conf             9857899999999999988838882


No 416
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A
Probab=31.69  E-value=23  Score=14.59  Aligned_cols=44  Identities=14%  Similarity=0.037  Sum_probs=28.3

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             7755899999999999964999---8899998289987988997515
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +.+|++++..=-....+..-.+   ..+||..+|++...|.-|....
T Consensus        18 t~ft~~Ql~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qVkvWFqNr   64 (77)
T 1puf_A           18 CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNR   64 (77)
T ss_dssp             CCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             89999999999999987799999999999999099878867973888


No 417
>3h87_C Putative uncharacterized protein; toxin antitoxin complex, RHH motif, structural genomics; 1.49A {Mycobacterium tuberculosis}
Probab=31.64  E-value=23  Score=14.58  Aligned_cols=50  Identities=14%  Similarity=0.216  Sum_probs=32.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             899999999999964999889999828998798899751578875577989999987321
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT   65 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~   65 (223)
                      .+++...||..++++|||..++=+.         .+++..-..++ ......|.+++.++
T Consensus        10 ~~~vl~~iD~~A~~~GlSRnE~L~r---------~le~~a~~~~~-~vTaadl~R~a~a~   59 (73)
T 3h87_C           10 PDDVLASLDAIAARLGLSRTEYIRR---------RLAQDAQTARV-TVTAADLRRLRGAV   59 (73)
T ss_dssp             CHHHHHHHHHHHHHHTCCHHHHHHH---------HHHHHHTSCCC-CCCHHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHCCCCHHHHHHH---------HHHHHHCCCCC-CCCHHHHHHHHHHH
T ss_conf             9999999778999838768899999---------98876227788-24699999999998


No 418
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2
Probab=31.34  E-value=23  Score=14.55  Aligned_cols=24  Identities=4%  Similarity=0.113  Sum_probs=21.0

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             499988999982899879889975
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      ..+|..++|+..|+|...+.+.++
T Consensus        24 ~~~tl~eia~~lgvS~erVrqie~   47 (68)
T 2p7v_B           24 TDYTLEEVGKQFDVTRERIRQIEA   47 (68)
T ss_dssp             SCCCHHHHHHHHTCCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             977899999998969999999999


No 419
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1
Probab=31.24  E-value=23  Score=14.54  Aligned_cols=43  Identities=23%  Similarity=0.274  Sum_probs=27.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7755899999999999964999---889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++..=-.......-.|   ..+||..+|++...|..|..+
T Consensus         7 t~ft~~Q~~~Le~~F~~~~yPs~~~r~~LA~~lgl~~~qV~~WFqN   52 (68)
T 1ftt_A            7 VLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQN   52 (68)
T ss_dssp             SSCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHHTSCHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHEECCCHH
T ss_conf             9899999999999998679979999999999819887880002565


No 420
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens}
Probab=31.01  E-value=23  Score=14.51  Aligned_cols=49  Identities=14%  Similarity=0.125  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             9999999999964999889999828998798899751578875577989999987321875210000111
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF   77 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~~   77 (223)
                      ++.++|..+|       .++|+..|+.+..|              .+-.+|..+|...+.+..+|....+
T Consensus        23 ~l~~~L~~~R-------~~lA~~~~ip~~~I--------------~~d~~L~eia~~~P~t~~eL~~I~G   71 (101)
T 2rrd_A           23 KCLGELTEVC-------KSLGKVFGVHYFNI--------------FNTVTLKKLAESLSSDPEVLLQIDG   71 (101)
T ss_dssp             HHHHHHHHHH-------HHHHHHTTCCHHHH--------------CCHHHHHHHHHHCCCCHHHHHTSTT
T ss_pred             HHHHHHHHHH-------HHHHHHCCCCCEEE--------------ECHHHHHHHHHHCCCCHHHHHCCCC
T ss_conf             9999999999-------99999769995455--------------7799999999868599999826778


No 421
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A
Probab=30.47  E-value=13  Score=16.08  Aligned_cols=33  Identities=6%  Similarity=0.112  Sum_probs=25.2

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHH
Q ss_conf             5899999999999964999889999828998798
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSF   38 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti   38 (223)
                      +++++-.-|.+|+.+ |.|+.+.-|++++++..+
T Consensus         7 ~~enl~~eI~~Lm~~-GYs~~dv~rAL~Ia~Nni   39 (52)
T 2ooa_A            7 ALENVDAKIAKLMGE-GYAFEEVKRALEIAQNNV   39 (52)
T ss_dssp             ----CHHHHHHHHHT-TCCHHHHHHHHHHTTTCH
T ss_pred             CCCCCCHHHHHHHHC-CCCHHHHHHHHHHHHCCH
T ss_conf             744221799999986-655999999999986229


No 422
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1
Probab=30.34  E-value=24  Score=14.44  Aligned_cols=43  Identities=28%  Similarity=0.254  Sum_probs=26.3

Q ss_pred             CCCCHHHHHHHHHHHHHH-CCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             775589999999999996-4999---8899998289987988997515
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAER-HNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~-~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +.+|.+++. .|++.-++ .-.+   ..+||..+|++...|..|....
T Consensus        12 t~ft~~Q~~-~Le~~F~~~~yP~~~~r~~LA~~lgL~~~~V~~WFqNr   58 (80)
T 2cue_A           12 TSFTQEQIE-ALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNR   58 (80)
T ss_dssp             CCSCHHHHH-HHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHH
T ss_pred             CCCCHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHCCCCC
T ss_conf             998999999-99999986699899999999999798887833614030


No 423
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28
Probab=30.07  E-value=24  Score=14.41  Aligned_cols=22  Identities=5%  Similarity=0.069  Sum_probs=19.4

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             4999889999828998798899
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      .++++++||+.++++++++++.
T Consensus        49 ~~~~~~~la~~l~~~ks~vs~~   70 (250)
T 1p4x_A           49 NTLPFKKIVSDLCYKQSDLVQH   70 (250)
T ss_dssp             SEEEHHHHHHHSSSCGGGTHHH
T ss_pred             CCCCHHHHHHHHCCCCCHHHHH
T ss_conf             9978999999968881069999


No 424
>2ns0_A Hypothetical protein; rhodococcus structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} SCOP: a.4.5.76
Probab=29.84  E-value=24  Score=14.39  Aligned_cols=30  Identities=23%  Similarity=0.394  Sum_probs=24.0

Q ss_pred             CCHHHHHHHHHHHHHHCC----CCHHHHHHHHCC
Q ss_conf             558999999999999649----998899998289
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN----LTPSGLARKAGL   33 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g----ls~~~lA~~~Gv   33 (223)
                      .+..+|-.+|-+|+.++|    +.||+.||.++-
T Consensus         3 ~~d~~le~~Il~Ll~~R~~~~ticPSEvARal~~   36 (85)
T 2ns0_A            3 VSDRELEECIRALLDARADSASICPSDVARAVAP   36 (85)
T ss_dssp             SCHHHHHHHHHHHHHHSCTTCCBCHHHHHHHHCT
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCC
T ss_conf             5589999999999996499897598999988684


No 425
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A
Probab=29.64  E-value=10  Score=16.85  Aligned_cols=36  Identities=17%  Similarity=0.122  Sum_probs=25.5

Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             5899999999999964999889999828998798899
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +++.=..-|+.| .+...+.++||+.+|++++++++.
T Consensus        10 ~~~~R~~Il~~L-~~~~~~~~ela~~l~~s~~~v~~h   45 (232)
T 2qlz_A           10 GNKVRRDLLSHL-TCMECYFSLLSSKVSVSSTAVAKH   45 (232)
T ss_dssp             TSHHHHHHHHHH-TTTTTCSSSSCTTCCCCHHHHHHH
T ss_pred             CCHHHHHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             899999999999-818977999999989198899999


No 426
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1
Probab=29.38  E-value=25  Score=14.34  Aligned_cols=43  Identities=19%  Similarity=0.214  Sum_probs=26.5

Q ss_pred             CCCCHHHHHHHHHHHHHH-CCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             775589999999999996-4999---8899998289987988997515
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAER-HNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~-~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +.||.+++ ..|+..-++ .-.+   ..+||..+|++...|..|..+.
T Consensus         7 t~ft~~Ql-~~Le~~F~~~~yp~~~~r~~LA~~lgl~~~qV~~WFQNR   53 (68)
T 1zq3_P            7 TTFTSSQI-AELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNR   53 (68)
T ss_dssp             CCCCHHHH-HHHHHHHTTCSSCCHHHHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             CCCCHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999999-999999986699899999999999799756877852548


No 427
>2ay0_A Bifunctional PUTA protein; ribbon-helix-helix, DNA-binding domain, proline catabolism, proline utilization A, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.43.1.11
Probab=29.35  E-value=25  Score=14.34  Aligned_cols=26  Identities=31%  Similarity=0.327  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             89999999999996499988999982
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      -+++.++|++|++..|=|++.|++.+
T Consensus        11 d~el~~Rl~~lA~~~~RS~hwli~qA   36 (58)
T 2ay0_A           11 DDATRERIKSAATRIDRTPHWLIKQA   36 (58)
T ss_dssp             CHHHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             99999999999998589976999999


No 428
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1
Probab=29.07  E-value=25  Score=14.30  Aligned_cols=42  Identities=12%  Similarity=0.132  Sum_probs=26.1

Q ss_pred             CCCHHHHHHHHHHHHHH-CCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             75589999999999996-4999---8899998289987988997515
Q gi|254780444|r    3 SFSHKKIWEAIDRMAER-HNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~-~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .+|.+++. .|++.-.. .-++   ..+||..+|++...|..|..+.
T Consensus        40 ~ft~~Q~~-~Le~~F~~~~yp~~~~r~~LA~~l~l~~~~V~vWFqNr   85 (97)
T 1b72_A           40 NFTTRQLT-ELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNR   85 (97)
T ss_dssp             CCCHHHHH-HHHHHHTTCSSCCHHHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CCCHHHHH-HHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             88999999-99999998689769999999887199965702314888


No 429
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli}
Probab=28.63  E-value=25  Score=14.26  Aligned_cols=24  Identities=13%  Similarity=0.195  Sum_probs=21.3

Q ss_pred             CCCCHHHHHHHHCCCHHHHHHHHH
Q ss_conf             499988999982899879889975
Q gi|254780444|r   20 HNLTPSGLARKAGLDPTSFNKSKR   43 (223)
Q Consensus        20 ~gls~~~lA~~~Gv~~~ti~~~~~   43 (223)
                      .|-+++++|...|++.+.+++..+
T Consensus        33 ~G~~~~evA~~~Glskq~V~~~V~   56 (101)
T 2w7n_A           33 DGKPQATFATSLGLTRGAVSQAVH   56 (101)
T ss_dssp             TCCCHHHHHHHHTCCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHCCHHHHHHHHHH
T ss_conf             884099999996803889999999


No 430
>1b4a_A Arginine repressor; helix turn helix; 2.50A {Geobacillus stearothermophilus} SCOP: a.4.5.3 d.74.2.1 PDB: 1f9n_A
Probab=28.47  E-value=26  Score=14.24  Aligned_cols=34  Identities=9%  Similarity=0.205  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHCCC-CHHHHHHHHC-----CCHHHHHHHHH
Q ss_conf             9999999996499-9889999828-----99879889975
Q gi|254780444|r   10 WEAIDRMAERHNL-TPSGLARKAG-----LDPTSFNKSKR   43 (223)
Q Consensus        10 ~~~i~~l~~~~gl-s~~~lA~~~G-----v~~~ti~~~~~   43 (223)
                      .+.|.++.++..+ ||.+|.+.+.     ++|+|+||--+
T Consensus         7 q~~I~~lI~~~~I~tQeeL~~~L~~~Gi~vTQATiSRDlk   46 (149)
T 1b4a_A            7 HIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIK   46 (149)
T ss_dssp             HHHHHHHHHHSCCCSHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             9999999985897889999999998698540899888899


No 431
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 2.10A {Pseudomonas syringae PV}
Probab=28.15  E-value=26  Score=14.20  Aligned_cols=38  Identities=16%  Similarity=0.161  Sum_probs=29.4

Q ss_pred             CCHHHHHHHHHHHHHHCC------CCHHHHHHHHCCCHHHHHHH
Q ss_conf             558999999999999649------99889999828998798899
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHN------LTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~g------ls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +.+++|.+.|+..+-...      |+..+||+..|||.+++...
T Consensus        26 ~~~~~v~~~lr~~I~~g~l~pG~~L~e~~La~~~gvSRtpVREA   69 (237)
T 3c7j_A           26 LARTVIEEKLRNAIIDGSLPSGTALRQQELATLFGVSRMPVREA   69 (237)
T ss_dssp             GHHHHHHHHHHHHHHTSSSCTTCBCCHHHHHHHHTSCHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             38999999999999819999909749999999889586999999


No 432
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens}
Probab=27.97  E-value=26  Score=14.21  Aligned_cols=31  Identities=3%  Similarity=0.157  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHH
Q ss_conf             89999999999996499988999982899879
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTS   37 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~t   37 (223)
                      -+++-.-|.+|+.+ |.|+.+.-|++|+++..
T Consensus         4 s~~~~~eI~~Lm~~-GYs~~~v~rAL~Ia~Nn   34 (56)
T 2juj_A            4 SPQLSSEIENLMSQ-GYSYQDIQKALVIAQNN   34 (56)
T ss_dssp             CHHHHHHHHHHHTT-TCCHHHHHHHHHHTTTC
T ss_pred             CCCCHHHHHHHHHC-CCCHHHHHHHHHHHHCC
T ss_conf             33022899999985-54499999999998711


No 433
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron}
Probab=27.08  E-value=27  Score=14.08  Aligned_cols=62  Identities=19%  Similarity=0.259  Sum_probs=42.6

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             558999999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r    4 FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         4 ~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
                      |+++--.++|     +..|+....|...|++.+.+-+.++...-     |-.-+...++..-|+.+..+.+.
T Consensus         3 lsnelkveri-----rlsltaksvaeemgisrqqlcnieqseta-----pvvvkyiaflrskgvdlnalfdr   64 (77)
T 2k9q_A            3 LSNELKVERI-----RLSLTAKSVAEEMGISRQQLCNIEQSETA-----PVVVKYIAFLRSKGVDLNALFDR   64 (77)
T ss_dssp             HHHHHHHHHH-----HHTCCHHHHHHHHTSCHHHHHHHHTCCSC-----CHHHHHHHHHHHTTCCHHHHHHH
T ss_pred             CCCCCEEEEE-----EEEEEHHHHHHHHCCCHHHHCCCCCCCCC-----CCHHHHHHHHHHCCCCHHHHHHH
T ss_conf             5420123566-----77522677899848459883474113657-----73488899998638758999999


No 434
>2ev1_A Hypothetical protein RV1264/MT1302; alpha-helical, regulatory domain of adenylyl cyclase, oleic acid, lyase; HET: OLA 1PE; 1.60A {Mycobacterium tuberculosis} PDB: 2ev2_A* 2ev3_A* 2ev4_A*
Probab=27.02  E-value=27  Score=14.07  Aligned_cols=25  Identities=12%  Similarity=0.197  Sum_probs=20.6

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCCC
Q ss_conf             9988999982899879889975157
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFGI   46 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~~   46 (223)
                      +|..++|+.+||++.++.+|.+.-+
T Consensus        79 Yt~rEvAe~tGV~~e~~rr~wRalG  103 (222)
T 2ev1_A           79 VSAREISENYGVDLELLQRVQRAVG  103 (222)
T ss_dssp             ECHHHHHHHHTCCHHHHHHHHHHHC
T ss_pred             ECHHHHHHHHCCCHHHHHHHHHHCC
T ss_conf             8699999997919999999999819


No 435
>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis}
Probab=26.05  E-value=28  Score=13.96  Aligned_cols=26  Identities=15%  Similarity=0.086  Sum_probs=22.0

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             64999889999828998798899751
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      ..|+|-.+.|+.+++|..|+..+.+.
T Consensus       162 ~~G~snkeIA~~L~iS~~TVk~h~~~  187 (225)
T 3c3w_A          162 SEGLTNKQIADRMFLAEKTVKNYVSR  187 (225)
T ss_dssp             HTTCCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             93898889999978879999999999


No 436
>1s4k_A Putative cytoplasmic protein YDIL; structural genomics, MCSG, PSI, protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: a.35.1.6
Probab=25.73  E-value=29  Score=13.92  Aligned_cols=35  Identities=6%  Similarity=0.046  Sum_probs=29.4

Q ss_pred             HHHHHHHCCCCHHHHHHHHC--CCHHHHHHHHHCCCC
Q ss_conf             99999964999889999828--998798899751578
Q gi|254780444|r   13 IDRMAERHNLTPSGLARKAG--LDPTSFNKSKRFGIE   47 (223)
Q Consensus        13 i~~l~~~~gls~~~lA~~~G--v~~~ti~~~~~~~~~   47 (223)
                      |++||+-.-+|..+-|.-.+  ++..+..+|++|...
T Consensus         8 LqalR~if~m~v~EaA~~I~~~~~s~tWQ~WE~G~~~   44 (120)
T 1s4k_A            8 LQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIP   44 (120)
T ss_dssp             HHHHHHHTTCCHHHHHHHTSSSCCHHHHHHHHHTSSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCC
T ss_conf             9999999995399999999657768999999758978


No 437
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli}
Probab=25.41  E-value=27  Score=14.05  Aligned_cols=36  Identities=17%  Similarity=0.357  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             899999999999964999889999828998798899
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      ++.+|+.|+.+....-.+..+||..+|++...+.+.
T Consensus         5 ~q~~w~~ie~~~~~~Pp~v~dla~~l~~d~~~~~~~   40 (121)
T 2pjp_A            5 QQAIWQKAEPLFGDEPWWVRDLAKETGTDEQAMRLT   40 (121)
T ss_dssp             HHHHHHHHGGGCSSSCEEHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             999999999987469998999998979499999999


No 438
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens}
Probab=24.86  E-value=20  Score=14.94  Aligned_cols=30  Identities=3%  Similarity=0.182  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHCCCHHHH
Q ss_conf             9999999999964999889999828998798
Q gi|254780444|r    8 KIWEAIDRMAERHNLTPSGLARKAGLDPTSF   38 (223)
Q Consensus         8 ~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti   38 (223)
                      ++-+-|.+|+.+ |.|+.+.-|++|+++..+
T Consensus         3 ~~~~eI~~Lm~~-GYs~~~v~rAL~Ia~Nni   32 (46)
T 2oo9_A            3 QLSSEIENLMSQ-GYSYQDIQKALVIAQNNI   32 (46)
T ss_dssp             HHHHHHHHHHHT-TBCHHHHHHHHHHTTTCH
T ss_pred             CHHHHHHHHHHC-CCCHHHHHHHHHHHHCCH
T ss_conf             203899999986-776999999999986219


No 439
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300}
Probab=24.85  E-value=30  Score=13.82  Aligned_cols=19  Identities=5%  Similarity=0.197  Sum_probs=11.8

Q ss_pred             CCHHHHHHHHCCCHHHHHH
Q ss_conf             9988999982899879889
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNK   40 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~   40 (223)
                      +|+.+||..+|+++.|+++
T Consensus       176 lt~~~iA~~lg~sr~tvsR  194 (231)
T 3e97_A          176 LGTQDIMARTSSSRETVSR  194 (231)
T ss_dssp             CCHHHHHHHHTCCHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHH
T ss_conf             6999999886998999999


No 440
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1
Probab=24.83  E-value=30  Score=13.82  Aligned_cols=22  Identities=23%  Similarity=0.241  Sum_probs=18.1

Q ss_pred             HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             8899998289987988997515
Q gi|254780444|r   24 PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        24 ~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      ..+||..+|++...|..|.+..
T Consensus        31 ~~~La~~lgl~~~qV~~WF~Nr   52 (64)
T 1x2m_A           31 LEGLSKQLDWDVRSIQRWFRQR   52 (64)
T ss_dssp             HHHHHHHHCSCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHCCHHH
T ss_conf             9999999498989988805854


No 441
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B
Probab=24.79  E-value=30  Score=13.81  Aligned_cols=43  Identities=14%  Similarity=0.095  Sum_probs=26.3

Q ss_pred             CCCHHHHHHHHHHHHHHCCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             755899999999999964999---8899998289987988997515
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .+|.+++..=-.......-.+   ..+||..+|++...|..|....
T Consensus        24 ~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~WFqNr   69 (81)
T 1fjl_A           24 TFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNR   69 (81)
T ss_dssp             CCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             8899999999999988699998999999999299988916752447


No 442
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1
Probab=24.52  E-value=30  Score=13.78  Aligned_cols=42  Identities=12%  Similarity=0.206  Sum_probs=26.5

Q ss_pred             CCCCHHHHHHHHHHHHHH-CCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             775589999999999996-4999---889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAER-HNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~-~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++ +.|++.=++ .-.|   ..+||..+|++...|.-|..+
T Consensus         6 t~ft~~Ql-~~Le~~F~~~~yP~~~~r~~La~~l~l~~~qV~vWFqN   51 (60)
T 1jgg_A            6 TAFTRDQL-GRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQN   51 (60)
T ss_dssp             CCCCHHHH-HHHHHHHHHCSCCCHHHHHHHHHHHTSCHHHHHHHHHH
T ss_pred             CCCCHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHCCCCC
T ss_conf             88999999-99999998679989899999999909983261103742


No 443
>3m8j_A FOCB protein; all-alpha, helix-turn-helix, transcription; 1.40A {Escherichia coli}
Probab=24.04  E-value=31  Score=13.72  Aligned_cols=31  Identities=13%  Similarity=0.159  Sum_probs=25.4

Q ss_pred             HHHHHHHH--CCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             99999996--49998899998289987988997
Q gi|254780444|r   12 AIDRMAER--HNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus        12 ~i~~l~~~--~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      -|.+|+..  .|+++.+.+.+-||+++.++..-
T Consensus        49 vI~AL~dylV~G~~rk~ac~r~~V~~syfS~~L   81 (111)
T 3m8j_A           49 VILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTL   81 (111)
T ss_dssp             HHHHHHHHHTTCCCHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHH
T ss_conf             999999999848709999999099789999999


No 444
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1
Probab=23.85  E-value=13  Score=16.04  Aligned_cols=23  Identities=26%  Similarity=0.225  Sum_probs=19.0

Q ss_pred             HCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             64999889999828998798899
Q gi|254780444|r   19 RHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        19 ~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +.|.|-+.-|++++++|+++|+-
T Consensus        14 ~~~~S~s~AA~~L~isQ~avS~~   36 (324)
T 1al3_A           14 NHNLNVSSTAEGLYTSQPGISKQ   36 (324)
T ss_dssp             -----------------------
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             85998999999988888899999


No 445
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed oxyanion HOLE; 2.00A {Equine arteritis virus} SCOP: b.47.1.3
Probab=23.83  E-value=15  Score=15.66  Aligned_cols=51  Identities=10%  Similarity=0.091  Sum_probs=34.8

Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEEECCCE-EEEEE
Q ss_conf             368559999628332421487868999368974058889999717968-99999
Q gi|254780444|r  133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI-VAKVL  185 (223)
Q Consensus       133 ~~~~~~~l~V~GDSM~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~-~iKrl  185 (223)
                      ...-+|++.--|||=.|.|..+++|-|.+..+ ..|.++ +-+.+|+. -+|-+
T Consensus       101 G~~~afcFT~cGDSGSPVI~~d~LVGVHTGSN-k~GsG~-vTtp~G~~~~~~~~  152 (198)
T 1mbm_A          101 SGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSN-TSGVAY-VTTPSGKLLGADTV  152 (198)
T ss_dssp             CSSCEECCCCGGGTTCEEEETTEEEEEEEEEE-GGGEEE-EECTTCCEESSSCE
T ss_pred             CCCEEEEECCCCCCCCCEECCCCEEEEECCCC-CCCCEE-EECCCCCEECCCCE
T ss_conf             38548998157888994242896588870788-767457-87789857234534


No 446
>1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli}
Probab=23.72  E-value=31  Score=13.68  Aligned_cols=24  Identities=13%  Similarity=0.128  Sum_probs=19.4

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             998899998289987988997515
Q gi|254780444|r   22 LTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        22 ls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      |...+++..+|++.+||.++.+.+
T Consensus        11 lr~keV~~~~glsrstiy~~i~~G   34 (66)
T 1z4h_A           11 VDLKFIMADTGFGKTFIYDRIKSG   34 (66)
T ss_dssp             ECHHHHHHHHSSCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHCC
T ss_conf             649999999897999999999879


No 447
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua}
Probab=23.65  E-value=31  Score=13.67  Aligned_cols=36  Identities=11%  Similarity=0.230  Sum_probs=27.6

Q ss_pred             HHHHHHHHHHHHHHCC------C-CHHHHHHHHCCCHHHHHHH
Q ss_conf             8999999999999649------9-9889999828998798899
Q gi|254780444|r    6 HKKIWEAIDRMAERHN------L-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~g------l-s~~~lA~~~Gv~~~ti~~~   41 (223)
                      .++|...|......-.      | |..+||...|||++|+.+.
T Consensus        15 Y~qI~~~i~~~I~~G~l~~G~~LPser~La~~~~VSr~tVr~A   57 (125)
T 3neu_A           15 YSQISDWMKKQMITGEWKGEDKLPSVREMGVKLAVNPNTVSRA   57 (125)
T ss_dssp             HHHHHHHHHHHHHTTSSCTTCBCCCHHHHHHHHTCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             9999999999998499999699954999999939288999999


No 448
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1
Probab=23.56  E-value=31  Score=13.66  Aligned_cols=43  Identities=14%  Similarity=0.155  Sum_probs=26.5

Q ss_pred             CCCCHHHHHHHHHHHHH-HCCCC---HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             77558999999999999-64999---8899998289987988997515
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAE-RHNLT---PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~-~~gls---~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      +.+|.+++ +.|++.=. ..-.+   ..+||..+|++...|..|..+.
T Consensus         8 t~~t~~Q~-~~Le~~F~~n~~P~~~~~~~LA~~~~L~~~qV~~WFqNr   54 (66)
T 1bw5_A            8 TVLNEKQL-HTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNK   54 (66)
T ss_dssp             CCCSHHHH-HHHHHHHHHCSCCCHHHHHHHHHHHTSCHHHHHHHHHHH
T ss_pred             CCCCHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             89899999-999999988599999999999999390999988976888


No 449
>2kwp_A Transcription elongation protein NUSA; NMR {Escherichia coli}
Probab=22.42  E-value=33  Score=13.52  Aligned_cols=25  Identities=12%  Similarity=0.254  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9999999999996499988999982
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      .++.++|+.+.+++|++...+-.++
T Consensus         3 ~eil~al~~la~EKgI~~e~l~~al   27 (129)
T 2kwp_A            3 KEILAVVEAVSNEKALPREKIFEAL   27 (129)
T ss_dssp             HHHHHHHHHHHHHHCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             8999999999987299999999999


No 450
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=22.30  E-value=33  Score=13.50  Aligned_cols=18  Identities=17%  Similarity=0.187  Sum_probs=11.9

Q ss_pred             CCCCCCCCCCCCEEEEECC
Q ss_conf             8332421487868999368
Q gi|254780444|r  144 DTSMLPLYRKGDILILNSA  162 (223)
Q Consensus       144 GDSM~P~i~~Gd~vlVd~~  162 (223)
                      |.|| |.|..|+-||+.-+
T Consensus         4 ~ss~-p~f~~G~~VLarW~   21 (68)
T 2e5p_A            4 GSSG-PRLWEGQDVLARWT   21 (68)
T ss_dssp             CCCC-CCCCTTCEEEEECT
T ss_pred             CCCC-CCCCCCCEEEEEEC
T ss_conf             8788-76335878998840


No 451
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens}
Probab=22.00  E-value=34  Score=13.47  Aligned_cols=25  Identities=12%  Similarity=0.139  Sum_probs=8.6

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCEEE
Q ss_conf             4214878689993689740588899
Q gi|254780444|r  148 LPLYRKGDILILNSAIQVNCGDRLL  172 (223)
Q Consensus       148 ~P~i~~Gd~vlVd~~~~~~~g~~v~  172 (223)
                      .+++-+|..+-=+......+||.+.
T Consensus        64 NGt~vng~~l~~~~~~~L~~GD~i~   88 (102)
T 3kt9_A           64 NPTSIDSVVIGKDQEVKLQPGQVLH   88 (102)
T ss_dssp             SCCEETTEECCBTCEEEECTTCCEE
T ss_pred             CCEEECCEEECCCCCCCCCCCCEEE
T ss_conf             8668999895789600579999999


No 452
>2rqp_A Heterochromatin protein 1-binding protein 3; histone H1, alternative splicing, chromosomal protein, DNA-binding, nucleus, phosphoprotein; NMR {Homo sapiens}
Probab=21.79  E-value=34  Score=13.44  Aligned_cols=26  Identities=12%  Similarity=0.111  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             89999999999996499988999982
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKA   31 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~   31 (223)
                      .+=|.+||.+|-++.|-|..++.+-+
T Consensus        13 ~~MI~eAI~~l~er~GsS~~AI~kyI   38 (88)
T 2rqp_A           13 DAILTEAIKACFQKSGASVVAIRKYI   38 (88)
T ss_dssp             HHHHHHHHHHHHHHTCCCHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             99999999982998995999999999


No 453
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcriptional regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A*
Probab=21.78  E-value=16  Score=15.61  Aligned_cols=29  Identities=10%  Similarity=0.119  Sum_probs=20.2

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             9999999964999889999828998798899
Q gi|254780444|r   11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus        11 ~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~   41 (223)
                      +.+-++.+..  |-+.-|+++|++++++|+.
T Consensus         7 ~~f~~v~~~~--s~s~AA~~L~vtq~avS~~   35 (312)
T 2h9b_A            7 RYFVAVVEEQ--SFTKAADKLCIAQPPLSRQ   35 (312)
T ss_dssp             -------------------------------
T ss_pred             HHHHHHHHCC--CHHHHHHHHCCCHHHHHHH
T ss_conf             9999999809--9999999988888999999


No 454
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1
Probab=21.67  E-value=34  Score=13.42  Aligned_cols=42  Identities=14%  Similarity=0.165  Sum_probs=25.5

Q ss_pred             CCCCHHHHHHHHHHHHHH-CCC---CHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             775589999999999996-499---9889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAER-HNL---TPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~-~gl---s~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++ ..|++.=++ .-.   ...+||..+|++...|..|...
T Consensus         8 t~ft~~Ql-~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~~WFqN   53 (68)
T 1yz8_P            8 THFTSQQL-QQLEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKN   53 (68)
T ss_dssp             CCCCHHHH-HHHHHHHTTCSSCCTTTTTHHHHHTTSCHHHHHHHHHH
T ss_pred             CCCCHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             89999999-99999998669999999999999949298997893287


No 455
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A*
Probab=20.86  E-value=35  Score=13.32  Aligned_cols=59  Identities=14%  Similarity=0.274  Sum_probs=35.0

Q ss_pred             HHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHHHC-CCCCCCCC-CCHHHH-HHHHHHCCCCCCC
Q ss_conf             99999996499---9889999828998798899751-57887557-798999-9987321875210
Q gi|254780444|r   12 AIDRMAERHNL---TPSGLARKAGLDPTSFNKSKRF-GIEGRNRW-PSTESI-FKILAATNETICQ   71 (223)
Q Consensus        12 ~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~~~-~~~g~~r~-p~~~~l-~kia~~~~v~~~~   71 (223)
                      .|+.|. +.|.   |-.+||+.+|++++.+.+=..- +.-|++.- =..+.| ..+-+.+|..-.|
T Consensus        21 ~L~~l~-~~g~~~iSS~~La~~~gi~~~qVRKDls~fG~~G~~g~GY~V~~L~~~i~~iLG~~~~~   85 (212)
T 3keo_A           21 IFKRFN-TDGIEKASSKQIADALGIDSATVRRDFSYFGELGRRGFGYDVKKLMNFFAEILNDHSTT   85 (212)
T ss_dssp             HHHHHH-HTTCCEECHHHHHHHHTSCHHHHHHHHHTTGGGTTTSSSEEHHHHHHHHHHHTTTTSCE
T ss_pred             HHHHHH-HCCCEEECHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             999998-86986897999999969899999989988621799998934999999999996899984


No 456
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=20.78  E-value=36  Score=13.30  Aligned_cols=22  Identities=23%  Similarity=0.104  Sum_probs=18.2

Q ss_pred             HHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             8899998289987988997515
Q gi|254780444|r   24 PSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus        24 ~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      ..+||..+|++...|..|..+.
T Consensus        37 r~~LA~~l~l~~~qV~~WFqNr   58 (70)
T 2djn_A           37 RAELAASLGLTQTQVKIWFQNK   58 (70)
T ss_dssp             HHHHHHHSSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHH
T ss_conf             9999999787866746743402


No 457
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus}
Probab=20.26  E-value=30  Score=13.78  Aligned_cols=31  Identities=6%  Similarity=0.202  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHH
Q ss_conf             99999999999964999889999828998798
Q gi|254780444|r    7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSF   38 (223)
Q Consensus         7 ~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti   38 (223)
                      ++|-.-|.+|+.+ |.|+.+.-|++++++..+
T Consensus         7 e~~~~eI~~Lm~~-GYs~~~v~~AL~Ia~Nni   37 (53)
T 2d9s_A            7 GQLSSEIERLMSQ-GYSYQDIQKALVIAHNNI   37 (53)
T ss_dssp             SCSHHHHHHHHHH-TCCHHHHHHHHHHTTTCH
T ss_pred             CHHHHHHHHHHHC-CCCHHHHHHHHHHHHCCH
T ss_conf             1101899999985-544999999999986119


No 458
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A
Probab=20.24  E-value=36  Score=13.23  Aligned_cols=41  Identities=20%  Similarity=0.241  Sum_probs=26.1

Q ss_pred             CCCHHHHHHHHHHHHH-HCCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7558999999999999-64999---889999828998798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAE-RHNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~-~~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .+|.+++. .|+..-+ ..-.+   ..+||..+||+...|.-|...
T Consensus        15 ~ft~~Q~~-~Le~~F~~~~yP~~~~r~~LA~~lgl~~~qV~vWFqN   59 (77)
T 1nk2_P           15 LFTKAQTY-ELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQN   59 (77)
T ss_dssp             CCCHHHHH-HHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             CCCHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHHCHH
T ss_conf             98999999-9999998779989999999999949886572341620


No 459
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A
Probab=20.21  E-value=37  Score=13.23  Aligned_cols=42  Identities=21%  Similarity=0.268  Sum_probs=26.5

Q ss_pred             CCCCHHHHHHHHHHHHHH-CCCC---HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             775589999999999996-4999---889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAER-HNLT---PSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~-~gls---~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.+++. .|+..=.+ .-.|   ..+||..+|++...|..|...
T Consensus         8 t~ft~~Ql~-~Le~~F~~n~~Ps~~~r~~LA~~lgl~~~~V~~WFqN   53 (61)
T 2hdd_A            8 TAFSSEQLA-RLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKN   53 (61)
T ss_dssp             CCCCHHHHH-HHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHH
T ss_pred             CCCCHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHHCCHH
T ss_conf             989999999-9999998679979999999999979687880230554


Done!