HHSEARCH alignment of GI: 254780444 and SCOP domain: d1r71a_

Alignment
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]}
Probab=93.74  E-value=0.081  Score=28.89  Aligned_cols=42  Identities=14%  Similarity=0.249  Sum_probs=34.7

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCC
Q ss_conf             7558999999999999649998899998289987988997515
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG   45 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~   45 (223)
                      .||-=++..++++|.++ |+|+.++|+++|.+.++|+++.+-.
T Consensus        13 ~L~p~e~A~a~~~l~~~-g~s~~eiA~~~G~s~~~V~~~l~L~   54 (114)
T d1r71a_          13 ELTPREIADFIGRELAK-GKKKGDIAKEIGKSPAFITQHVTLL   54 (114)
T ss_dssp             CCCHHHHHHHHHHHHHT-TCCHHHHHHHHTCCHHHHHHHHGGG
T ss_pred             CCCHHHHHHHHHHHHHH-CCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             89999999999999880-9989999999777299999999996


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: KorB DNA-binding domain-like
family: KorB DNA-binding domain-like
domain: Transcriptional repressor protein KorB DNA-binding domain
species: Escherichia coli [TaxId: 562]