HHSEARCH alignment of GI: 254780444 and SCOP domain: d1umua_

Alignment
>d1umua_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]}
Probab=99.66  E-value=3.2e-16  Score=122.19  Aligned_cols=86  Identities=23%  Similarity=0.339  Sum_probs=75.2

Q ss_pred             CCCCEEEEEECCCCC-CCCCCCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHH-
Q ss_conf             368559999628332-421487868999368974058889999717968999999977987999968589887585478-
Q gi|254780444|r  133 IQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-  210 (223)
Q Consensus       133 ~~~~~~~l~V~GDSM-~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~-  210 (223)
                      .+...|+++|+|||| +|.|.+||+++||++.++.+|++|++.. +|+.++||+.. . +.+.|.|+||.|+|+.+..+ 
T Consensus        16 ~~~~~f~~rV~GdSM~~~gI~~GDlliVd~~~~~~~g~ivva~i-~ge~~vKrl~~-~-~~~~L~~~N~~y~~i~i~~~~   92 (105)
T d1umua_          16 HPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAV-DGEFTVKKLQL-R-PTVQLIPMNSAYSPITISSED   92 (105)
T ss_dssp             CGGGEEEEECCSSTTGGGTCCTTCEEEEETTSCCCTTCEEEEEE-TTEEEEEEEEC-S-SSCEEECSSTTSCCEECCTTS
T ss_pred             CCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEE-CCEEEEEEEEE-C-CCEEEECCCCCCCCEECCCCC
T ss_conf             98865999991885334760899899998255544575899999-99999999997-8-909998799999987859999


Q ss_pred             HEEEEEEEEEE
Q ss_conf             65999779985
Q gi|254780444|r  211 DIEWIARILWA  221 (223)
Q Consensus       211 ~i~iigrVvw~  221 (223)
                      +++|+|+|+++
T Consensus        93 ~~~I~GvVv~v  103 (105)
T d1umua_          93 TLDVFGVVIHV  103 (105)
T ss_dssp             CEEEEEEEEEE
T ss_pred             CEEEEEEEEEE
T ss_conf             78999999999


SCOP domain information

class: All beta proteins
fold: LexA/Signal peptidase
superfamily: LexA/Signal peptidase
family: LexA-related
domain: UmuD'
species: Escherichia coli [TaxId: 562]