HHSEARCH alignment of GI: 254780444 and SCOP domain: d2a6ca1

Alignment
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]}
Probab=98.77  E-value=1.5e-08  Score=72.52  Aligned_cols=64  Identities=13%  Similarity=0.080  Sum_probs=56.8

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             89999999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         6 ~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
                      ..++..+|.++|+++||||.+||+++|++++++++|++|.    .+.|+.++|.++|+++|++++...
T Consensus         4 ~~~l~~~i~~~r~~~gltq~elA~~~gv~~~~is~ie~g~----~~~~s~~~L~~ia~~Lg~~i~~~~   67 (69)
T d2a6ca1           4 RSQLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGK----IDLFSLESLIDMITSIGLKVEINI   67 (69)
T ss_dssp             HHHHHHHHHHHHHTTTCCHHHHHHHHTSCHHHHHHHHTTC----GGGCCHHHHHHHHHHTTCCCCCCC
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHCCC----CCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999999969999999999874784799997665----201008999999999199707651


SCOP domain information

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: NE1354
domain: HTH-motif protein NE1354
species: Nitrosomonas europaea [TaxId: 915]