HHSEARCH alignment of GI: 254780444 and SCOP domain: d2o7ta1

Alignment
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]}
Probab=91.41  E-value=0.29  Score=25.26  Aligned_cols=38  Identities=18%  Similarity=0.294  Sum_probs=30.1

Q ss_pred             CHHHHHHHHHHHHHHCC---CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             58999999999999649---998899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHN---LTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~g---ls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--++..+.|   +|-+++|+++|++.+++.++.
T Consensus         8 ~r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~t~y~~F   48 (78)
T d2o7ta1           8 RREHIITTTCNLYRTHHHDSLTMENIAEQAGVGVATLYRNF   48 (78)
T ss_dssp             HHHHHHHHHHHHHHHSCGGGCCHHHHHHHHTCCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHC
T ss_conf             99999999999999849140679999988399887999988


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Tetracyclin repressor-like, N-terminal domain
domain: Transcriptional regulator Cgl1640/Cg1846
species: Corynebacterium glutamicum [TaxId: 1718]