BLAST/PSIBLAST alignment of GI: 254780444 and GI: 325291874 at iteration 1
>gi|325291874|ref|YP_004277738.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3] Length = 216
>gi|325059727|gb|ADY63418.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3] Length = 216
 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/222 (49%), Positives = 147/222 (66%), Gaps = 9/222 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+ IW AID +A+RH LTPS LA++AGLD TSFNKSKRFG +GR RWPSTES+ K+L 
Sbjct: 2   LSHETIWSAIDTLAKRHQLTPSALAKRAGLDSTSFNKSKRFGPDGRKRWPSTESVSKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AT  ++ Q     F   +T +    +  IPLL F  +GSGGFFD G FP G  W+ V  P
Sbjct: 62  ATGASVDQFFGYAFGRTQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEFP 121

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                  G+YA++        Q  SM+PLYR GDILI+    QV  GDR+++K R G+++
Sbjct: 122 SSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAQVRRGDRVVLKSRDGEVM 174

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 175 AKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216