BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780444|ref|YP_003064857.1| bacteriophage repressor
protein C1 [Candidatus Liberibacter asiaticus str. psy62]
         (223 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040121|gb|ACT56917.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 223

 Score =  463 bits (1192), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/223 (100%), Positives = 223/223 (100%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK
Sbjct: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV
Sbjct: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI
Sbjct: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ
Sbjct: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223


>gi|315122107|ref|YP_004062596.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495509|gb|ADR52108.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 216

 Score =  357 bits (916), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 182/223 (81%), Positives = 195/223 (87%), Gaps = 7/223 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+KIWEAID+MA+RHNLTPSGLARKAGLDPTSFNKSKRFG+EGRNRWPSTESI K
Sbjct: 1   MTKFSHEKIWEAIDQMAKRHNLTPSGLARKAGLDPTSFNKSKRFGVEGRNRWPSTESISK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL ATNETICQ   + F + +  EKKEKEIPLL FPPS S GFFDSG FP GNKWNTVGV
Sbjct: 61  ILEATNETICQFFGILFLEEKNIEKKEKEIPLLDFPPSESSGFFDSGGFPAGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYAIQ        QDTSMLPLYRKGDILILN+AIQVNCGDR+LIKP  GDI
Sbjct: 121 PEIRSPHNGIYAIQ-------IQDTSMLPLYRKGDILILNAAIQVNCGDRVLIKPHEGDI 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            AKVLIS+RGRSIDLMSLNCCYPVDT++ SDIEWIA+ILWASQ
Sbjct: 174 EAKVLISQRGRSIDLMSLNCCYPVDTIDASDIEWIAKILWASQ 216


>gi|239834343|ref|ZP_04682671.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
 gi|239822406|gb|EEQ93975.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
          Length = 227

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 144/228 (63%), Gaps = 14/228 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K
Sbjct: 9   MTMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAK 68

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKE-----KEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           ++ AT  T  +   L   + RT +  E     + IPLL    +G+GG+FD   FP G  W
Sbjct: 69  VMEATGSTFDEFTRLIGGETRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGW 128

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P   S   G+YA++           SMLPLYR GD LI+     +  GDR++++ 
Sbjct: 129 DIVEFPA--STGEGVYALE-------VSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRT 179

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + G+++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 180 KDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESRDIEWVARILWASQ 227


>gi|92116178|ref|YP_575907.1| putative phage repressor [Nitrobacter hamburgensis X14]
 gi|91799072|gb|ABE61447.1| putative phage repressor [Nitrobacter hamburgensis X14]
          Length = 210

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MAMLTHAQIWTALDRLAERSGLSPSGLARKAGLDPTTFNKSKRITGDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +       R T+     +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIEDTARATQA----VPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PSVHDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTSIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKMIELQSLNPNHVNRTLAASDVEWIARIVWASQ 210


>gi|75674664|ref|YP_317085.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
 gi|74419534|gb|ABA03733.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
          Length = 210

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 143/226 (63%), Gaps = 19/226 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATN---ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
            LAAT    +T  Q ++        TE+  K +PLL F  +G+GG+FD G FP G  W+ 
Sbjct: 61  ALAATGTAIDTFVQFIE-------DTERAAKAVPLLGFAEAGAGGYFDDGGFPVGKGWDE 113

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           VG+P +   H   YA++           SM P YR GD+++++    +  GDR+++K R 
Sbjct: 114 VGLPCVNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRD 164

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++ K L  R  R+I+L SLN  +   T+  S++EWIARI+WASQ
Sbjct: 165 GEVMVKELKRRTARTIELQSLNPSHANRTLPASEVEWIARIVWASQ 210


>gi|15887830|ref|NP_353511.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
 gi|15155410|gb|AAK86296.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
          Length = 216

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 147/222 (66%), Gaps = 9/222 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+ IW AID +AERH LTPS LA++AGLDPTSFNKSKRFG +GR RWPSTES+ K+L 
Sbjct: 2   LSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGPDGRKRWPSTESVSKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AT  ++ Q     F   +T +    +  IPLL F  +GSGGFFD G FP G  W+ V  P
Sbjct: 62  ATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEFP 121

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                  G+YA++        Q  SM+PLYR GDILI+     V  GDR+++K R G+++
Sbjct: 122 SSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAPVRRGDRVVLKSRDGEVM 174

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 175 AKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|85713691|ref|ZP_01044681.1| peptidase S24 [Nitrobacter sp. Nb-311A]
 gi|85699595|gb|EAQ37462.1| peptidase S24 [Nitrobacter sp. Nb-311A]
          Length = 210

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +       R  +     +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIEDSARAAQA----VPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PAVNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  ++I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKTIELQSLNPSHANRTLPASDVEWIARIVWASQ 210


>gi|222084796|ref|YP_002543325.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722244|gb|ACM25400.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 221

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 150/227 (66%), Gaps = 14/227 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AID++AER+ LTPSGLAR+AGLDPTSFNKSKR G +GR RWPSTESI K+L 
Sbjct: 2   LSHEQIWSAIDKLAERYALTPSGLARRAGLDPTSFNKSKRLGQDGRLRWPSTESIAKVLG 61

Query: 64  ATNETICQLLDL--PFSDG-----RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  ++ Q L +  P   G       +      IPLL F  +GSGGFFD G FP G  W+
Sbjct: 62  ATGASMEQFLGILRPVERGDGNADHASSPPASSIPLLGFAQAGSGGFFDDGGFPAGQGWD 121

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++        Q  SMLPLYR GD+LI+    Q+   DR+++K R
Sbjct: 122 MVEFPAAPGQKGGVYALE-------VQGESMLPLYRDGDVLIVEPGAQIRRSDRVVVKTR 174

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AKVL+ +  +SI+L+SLN  +P  + +++D+EWIARI+WASQ
Sbjct: 175 EGEVMAKVLLRQSAKSIELLSLNPEHPNRSFDLADVEWIARIIWASQ 221


>gi|15964281|ref|NP_384634.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307307018|ref|ZP_07586757.1| putative phage repressor [Sinorhizobium meliloti BL225C]
 gi|307320672|ref|ZP_07600085.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|15073458|emb|CAC45100.1| Transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306893707|gb|EFN24480.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306901958|gb|EFN32557.1| putative phage repressor [Sinorhizobium meliloti BL225C]
          Length = 218

 Score =  201 bits (510), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 149/224 (66%), Gaps = 11/224 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL 
Sbjct: 2   LSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRQSTDGRDRWPSTESIAKILH 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE----IPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           AT  ++ Q L L   +   +E+++      IPL+ F  +G+GGFFD G FP G  W+T+ 
Sbjct: 62  ATGASVDQFLALMEPNAAGSEREDASAAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDTIE 121

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P       G YA++        Q  SMLPLYR GD+LI++ + QV   DR+++K R G+
Sbjct: 122 FPTPERRQGGTYALE-------VQGDSMLPLYRDGDVLIVDPSAQVRRNDRVVVKTRGGE 174

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AKVL  +  R I+L+SLN  +P    EM+D+EWIARI+WASQ
Sbjct: 175 VMAKVLARQTPRGIELVSLNPDHPNRNFEMNDVEWIARIIWASQ 218


>gi|325291874|ref|YP_004277738.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
 gi|325059727|gb|ADY63418.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
          Length = 216

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/222 (49%), Positives = 147/222 (66%), Gaps = 9/222 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+ IW AID +A+RH LTPS LA++AGLD TSFNKSKRFG +GR RWPSTES+ K+L 
Sbjct: 2   LSHETIWSAIDTLAKRHQLTPSALAKRAGLDSTSFNKSKRFGPDGRKRWPSTESVSKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AT  ++ Q     F   +T +    +  IPLL F  +GSGGFFD G FP G  W+ V  P
Sbjct: 62  ATGASVDQFFGYAFGRTQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEFP 121

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                  G+YA++        Q  SM+PLYR GDILI+    QV  GDR+++K R G+++
Sbjct: 122 SSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAQVRRGDRVVLKSRDGEVM 174

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 175 AKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|153011349|ref|YP_001372563.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
 gi|151563237|gb|ABS16734.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
          Length = 217

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 140/225 (62%), Gaps = 14/225 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAKVME 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKE-----KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           AT  T  +   L     RT +  E     + IPLL    +G+GG+FD   FP G  W+ V
Sbjct: 62  ATGSTFDEFTRLIRGGNRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGWDIV 121

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P       G+YA++           SMLPLYR GD LI+     +  GDR++++ + G
Sbjct: 122 EFPA--GSGEGVYALE-------VSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRTKDG 172

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 173 EVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWVARILWASQ 217


>gi|115522745|ref|YP_779656.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
 gi|115516692|gb|ABJ04676.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
          Length = 208

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/220 (44%), Positives = 140/220 (63%), Gaps = 13/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K LA
Sbjct: 2   LTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAKALA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           ATN  I   + L     R  +     +PLL F  +G+GG+FD G FP G  W+ VG+P++
Sbjct: 62  ATNTAIDSFVRLIGDRARPVQ----SVPLLGFAQAGAGGYFDDGGFPVGKGWDEVGLPQV 117

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H   YA++           SM P YR GD+++++    V  GDR+++K   G+++ K
Sbjct: 118 NDEH--AYALE-------ISGDSMKPAYRAGDVIVVSPGTPVRRGDRVVVKTNNGEVMVK 168

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  ++++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 169 ELKRRTSKTLELASLNPSHPDRTLAPADVEWIARIVWASQ 208


>gi|90422277|ref|YP_530647.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
 gi|90104291|gb|ABD86328.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
          Length = 208

 Score =  198 bits (503), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 142/220 (64%), Gaps = 13/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+AER  L+PSGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K LA
Sbjct: 2   LTHDQIWTALDRLAERAGLSPSGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAKALA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           ATN  I   + L   DG    +  + +PLL    +GSGG+FD G FP G  W+ VG+P +
Sbjct: 62  ATNTAIDAFVQL-IGDG---PRAVQSVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGLPSV 117

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H   YA++           SM P YR GD+++++    +  GDR+++K R G+++ K
Sbjct: 118 NDEH--AYALE-------ISGDSMKPAYRAGDVIVVSPGSPIRRGDRVVVKTRDGEVMVK 168

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  ++++L+SLN  +P  T+  +++EWIARI+WASQ
Sbjct: 169 ELKRRTAKTLELLSLNPSHPDRTLAPAEVEWIARIVWASQ 208


>gi|190890233|ref|YP_001976775.1| phage-related transcriptional regulator protein [Rhizobium etli
           CIAT 652]
 gi|190695512|gb|ACE89597.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CIAT 652]
          Length = 228

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (67%), Gaps = 21/234 (8%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDG----RTTEKKEK----------EIPLLYFPPSGSGGFFDSGVF 109
           AT  ++ Q L L    G    RT E+ ++           IPLL F  +G+GGFFD G F
Sbjct: 62  ATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPQGGAIPLLGFAQAGAGGFFDDGGF 121

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   D
Sbjct: 122 PAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRND 174

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 175 RVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|218516275|ref|ZP_03513115.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli 8C-3]
          Length = 228

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (67%), Gaps = 21/234 (8%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDG----RTTEKKEK----------EIPLLYFPPSGSGGFFDSGVF 109
           AT  ++ Q L L    G    RT E+ ++           IPLL F  +G+GGFFD G F
Sbjct: 62  ATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPEGGAIPLLGFAQAGAGGFFDDGGF 121

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   D
Sbjct: 122 PAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRND 174

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 175 RVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|327190883|gb|EGE57941.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CNPAF512]
          Length = 228

 Score =  197 bits (502), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (67%), Gaps = 21/234 (8%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDG----RTTEKKEK----------EIPLLYFPPSGSGGFFDSGVF 109
           AT  ++ Q L L    G    RT E+ ++           IPLL F  +G+GGFFD G F
Sbjct: 62  ATGASMEQFLALLPPGGTAAERTGERAQQPDSRFQPQGGAIPLLGFAQAGAGGFFDDGGF 121

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   D
Sbjct: 122 PAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRND 174

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 175 RVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|316932334|ref|YP_004107316.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
 gi|315600048|gb|ADU42583.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 100/223 (44%), Positives = 137/223 (61%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L     R  +     +PLL    +GSGG+FD G FP G  W  +G+
Sbjct: 61  ALQATNTAIDTFVQLIHDRPRVVQ----SVPLLGLAQAGSGGYFDDGGFPVGKGWEEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA+Q           SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSISDEH--AYALQ-------ISGDSMKPAYRHGDIVVVSPSAAVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +P  T+  S++EWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVIELASLNPSHPDRTLAPSEVEWIGRIVWASQ 210


>gi|39933872|ref|NP_946148.1| S24 family peptidase [Rhodopseudomonas palustris CGA009]
 gi|192289291|ref|YP_001989896.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|39647719|emb|CAE26239.1| Peptidase family S24 [Rhodopseudomonas palustris CGA009]
 gi|192283040|gb|ACE99420.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/223 (44%), Positives = 138/223 (61%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L     R  +     +PLL    +GSGG+FD G FP G  W+ VG+
Sbjct: 61  ALQATNTAIDTFVQLIHDRPRVVQ----SVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA++           SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSITDEH--AYALE-------ISGDSMKPAYRSGDIVVVSPSATVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  S+IEWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVVELASLNPSHPDRTLAPSEIEWIGRIVWASQ 210


>gi|116250339|ref|YP_766177.1| phage-related transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254987|emb|CAK06061.1| putative phage-related transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 225

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 154/231 (66%), Gaps = 18/231 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE-----------IPLLYFPPSGSGGFFDSGVFPTG 112
           AT  ++ Q L     D   +E++ ++           IPLL F  +G+GGFFD G FP G
Sbjct: 62  ATGASMEQFLAFMRPDAGPSEQQARQQENAFQPQGGSIPLLGFAQAGAGGFFDDGGFPAG 121

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR++
Sbjct: 122 QGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVV 174

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 175 VRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|13474687|ref|NP_106256.1| repressor protein CI [Mesorhizobium loti MAFF303099]
 gi|14025442|dbj|BAB52042.1| repressor protein CI [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/220 (44%), Positives = 139/220 (63%), Gaps = 9/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+ 
Sbjct: 2   LSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKIIE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++ +   L      T     + +PLL F  +G+GGFFD   FP G  W+ V +P  
Sbjct: 62  ATGASLDEFTGLIEGRMSTAPAHRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDLVELPAQ 121

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K  +G+++AK
Sbjct: 122 STESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTSGEVMAK 172

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 173 VLDRQTVKSIALVSLNPDHPDRDIPMREVEWVARIVWASQ 212


>gi|218671565|ref|ZP_03521235.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli GR56]
          Length = 223

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 155/229 (67%), Gaps = 16/229 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDL--PFSDGRTTEKKEK-------EIPLLYFPPSGSGGFFDSGVFPTGNK 114
           AT  ++ Q L    P ++       E+        IPLL F  +G+GGFFD G FP G  
Sbjct: 62  ATGASMEQFLAFMRPGANSSAELPGERAKPPHGGAIPLLGFAQAGAGGFFDDGGFPAGQG 121

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR++++
Sbjct: 122 WDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVVR 174

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 175 TREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 223


>gi|299134039|ref|ZP_07027232.1| putative phage repressor [Afipia sp. 1NLS2]
 gi|298590786|gb|EFI50988.1| putative phage repressor [Afipia sp. 1NLS2]
          Length = 207

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 139/220 (63%), Gaps = 14/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K LA
Sbjct: 2   LTHDQIWTALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTSDGRERWPSTESVAKALA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++   +    S  R+      ++PLL F  +GSGG+FD G FP G  W+ VG+P +
Sbjct: 62  ATGISVDTFVHFIESSSRSV-----QVPLLGFAEAGSGGYFDDGGFPVGKGWDEVGLPSV 116

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H   YA++           SM P YR GD+++++ +  +  GDR+++K + G+++ K
Sbjct: 117 NDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPSAPIRRGDRVVVKTKDGEVMVK 167

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  + I+L SLN  +   T+  S+IEWIARILWASQ
Sbjct: 168 ELRRRTQKVIELQSLNPAHSDRTLPTSEIEWIARILWASQ 207


>gi|260461922|ref|ZP_05810167.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
 gi|259032169|gb|EEW33435.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
          Length = 216

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/226 (43%), Positives = 142/226 (62%), Gaps = 17/226 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+ 
Sbjct: 2   LSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKIIE 61

Query: 64  ATNETICQLLDLPFSDGRTT------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT  ++ +   L   +GR        + + + +PLL F  +G+GGFFD   FP G  W+ 
Sbjct: 62  ATGASLDEFTGLI--EGRAGLVHDARDGRRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDL 119

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           V +P   +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K   
Sbjct: 120 VELPAQSTESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAATRKGDRVVVKTTA 170

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AKVL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 171 GEVMAKVLERQTVKSISLVSLNPDHPDRDISMREVEWVARIVWASQ 216


>gi|86356189|ref|YP_468081.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280291|gb|ABC89354.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 223

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 154/229 (67%), Gaps = 16/229 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SHK+IWEAIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHKQIWEAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDL--PFSDGRTTEKKEK-------EIPLLYFPPSGSGGFFDSGVFPTGNK 114
           AT  ++ Q L    P S        E+        IPLL F  +G+GGFFD G FP G+ 
Sbjct: 62  ATGASMEQFLAFMQPASSSSGERIGERAGPSPGGAIPLLGFAQAGAGGFFDDGGFPAGHG 121

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR++++
Sbjct: 122 WDVVEFPPKPSQRSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVVR 174

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             TG+++AKVL+ +  RSI+LMSLN  +P  T++++D++WIARI+WASQ
Sbjct: 175 TCTGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLADVDWIARIIWASQ 223


>gi|319785581|ref|YP_004145057.1| peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171469|gb|ADV15007.1| Peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 216

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/226 (43%), Positives = 142/226 (62%), Gaps = 17/226 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH ++W AID +AER++L+ SGLA++AGLD T+FNKSKR   +GR RWPSTES+ KI+ 
Sbjct: 2   LSHDRVWAAIDALAERYSLSASGLAKRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKIME 61

Query: 64  ATNETICQLLDLPFSDGR------TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT  ++ +   L   +GR       +  +   +PLL F  +G+GGFFD   FP G  W+ 
Sbjct: 62  ATGASLDEFTGL--IEGRAGASHAASVARRSSVPLLGFAQAGAGGFFDDAGFPAGQGWDL 119

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           + +P   +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K  +
Sbjct: 120 IELPTQSTESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTS 170

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AKVL  +  RSI L+SLN  +P   + M D+EW+ARI+WASQ
Sbjct: 171 GEVMAKVLERQTVRSIALVSLNPDHPDRDIPMRDVEWVARIVWASQ 216


>gi|227820746|ref|YP_002824716.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
 gi|227339745|gb|ACP23963.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
          Length = 217

 Score =  191 bits (486), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 109/223 (48%), Positives = 143/223 (64%), Gaps = 10/223 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI K+L 
Sbjct: 2   LSHDSIWRAIDALAERHQLSPSGLARRAGLDPTSFNKSKRQSPDGRDRWPSTESISKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKK---EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           AT  TI Q + L  S    + +       IPL+ F  +G+GGFFD G FP G  W+ V  
Sbjct: 62  ATGATIDQFMALLQSGSGPSSRTGLPAAGIPLIGFAQAGAGGFFDDGGFPVGQGWDEVDF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P        +YA++        Q  SMLPLYR GD+LI++    V  GDR+++K   G++
Sbjct: 122 PVAAQSKASVYALE-------VQGDSMLPLYRDGDVLIVDPGASVRRGDRVVLKSCEGEV 174

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK+L  +  R ++L+SLN  +P  + EM D+EWIARI+WASQ
Sbjct: 175 MAKILARQTSRGVELLSLNPDHPNRSFEMKDVEWIARIVWASQ 217


>gi|241202972|ref|YP_002974068.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856862|gb|ACS54529.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 225

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 151/231 (65%), Gaps = 18/231 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE-----------IPLLYFPPSGSGGFFDSGVFPTG 112
           AT  ++ Q +     D   +++   +           IPLL F  +G+GGFFD G FP G
Sbjct: 62  ATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGFAQAGAGGFFDDGGFPAG 121

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             W+ V  P   S   G+YA++        Q  SM+PLYR GD+LI+    QV   DR++
Sbjct: 122 QGWDVVEFPAAPSQKAGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVV 174

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 175 VRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|222147460|ref|YP_002548417.1| bacteriophage repressor protein [Agrobacterium vitis S4]
 gi|221734450|gb|ACM35413.1| bacteriophage repressor protein [Agrobacterium vitis S4]
          Length = 224

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 146/232 (62%), Gaps = 21/232 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+ IW AIDR+AE+++LTPSGLARKAGLDPTSFNKSKR G +GR RWPSTESI K+L 
Sbjct: 2   LSHETIWNAIDRLAEQYHLTPSGLARKAGLDPTSFNKSKRVGPDGRMRWPSTESIAKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP------------SGSGGFFDSGVFPT 111
           AT   I Q + L  +D        + +P   FPP            +GSGGFFD G FP 
Sbjct: 62  ATGARIDQFVTLISNDNHQVNAVHETLPDGNFPPQIGTIPLLGLAQAGSGGFFDDGGFPA 121

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V +P    P  G+YA++        Q  SM PLYR GDILI+     V  GDR+
Sbjct: 122 GQGWDLVDLPTSAKP--GVYALE-------IQGDSMKPLYRDGDILIVEPGAPVRRGDRV 172

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++K   G+++AKVL  +  R++DL+S+N  +P   ++M D+EWIARI+W SQ
Sbjct: 173 VVKTCDGEVMAKVLGRQTARTVDLISINPDHPNRVLDMQDVEWIARIIWVSQ 224


>gi|158422012|ref|YP_001523304.1| S24 family peptidase [Azorhizobium caulinodans ORS 571]
 gi|158328901|dbj|BAF86386.1| peptidase family S24 protein [Azorhizobium caulinodans ORS 571]
          Length = 222

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/230 (42%), Positives = 144/230 (62%), Gaps = 19/230 (8%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW AIDR+AE + L+ SGLA++AGLD T+FN+SKR   +GR RWPSTES+ KIL+
Sbjct: 2   LTHGQIWTAIDRLAEANGLSASGLAKRAGLDSTAFNRSKRITSDGRPRWPSTESVSKILS 61

Query: 64  ATNETICQLLDLPFSD-----GRTTE-----KKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           ATN ++   L L   +     G + E     + ++ IP +    +G GGFFD   FP G+
Sbjct: 62  ATNTSMRAFLALLEGEDIGPSGFSEEPAPPFRPQRAIPHIGLAQAGDGGFFDDAGFPVGS 121

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+ +  PE+   H   YA++           SMLPLYR GD+++++ A  V  GDR+++
Sbjct: 122 GWDEILFPEVEDEH--AYALE-------ISGDSMLPLYRPGDLVVVSPAASVRKGDRVVV 172

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K R G+++AK L+ R  R+++L SLN  Y   T+  +D+ WIARI+WASQ
Sbjct: 173 KTRDGEVLAKELVRRTARTVELRSLNPEYEGRTLAATDVLWIARIIWASQ 222


>gi|298290079|ref|YP_003692018.1| phage repressor [Starkeya novella DSM 506]
 gi|296926590|gb|ADH87399.1| putative phage repressor [Starkeya novella DSM 506]
          Length = 206

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 135/220 (61%), Gaps = 15/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW AID++AERH L+ S LA++AGLDPT+FN+SKR   +GR RWPSTESI KILA
Sbjct: 2   LTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPDGRARWPSTESIAKILA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++   + L     R      + IPL+ F  +G GG+FD   FP G  W+ +  P +
Sbjct: 62  ATGASLDDFMALIGGGTR------RAIPLIGFAQAGRGGYFDDAGFPVGGAWDEIEFPNV 115

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H   YA++           SMLPLYR GD+++++ A     GDR+++K R G+++AK
Sbjct: 116 GDEH--AYALE-------IAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEVMAK 166

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  ++++L SLN  +     +  +I WIAR+LWASQ
Sbjct: 167 ELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ 206


>gi|209547798|ref|YP_002279715.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533554|gb|ACI53489.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 225

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 150/231 (64%), Gaps = 18/231 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IW AIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L 
Sbjct: 2   LSHDQIWGAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVLD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE-----------IPLLYFPPSGSGGFFDSGVFPTG 112
           AT  ++ Q L     D   +++   +           IPLL F  +G+GGFFD G FP G
Sbjct: 62  ATGASVEQFLAFLQPDAGFSKRPAGQSDGAFPPQGSSIPLLGFAQAGAGGFFDDGGFPAG 121

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             W+ V  P   +  + +YA++        Q  SM+PLYR GD+LI+    QV   DR++
Sbjct: 122 QGWDVVEFPAAPAQKSAVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVV 174

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++   G+++AKVL+ +  RSI+LMSLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 175 VRTCEGEVMAKVLLRQSPRSIELMSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|323135593|ref|ZP_08070676.1| putative phage repressor [Methylocystis sp. ATCC 49242]
 gi|322398684|gb|EFY01203.1| putative phage repressor [Methylocystis sp. ATCC 49242]
          Length = 213

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 134/220 (60%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR    GR RWPSTESI K+L 
Sbjct: 5   LSHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRETASGRQRWPSTESIAKVLQ 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++ + + L  ++     K  +  PL+    +G+GGFFD   F  G  W+ + V   
Sbjct: 65  ATGASLDEFMALVSANSSACRKHTR--PLIGLAQAGAGGFFDDAGFAIGAGWDEIDVLAD 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H+  YA++           SM PLYR GD++I++ A  V  GDR+++K   G+I+AK
Sbjct: 123 ADEHS--YALE-------ISGDSMFPLYRDGDVVIVSPAAPVRRGDRVVVKTTDGEIMAK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  +  R+++L S+N  YP   +   ++ WIARILWASQ
Sbjct: 174 ELKRQTARTVELRSINPAYPDRVIPREEVSWIARILWASQ 213


>gi|150395367|ref|YP_001325834.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150026882|gb|ABR58999.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 215

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 147/221 (66%), Gaps = 8/221 (3%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL 
Sbjct: 2   LSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRRSADGRDRWPSTESISKILQ 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE-IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AT  T+ Q + L   +   +EK+    IPL+ F  +G+GGFFD G FP G  W+++  P 
Sbjct: 62  ATGATVDQFMALMQPNAAGSEKESAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDSIEFPT 121

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                 G YA++        Q  SMLPLYR GDILI++ + QV   DR++++ R G+++A
Sbjct: 122 AERRQTGAYALE-------VQGDSMLPLYRDGDILIVDPSAQVRRNDRVVVRTREGEVMA 174

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           KVL  +  R I+L+SLN  +P    EM ++EWIARI+WASQ
Sbjct: 175 KVLARQTPRGIELVSLNPDHPNRNFEMKEVEWIARIIWASQ 215


>gi|254712567|ref|ZP_05174378.1| Peptidase family S24 [Brucella ceti M644/93/1]
 gi|254715639|ref|ZP_05177450.1| Peptidase family S24 [Brucella ceti M13/05/1]
 gi|261217388|ref|ZP_05931669.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320261|ref|ZP_05959458.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922477|gb|EEX89045.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292951|gb|EEX96447.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 218

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 141/227 (62%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FPTG  W+
Sbjct: 62  ATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPTGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|265999054|ref|ZP_05464836.2| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
 gi|263092030|gb|EEZ16327.1| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
          Length = 223

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 141/229 (61%), Gaps = 17/229 (7%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLL-------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           + AT  T  + +        LP   G  T+     IPLL    +G+GG+FD   FP G  
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQG 123

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++
Sbjct: 124 WDIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVR 174

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 175 TRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|260564858|ref|ZP_05835343.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
 gi|260152501|gb|EEW87594.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
          Length = 223

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 141/229 (61%), Gaps = 17/229 (7%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLL-------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           + AT  T  + +        LP   G  T+     IPLL    +G+GG+FD   FP G  
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAKAGAGGYFDDAGFPAGQG 123

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++
Sbjct: 124 WDIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVR 174

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 175 TRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|288957020|ref|YP_003447361.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
 gi|288909328|dbj|BAI70817.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
          Length = 210

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 140/220 (63%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H  IW AIDR+A +H L+ SGLAR+AGLDPT+FNKSKR   +G+ RWPSTESI K+L 
Sbjct: 2   LKHTDIWRAIDRLAAQHGLSASGLARRAGLDPTTFNKSKRTTNDGKLRWPSTESISKVLD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++ + + L   DG  T   ++ +P++ +  +GS G+FD   FP G+ W+ +  P +
Sbjct: 62  ATGASLSEFVSL-VGDGAGTGPLQR-VPVIGYAQAGSAGYFDDAGFPAGSGWDELLFPSL 119

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
             PH   YA++           SM P+YR GD +I++ A Q+   DR++++ + G+++AK
Sbjct: 120 GDPH--AYALE-------ISGDSMEPVYRDGDTIIVSPAAQIRRNDRVVVRTKGGEVMAK 170

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            LI      I+L+S+N  +P  ++ ++D+ W+ARI+WASQ
Sbjct: 171 QLIRETATKIELLSINRAHPDRSIPLADVAWMARIIWASQ 210


>gi|225629264|ref|ZP_03787297.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237816924|ref|ZP_04595916.1| Repressor protein C [Brucella abortus str. 2308 A]
 gi|225615760|gb|EEH12809.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237787737|gb|EEP61953.1| Repressor protein C [Brucella abortus str. 2308 A]
          Length = 234

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 107/229 (46%), Positives = 141/229 (61%), Gaps = 17/229 (7%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 16  TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 75

Query: 62  LAATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           + AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  
Sbjct: 76  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQG 134

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++
Sbjct: 135 WDIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVR 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 186 TRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 234


>gi|154250891|ref|YP_001411715.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
 gi|154154841|gb|ABS62058.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
          Length = 214

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 132/220 (60%), Gaps = 10/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH ++W AID +A RH LT SGLA+ AGLDPT+FNKSKR    GR RWP+TES+ +IL 
Sbjct: 5   LSHNRLWAAIDALAGRHGLTASGLAKAAGLDPTTFNKSKRVTAAGRPRWPNTESLARILD 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++   L L  +DG      ++ +PL+    +G GGFFD   FP G+ W  V  P+ 
Sbjct: 65  ATGSSLEDFLVL-VADGEVAFTPQRHVPLIGLAQAGRGGFFDDAGFPVGSGWEEVAFPDF 123

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
           +  H   YA++           SM P YR GDI++++   ++  GDR+++K    +++AK
Sbjct: 124 KDEH--AYALE-------VSGDSMEPFYRAGDIIVVSPGAEIRRGDRVVVKTAGDEVMAK 174

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VL  +    IDL SLN  Y   +++  +I W+ARI+WASQ
Sbjct: 175 VLARKTATRIDLQSLNPAYEDRSLKPEEIVWMARIIWASQ 214


>gi|189022624|ref|YP_001932365.1| Peptidase family S24 [Brucella abortus S19]
 gi|260544608|ref|ZP_05820429.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261756989|ref|ZP_06000698.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306839063|ref|ZP_07471883.1| Peptidase family S24 [Brucella sp. NF 2653]
 gi|306841676|ref|ZP_07474363.1| Peptidase family S24 [Brucella sp. BO2]
 gi|189021198|gb|ACD73919.1| Peptidase family S24 [Brucella abortus S19]
 gi|260097879|gb|EEW81753.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261736973|gb|EEY24969.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306288206|gb|EFM59590.1| Peptidase family S24 [Brucella sp. BO2]
 gi|306405886|gb|EFM62145.1| Peptidase family S24 [Brucella sp. NF 2653]
          Length = 223

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/229 (46%), Positives = 141/229 (61%), Gaps = 17/229 (7%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           + AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  
Sbjct: 65  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQG 123

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++
Sbjct: 124 WDIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVR 174

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 175 TRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|225686559|ref|YP_002734531.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|256111295|ref|ZP_05452321.1| DNA-binding protein RDGA [Brucella melitensis bv. 3 str. Ether]
 gi|265992801|ref|ZP_06105358.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225642664|gb|ACO02577.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|262763671|gb|EEZ09703.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|326410945|gb|ADZ68009.1| Repressor protein C [Brucella melitensis M28]
 gi|326554236|gb|ADZ88875.1| Repressor protein C [Brucella melitensis M5-90]
          Length = 218

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 140/227 (61%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNETICQLL-------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T  + +        LP   G  T+     IPLL    +G+GG+FD   FP G  W+
Sbjct: 62  ATGATFDEFIRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|17988843|ref|NP_541476.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. 16M]
 gi|256043668|ref|ZP_05446593.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265990088|ref|ZP_06102645.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984666|gb|AAL53740.1| DNA-binding protein rdga [Brucella melitensis bv. 1 str. 16M]
 gi|263000757|gb|EEZ13447.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 218

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 140/227 (61%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNETICQLL-------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T  + +        LP   G  T+     IPLL    +G+GG+FD   FP G  W+
Sbjct: 62  ATGATFDEFIRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAKAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|23500526|ref|NP_699966.1| S24 family peptidase [Brucella suis 1330]
 gi|62317372|ref|YP_223225.1| S24 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|83269348|ref|YP_418639.1| S24 family peptidase [Brucella melitensis biovar Abortus 2308]
 gi|148558376|ref|YP_001257738.1| S24 family peptidase [Brucella ovis ATCC 25840]
 gi|161620851|ref|YP_001594737.1| repressor protein C [Brucella canis ATCC 23365]
 gi|163844918|ref|YP_001622573.1| hypothetical protein BSUIS_B0784 [Brucella suis ATCC 23445]
 gi|254695818|ref|ZP_05157646.1| Peptidase family S24 [Brucella abortus bv. 3 str. Tulya]
 gi|254698652|ref|ZP_05160480.1| Peptidase family S24 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700006|ref|ZP_05161834.1| Peptidase family S24 [Brucella suis bv. 5 str. 513]
 gi|254703127|ref|ZP_05164955.1| Peptidase family S24 [Brucella suis bv. 3 str. 686]
 gi|254705728|ref|ZP_05167556.1| Peptidase family S24 [Brucella pinnipedialis M163/99/10]
 gi|254720098|ref|ZP_05181909.1| Peptidase family S24 [Brucella sp. 83/13]
 gi|254732099|ref|ZP_05190677.1| Peptidase family S24 [Brucella abortus bv. 4 str. 292]
 gi|256015557|ref|YP_003105566.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|256157535|ref|ZP_05455453.1| Peptidase family S24 [Brucella ceti M490/95/1]
 gi|256253490|ref|ZP_05459026.1| Peptidase family S24 [Brucella ceti B1/94]
 gi|256256056|ref|ZP_05461592.1| Peptidase family S24 [Brucella abortus bv. 9 str. C68]
 gi|260167569|ref|ZP_05754380.1| Peptidase family S24 [Brucella sp. F5/99]
 gi|260759885|ref|ZP_05872233.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763123|ref|ZP_05875455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882275|ref|ZP_05893889.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216238|ref|ZP_05930519.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261220617|ref|ZP_05934898.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313149|ref|ZP_05952346.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261750489|ref|ZP_05994198.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753747|ref|ZP_05997456.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265985104|ref|ZP_06097839.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265996036|ref|ZP_06108593.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297249410|ref|ZP_06933111.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306846010|ref|ZP_07478577.1| Peptidase family S24 [Brucella sp. BO1]
 gi|23464158|gb|AAN33971.1| peptidase, S24 family [Brucella suis 1330]
 gi|62197565|gb|AAX75864.1| peptidase, S24 family [Brucella abortus bv. 1 str. 9-941]
 gi|82939622|emb|CAJ12611.1| Peptidase family S24:Peptidase S24, C-terminal [Brucella melitensis
           biovar Abortus 2308]
 gi|148369661|gb|ABQ62533.1| peptidase, S24 family [Brucella ovis ATCC 25840]
 gi|161337662|gb|ABX63966.1| Repressor protein C [Brucella canis ATCC 23365]
 gi|163675641|gb|ABY39751.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|255998217|gb|ACU49904.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|260670203|gb|EEX57143.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673544|gb|EEX60365.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260871803|gb|EEX78872.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917845|gb|EEX84706.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919201|gb|EEX85854.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261302175|gb|EEY05672.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740242|gb|EEY28168.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743500|gb|EEY31426.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550333|gb|EEZ06494.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264663696|gb|EEZ33957.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|297173279|gb|EFH32643.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306273645|gb|EFM55490.1| Peptidase family S24 [Brucella sp. BO1]
          Length = 218

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/227 (46%), Positives = 140/227 (61%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  W+
Sbjct: 62  ATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|254690871|ref|ZP_05154125.1| Peptidase family S24 [Brucella abortus bv. 6 str. 870]
 gi|260756453|ref|ZP_05868801.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260676561|gb|EEX63382.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 218

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 140/227 (61%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  W+
Sbjct: 62  ATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SL+  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLDPEHPNRIFESKDIEWIARILWASQ 218


>gi|256059031|ref|ZP_05449240.1| Peptidase family S24 [Brucella neotomae 5K33]
 gi|261322976|ref|ZP_05962173.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261298956|gb|EEY02453.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 218

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 140/227 (61%), Gaps = 17/227 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH+ +W AID +AER++L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++ 
Sbjct: 2   FSHESVWAAIDALAERYSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVME 61

Query: 64  ATNET-------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           AT  T       I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  W+
Sbjct: 62  ATGATFDEFTRLIAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|209883821|ref|YP_002287678.1| peptidase S24 [Oligotropha carboxidovorans OM5]
 gi|209872017|gb|ACI91813.1| peptidase S24 [Oligotropha carboxidovorans OM5]
          Length = 207

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 137/220 (62%), Gaps = 14/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K LA
Sbjct: 2   MTHDQIWAALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTNDGRERWPSTESVAKALA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++        S  RT      ++PLL F  +GSGG+FD G FP G  WN VG+P +
Sbjct: 62  ATGVSVDTFAHFIESSSRTV-----QVPLLGFAEAGSGGYFDDGGFPVGEGWNEVGLPSV 116

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H   YA++           SM P YR GD+++++    +  GDR+++K + G+++ K
Sbjct: 117 NDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGAPIRRGDRVVVKTKDGEVMVK 167

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  + I+L SLN  +P  T   ++I+WIARI+WASQ
Sbjct: 168 ELRRRTQKVIELQSLNPAHPDRTFPTAEIDWIARIVWASQ 207


>gi|154245416|ref|YP_001416374.1| putative phage repressor [Xanthobacter autotrophicus Py2]
 gi|154159501|gb|ABS66717.1| putative phage repressor [Xanthobacter autotrophicus Py2]
          Length = 225

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 136/233 (58%), Gaps = 22/233 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H ++W AID++AE+H L+ SGLAR++GLDPT+FN+SKR   +GR RWPSTESI K L+
Sbjct: 2   LTHGQVWRAIDQLAEQHGLSTSGLARRSGLDPTTFNRSKRITTDGRLRWPSTESIAKALS 61

Query: 64  ATNETICQLLDLPF--------SDGRTTEKKE-----KEIPLLYFPPSGSGGFFDSGVFP 110
           AT  +      +          + G   E +        IP + F  +GSGGFFD   FP
Sbjct: 62  ATGTSAELFFAMMVPADERHGGAHGFAEESQPLTGPIHAIPQIGFAQAGSGGFFDDAGFP 121

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G  W+ +  PE+   H   YA++           SM P+YR GDI++++    V  GDR
Sbjct: 122 VGTGWDEIAFPEVEDQH--AYALE-------IAGDSMQPVYRNGDIVVVSPGTPVRRGDR 172

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++K R G+++AK L+ +  R ++L SLN  +    + +  +EW+ARI+WASQ
Sbjct: 173 VVVKTREGEVLAKELVRKTTRHVELRSLNPAHEDRQIPLDQLEWMARIIWASQ 225


>gi|239787365|emb|CAX83841.1| Predicted transcriptional regulator [uncultured bacterium]
          Length = 210

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 138/221 (62%), Gaps = 17/221 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H  IW AIDR+A +H LT SGLARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L AT
Sbjct: 4   HADIWHAIDRLAFKHGLTASGLARKAGLDPTTFNKSKRTSPEGKLRWPSTESVAKVLTAT 63

Query: 66  NETICQ---LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
             +I +   ++D P   G       + IPL+    +GS G+FD   +PTG  W+ +  PE
Sbjct: 64  GASIAEFVTMIDNPDETGAV-----QRIPLIGLAQAGSDGYFDDAGYPTGAGWDEIPFPE 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  YA++       T D SM PLYR+GDI+I++ A Q+   DR+++K   G+++ 
Sbjct: 119 MGD--SKAYALEI------TGD-SMEPLYREGDIVIVSPAAQIRRADRVIVKTNDGEVMV 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L+ R  + +DL SLN  +P  ++ + ++  I R++WASQ
Sbjct: 170 KQLLRRTAKFVDLQSLNDQHPNRSLPIEEVALIHRVVWASQ 210


>gi|163761294|ref|ZP_02168369.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162281451|gb|EDQ31747.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 226

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 146/229 (63%), Gaps = 16/229 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW A+D +AERH LT SGLAR+AGLDPT+FNKSKR G +GR+RWPSTES+ K+L 
Sbjct: 5   LSHERIWSALDALAERHGLTASGLARRAGLDPTAFNKSKRRGADGRDRWPSTESLAKVLD 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKE---------IPLLYFPPSGSGGFFDSGVFPTGNK 114
           AT  ++   + L     R       E         IPLL F  +GSGGFFD G FP G  
Sbjct: 65  ATGSSLNDFMSLVVGGQRNDASAIPEGAFPPQAGSIPLLGFAQAGSGGFFDDGGFPAGQG 124

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P   S   G+YA++        Q  SMLPLYR GDILI+    QV  GDR++++
Sbjct: 125 WDVVDFPAQPSERPGVYALE-------VQGDSMLPLYRDGDILIVEPGAQVRRGDRVVVR 177

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
              G+++AKVL     RS++L+SLN  +P  + E+S+I+W+ARI+WASQ
Sbjct: 178 SGEGEVMAKVLNRLSPRSVELISLNPDHPNRSFELSEIDWMARIIWASQ 226


>gi|296446773|ref|ZP_06888712.1| putative phage repressor [Methylosinus trichosporium OB3b]
 gi|296255776|gb|EFH02864.1| putative phage repressor [Methylosinus trichosporium OB3b]
          Length = 213

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 131/220 (59%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR   +G  RWPSTESI K+L 
Sbjct: 5   LTHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRQTADGHLRWPSTESIAKVLQ 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT   + + + L  S G    +  +  PL+    +G GGFFD   F  G  W  + V   
Sbjct: 65  ATGAGLDEFMTLVSSKGARPSRSAR--PLIGLAQAGVGGFFDDAGFAIGAGWEEIDVLAD 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H+  YA++           SM PLYR GDI+I++ +  V  GDR+++K   G+I+AK
Sbjct: 123 TDEHS--YALE-------ISGDSMAPLYRDGDIVIVSPSAPVRRGDRVVVKTIAGEILAK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  +  ++++L SLN  +P   +   ++ W+ARILWASQ
Sbjct: 174 ELKRQTAKTVELKSLNPAFPDRVLPKEEVSWMARILWASQ 213


>gi|86751722|ref|YP_488218.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
 gi|86574750|gb|ABD09307.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L     R  +     +PLL    +G+GGFFD G FP G  W+ +G+
Sbjct: 61  ALAATNTAIDTFVQLITDRPRVVQ----SVPLLGLAQAGAGGFFDDGGFPAGKGWDEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA++           SM P YR GDI++++    +  GDR+++K  +G++
Sbjct: 117 PSINDEH--AYALE-------ISGESMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTSGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHPDRTLAPADVEWIARIVWASQ 210


>gi|188581313|ref|YP_001924758.1| phage repressor [Methylobacterium populi BJ001]
 gi|179344811|gb|ACB80223.1| putative phage repressor [Methylobacterium populi BJ001]
          Length = 210

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 134/221 (60%), Gaps = 13/221 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L+
Sbjct: 2   LSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVLS 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVPE 122
           AT  ++   L L    G+ + +    +PL+    +GSG  F     PTG   W+ +  P+
Sbjct: 62  ATGASLDDFLHL-VDSGQASAR--TMVPLIGLTQAGSGRLFTEEGIPTGGPGWDEIEFPD 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G++VA
Sbjct: 119 LGGDH--AFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVVA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 170 KELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|163851531|ref|YP_001639574.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163663136|gb|ABY30503.1| peptidase S24 and S26 domain protein [Methylobacterium extorquens
           PA1]
          Length = 210

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 133/221 (60%), Gaps = 13/221 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+LA
Sbjct: 2   LSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVLA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVPE 122
           AT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P+
Sbjct: 62  ATGASLDDFLHLVDSGQGPTRTM---VPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFPD 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++A
Sbjct: 119 LGG--DRAFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVLA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  R+I+L SLN  +    V ++D+ W+AR++W  Q
Sbjct: 170 KELRRRTARTIELASLNPDHEDRAVPLADVAWMARVMWVRQ 210


>gi|144899439|emb|CAM76303.1| Peptidase S24, S26A and S26B [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 212

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 130/220 (59%), Gaps = 9/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H  IW A+D +A  + LT S LAR+AGLDPT+FNKSKR   EG+ RWPSTES+ K+L 
Sbjct: 2   LTHADIWAALDSLARDNGLTASALARRAGLDPTTFNKSKRITREGKLRWPSTESVAKVLD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++ QLL+           K   IPL+    +G  G+FD   +P G  W+ +  PE+
Sbjct: 62  ATGSSLGQLLNYIDDSLPAPVVKGATIPLIGSAQAGDRGYFDDAGYPCGGGWDEIPFPEV 121

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
               +  YA++           SM PLYR GDI+I++ A  V  GDR+++K   G+++ K
Sbjct: 122 G--DSNAYALE-------VSGDSMEPLYRDGDIVIVSPAASVRRGDRVVVKTLEGEVMVK 172

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            LI +  + I+L SLN  +P  ++   ++ W+ARILWASQ
Sbjct: 173 QLIRQTAKRIELASLNPAHPGRSLAAEEVSWLARILWASQ 212


>gi|254561298|ref|YP_003068393.1| LexA/Signal peptidase [Methylobacterium extorquens DM4]
 gi|254268576|emb|CAX24533.1| putative LexA/Signal peptidase [Methylobacterium extorquens DM4]
          Length = 210

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 133/221 (60%), Gaps = 13/221 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+LA
Sbjct: 2   LSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVLA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVPE 122
           AT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P+
Sbjct: 62  ATGASLDDFLHLVDSGQAPTRTM---VPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFPD 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++A
Sbjct: 119 LGG--DRAFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVLA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 170 KELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|218530341|ref|YP_002421157.1| phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240138699|ref|YP_002963171.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
 gi|218522644|gb|ACK83229.1| putative phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240008668|gb|ACS39894.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
          Length = 210

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 133/221 (60%), Gaps = 13/221 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+LA
Sbjct: 2   LSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVLA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVPE 122
           AT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P+
Sbjct: 62  ATGASLDDFLHLVDSGQGPTRTM---VPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFPD 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++A
Sbjct: 119 LGG--DRAFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVLA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 170 KELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|110632380|ref|YP_672588.1| putative phage repressor [Mesorhizobium sp. BNC1]
 gi|110283364|gb|ABG61423.1| putative phage repressor [Chelativorans sp. BNC1]
          Length = 214

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 11/222 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+K+W AID +A RH+L+ SGLARKAGLD T+FN+SKR   +GR RWPSTES+ KI+ 
Sbjct: 2   LSHEKVWAAIDALAARHSLSASGLARKAGLDSTAFNRSKRHSPDGRPRWPSTESLAKIMD 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEI--PLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AT  T+ +   L      +  +K   I  PL+ F  +G+GG+F    FP G  W  V +P
Sbjct: 62  ATGVTLGEFTALIEEMAESGRRKPGRISVPLIGFAQAGAGGYFTDAGFPVGQGWEQVELP 121

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
              S     YA++        Q  SMLPLYR GD+L++  +  V  GDR++++   G+++
Sbjct: 122 GQVS--EAAYALE-------VQGDSMLPLYRNGDVLVVEPSAPVRRGDRVVVRTLDGEVM 172

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK+L+ +  R ++L+SLN  +P   +   +++WIARI+WASQ
Sbjct: 173 AKILLRQTSRQMELLSLNPDHPNRVLGHEEVDWIARIVWASQ 214


>gi|209966574|ref|YP_002299489.1| peptidase family S24, putative [Rhodospirillum centenum SW]
 gi|209960040|gb|ACJ00677.1| peptidase family S24, putative [Rhodospirillum centenum SW]
          Length = 214

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 136/220 (61%), Gaps = 11/220 (5%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H +IW AIDR+A RH L+ SGLA++ GLDPT+FN+SKR   +G+ RWPSTES+ K+L AT
Sbjct: 4   HAEIWRAIDRLAARHGLSASGLAKRGGLDPTTFNRSKRVTHDGKLRWPSTESLAKVLEAT 63

Query: 66  NETICQLLDLPFSD--GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           N T   L+ L      G+      + +P++ +  +GS GFFD   +P GN W+ +  P +
Sbjct: 64  NSTFADLVALAGDGPVGQAAPVHVQRVPVIGYAQAGSDGFFDDAGYPVGNGWDELEFPHL 123

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
             P+   YA++           SM PLYR GD++I++    V  GDR++++ R G+++AK
Sbjct: 124 GDPN--AYALE-------ISGDSMEPLYRDGDVIIVSPGASVRRGDRVVVRTREGEVMAK 174

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L       ++L SLN  +P  T+ M+++ W+ARILWASQ
Sbjct: 175 QLARLTANRLELQSLNKAHPDRTLAMTEVAWMARILWASQ 214


>gi|23015760|ref|ZP_00055528.1| COG2932: Predicted transcriptional regulator [Magnetospirillum
           magnetotacticum MS-1]
          Length = 211

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 129/220 (58%), Gaps = 10/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L 
Sbjct: 2   LKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRVTREGKPRWPSTESVAKVLE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  T+   +     D     +    IPL+ F  +G  G+FD   +P G  W+ +  PEI
Sbjct: 62  ATGATMTAFVGY-IEDTAQARQTANTIPLIGFAQAGDCGYFDDAGYPVGGSWDEIPFPEI 120

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
             PH   YA++           SM PLYR GD++I++ A  V  GDR++++   G+++ K
Sbjct: 121 GDPHA--YALE-------VSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEVMVK 171

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L+ +  + I+L S+N  +P  ++   ++ WIARILW+SQ
Sbjct: 172 QLVRQTAKRIELASINPAHPGRSLATEEVAWIARILWSSQ 211


>gi|170746983|ref|YP_001753243.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
 gi|170653505|gb|ACB22560.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
          Length = 210

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 133/225 (59%), Gaps = 21/225 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTES+ K+LA
Sbjct: 2   LSHEQIWNAIDRLAERHGYSASGLARRAGLDATSFNRSKRVGADGRKRWPSTESVSKVLA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKE----KEIPLLYFPPSGSGGFFDSGVFPTGNK-WNTV 118
           AT  ++ + L       R  E +E      +PL+    +G+G  F     PTG   W  +
Sbjct: 62  ATGSSLDEFL-------RLIEAREIPARTMVPLIGLTQAGAGRLFTDEGMPTGGAGWEEI 114

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P++       +A++        Q  SMLPL+R GD+LI++    V  GDR++++   G
Sbjct: 115 EFPDLGEER--AFALE-------IQGDSMLPLFRDGDVLIVSPTASVRKGDRVVVRLHGG 165

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK L  R  R+++L SLN  +    + + ++ W+AR++W  Q
Sbjct: 166 EVLAKELRRRTARTVELASLNPEHEDRVLNLGEVAWMARVMWVRQ 210


>gi|328544878|ref|YP_004304987.1| peptidase S24-like domain protein [polymorphum gilvum SL003B-26A1]
 gi|326414620|gb|ADZ71683.1| Peptidase S24-like domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 215

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 130/223 (58%), Gaps = 12/223 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+++W AID +A R  L+PSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+L 
Sbjct: 2   LSHERVWAAIDALATRKGLSPSGLARRAGLDPTTFNPSKRIAGDGRPRWPSTESLAKVLE 61

Query: 64  ATNETICQLLDL--PF-SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           AT   + + + L  P  +D          +P          G+FD    P G  W+ +  
Sbjct: 62  ATGAPLAEFVALAAPLETDSAPPATSPMTVPFAGLDRVACEGYFDPTGNPIGRNWDEIPF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P++R     +YA++           ++LP+YR GDIL++   + V  GDR+++K ++G++
Sbjct: 122 PDLRG--EILYALE-------VSGNALLPVYRDGDILVVAPDVPVRRGDRVIVKVKSGEV 172

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + ++L  R  R+++L SL     V   E+  IEWIARI+WASQ
Sbjct: 173 IIRLLHRRTARTVELHSLAPSGTVHQCELDSIEWIARIVWASQ 215


>gi|83313328|ref|YP_423592.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82948169|dbj|BAE53033.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 223

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 129/220 (58%), Gaps = 10/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L 
Sbjct: 14  LKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRITREGKPRWPSTESVAKVLE 73

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++   +     D      +   IPL+ F  +G  G+FD   +P G  W+ +  PEI
Sbjct: 74  ATGASMTAFVAY-IEDLAQPHNQASTIPLVGFAQAGDRGYFDDAGYPVGGSWDEIPFPEI 132

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
             PH   YA++           SM PLYR GD++I++ A  V  GDR++++   G+++ K
Sbjct: 133 GDPH--AYALE-------VSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEVMVK 183

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L+ +  R I+L S+N  +P  ++   ++ W+ARILW+SQ
Sbjct: 184 QLLRQTARRIELGSINPAHPGRSLATEEVAWMARILWSSQ 223


>gi|91975266|ref|YP_567925.1| putative phage repressor [Rhodopseudomonas palustris BisB5]
 gi|91681722|gb|ABE38024.1| peptidase S24, S26A and S26B [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 135/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+ SGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MHMLTHDQIWTALDRLAERAGLSASGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L     R  +     +PLL    +G+GGFFD G FP G  W  VG+
Sbjct: 61  ALAATNTAIDTFVQLITDRPRVVQ----SVPLLGLAQAGAGGFFDDGGFPAGKGWEEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GDI++++    +  GDR+++K   G++
Sbjct: 117 PSVNDEH--AYALE-------ISGDSMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTGGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +   T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHADRTLAPADVEWIARIVWASQ 210


>gi|114704909|ref|ZP_01437817.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
 gi|114539694|gb|EAU42814.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
          Length = 216

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 96/224 (42%), Positives = 141/224 (62%), Gaps = 13/224 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH +IW AID +A+R+ LTPSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ KI  
Sbjct: 2   FSHDEIWSAIDALAKRNGLTPSGLARKAGLDPTTFNKSKRQSTDGRPRWPSTESLSKIFE 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEK----EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           A N +      L   D   ++ K +     +PLL    +G GGFFD   FP G+ W+ + 
Sbjct: 62  AVNSSFGDFAQLVSGDDAESDSKVRSKPVSVPLLGLAEAGGGGFFDDAGFPAGHGWDEIT 121

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           +P+ +     +YA++           SM PLYR+GD ++++    V  GDR+++K R G+
Sbjct: 122 LPDGK--DEPMYALE-------VSGRSMEPLYREGDRIVVSPTASVRRGDRVVVKTREGE 172

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK+L  +  R+I+L SLN  +P+    + +I+W+ARI+WA+Q
Sbjct: 173 VMAKILQRQTARTIELSSLNPDFPLRQFAVEEIDWLARIVWATQ 216


>gi|114799918|ref|YP_759340.1| S24 family peptidase [Hyphomonas neptunium ATCC 15444]
 gi|114740092|gb|ABI78217.1| peptidase, S24 family [Hyphomonas neptunium ATCC 15444]
          Length = 205

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 119/220 (54%), Gaps = 15/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             HK IW  +D +A  H LT S LA++AGLDPTSFN SKR   +GR RWPSTES+ ++L 
Sbjct: 1   MQHKDIWRGLDLLAAHHGLTASALAKRAGLDPTSFNPSKREAADGRPRWPSTESLARVLD 60

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A          L         ++    PL+ F  +G  GFFD   FP G  W  V  P +
Sbjct: 61  AVGAGFDDFAAL------VEGRRGGSAPLIGFAQAGQDGFFDDAGFPVGAGWEEVRFPGL 114

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +    +YA++           SM P YR GD +I+    +V  GDR++ K   G+++AK
Sbjct: 115 GA--ETVYALE-------ISGDSMEPAYRAGDRIIVAPGAEVKPGDRVVAKTVAGEVMAK 165

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VL  +  R I+L SLN  YP    + S++ W+ARILWASQ
Sbjct: 166 VLARKNTRLIELASLNPAYPAREFKPSEVAWLARILWASQ 205


>gi|315499624|ref|YP_004088427.1| phage repressor [Asticcacaulis excentricus CB 48]
 gi|315417636|gb|ADU14276.1| putative phage repressor [Asticcacaulis excentricus CB 48]
          Length = 209

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/226 (41%), Positives = 132/226 (58%), Gaps = 23/226 (10%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG--RNRWPSTESIFK 60
           S SH +IW AIDR+A     +PSGLAR AGLDPT+FNKSKR   E   R RWPSTES+ K
Sbjct: 2   SLSHAQIWNAIDRLARNLGTSPSGLARLAGLDPTAFNKSKRQSTEDPPRPRWPSTESLAK 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           +L AT ++      L       TE +   K +PL+ F  +G+ G FD   FP G  W+ +
Sbjct: 62  VLDATGQSFPDFAAL-------TEPRPVPKGVPLIGFAQAGNDGLFDDAGFPVGQGWDEI 114

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRT 177
           G+P       G+YA++           SMLPLYR GD +I++   Q +  GDR+++K   
Sbjct: 115 GLPA----GEGLYALE-------ISGDSMLPLYRDGDRIIVDPLRQNLRRGDRVVVKTSE 163

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AK L+    + ++L SLN  +    +E S + W+ARI+WASQ
Sbjct: 164 GEVMAKELVRLTEKQVELRSLNPDFSNRVLERSQVTWLARIVWASQ 209


>gi|254292703|ref|YP_003058726.1| phage repressor [Hirschia baltica ATCC 49814]
 gi|254041234|gb|ACT58029.1| putative phage repressor [Hirschia baltica ATCC 49814]
          Length = 206

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 125/219 (57%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKILAA 64
           H  IW  ID +A RH L+ S LAR AGLD T+FNKSKR   +G + RWPSTES+ K LAA
Sbjct: 3   HSDIWNGIDALAARHGLSVSALARAAGLDATAFNKSKRASADGSKPRWPSTESLSKALAA 62

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                 +  D+  + GR    + + IPL+    +G GGFFD   FP G  W+ +  P++ 
Sbjct: 63  VGTGWEEFADM--AQGR----QGRTIPLIGLAQAGDGGFFDDAGFPVGASWDDIHFPDMG 116

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                +YA++           SM P++R+GD +I+   + V  GDR++ K + G+++AK 
Sbjct: 117 D--ETVYALEISGD-------SMEPVFREGDRIIVAPGMDVRRGDRVVAKTKEGEVLAKF 167

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           L       ++L+S N  YP      SDIEWIARILWASQ
Sbjct: 168 LGHLSASRVELISANPAYPPREFAASDIEWIARILWASQ 206


>gi|83859576|ref|ZP_00953096.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
 gi|83851935|gb|EAP89789.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
          Length = 210

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 126/224 (56%), Gaps = 15/224 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIF 59
           M   +H +IW  IDR+A R  LTPSGLAR+AGLDPT+FN SKR   +G + RWPSTES+ 
Sbjct: 1   MPMLTHAQIWSGIDRLAHRAGLTPSGLARRAGLDPTTFNPSKRTSADGAKPRWPSTESLA 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K L AT  +      L    G T  +    +PLL F  +G  G+FD   FPTG  W  + 
Sbjct: 61  KALEATRVSFDDFAALAM--GHTAGRS---VPLLGFAQAGDHGYFDDAGFPTGEGWEDIR 115

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P       G YA++           SM P+YR GD ++++       GDR+++K R+G+
Sbjct: 116 FPGDEG--EGAYALEISGE-------SMSPVYRHGDRIVVSPDAPPRRGDRVVVKTRSGE 166

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK L      S++L+SLN  Y    +   D+ W+ARI+WASQ
Sbjct: 167 VMAKELGRVTAESVELISLNPSYDNRILSTRDLVWMARIVWASQ 210


>gi|90418702|ref|ZP_01226613.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336782|gb|EAS50487.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 215

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 142/225 (63%), Gaps = 16/225 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSH +IW AID +A RH ++PSGLAR+AGLDPT+FNKSKR   +GR RWPSTESI K++A
Sbjct: 2   FSHDRIWLAIDALATRHRMSPSGLARRAGLDPTTFNKSKRNASDGRPRWPSTESIAKVIA 61

Query: 64  ATNETICQLLDLPFSDGRT-----TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           AT  +I +   L    G T     +      +PLL F  +G GGFFD   FP G  W+ +
Sbjct: 62  ATGTSIEEFAAL--MRGETPGVPRSPSPAMSVPLLGFAEAGGGGFFDDSGFPAGQGWDEI 119

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P   +    +YA++           SM+PLYR GDILI++ A  V  GDR++++ R G
Sbjct: 120 ALPS--TGDETVYALE-------VSGQSMMPLYRDGDILIVSPAAAVRRGDRVVVRTREG 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK+L  +  R+I+L S N  +P    +M ++EW+ARILWASQ
Sbjct: 171 EVMAKILQRQTSRTIELASTNPDFPDRQFQMDEVEWMARILWASQ 215


>gi|302383458|ref|YP_003819281.1| phage repressor [Brevundimonas subvibrioides ATCC 15264]
 gi|302194086|gb|ADL01658.1| putative phage repressor [Brevundimonas subvibrioides ATCC 15264]
          Length = 211

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 126/224 (56%), Gaps = 17/224 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTESIFK 60
           S SH ++W A+D +A R  L+ S LARKAGLD T+FN SKRF  G+  R RWPSTES+  
Sbjct: 2   SLSHDRLWTALDTLARRQGLSSSALARKAGLDATAFNPSKRFGPGVPPRPRWPSTESLNL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL AT  ++ +   L          +    PLL    +G+ GFFD    PTG+ W    +
Sbjct: 62  ILEATGTSLAEFAAL----ADDAPARIATAPLLGMAQAGADGFFDDAGLPTGDGWEQTDL 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGD 179
           P   SP   ++++            SM+PLYR+GD +L+      V  GDR++ + R+G+
Sbjct: 118 P---SPKESLFSLL-------ISGDSMVPLYREGDRVLVDRERTDVRKGDRVVARTRSGE 167

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            +AK + +   R++ L S+N  YP   +  +D++W+ARILW SQ
Sbjct: 168 TLAKQIEALTARTVTLASINPAYPPRVLARADVDWMARILWVSQ 211


>gi|170741440|ref|YP_001770095.1| peptidase S24/S26 domain-containing protein [Methylobacterium sp.
           4-46]
 gi|168195714|gb|ACA17661.1| peptidase S24 and S26 domain protein [Methylobacterium sp. 4-46]
          Length = 209

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 118/217 (54%), Gaps = 12/217 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IW AID +A+RH LTPSGLA++AGLDPTSFN+SKR   +GR RWPSTES+ KILA
Sbjct: 2   LSHDRIWSAIDHLAQRHRLTPSGLAKRAGLDPTSFNRSKRVAPDGRRRWPSTESLAKILA 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  T+ + + L              +PL+        G       PTG+ W+ +  P++
Sbjct: 62  ATGATLDEFVQLVSP---RAAAGAAVVPLIGSAALAVAGRIGPDGRPTGSAWDELDFPDL 118

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +       +Q  D R         PLY  GD+L++ +   +  GDR+L+  RTG +V  
Sbjct: 119 GTQDCFAIEVQGNDLR---------PLYHDGDVLVVCATAPMRRGDRILVSLRTGALVGA 169

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           VL  R  R  DL  +       ++  ++I W+ARI+W
Sbjct: 170 VLRRRTARVADLAPVMPGEAARSIATAEIAWMARIMW 206


>gi|326403286|ref|YP_004283367.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
 gi|325050147|dbj|BAJ80485.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
          Length = 223

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 121/232 (52%), Gaps = 21/232 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL+
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 64  ATNETICQLLDL-------PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           A++  I     L       P    R      + +PL     +G GGFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAVRTVPLASLAQAGQGGFFDEGGNPTGGGWD 120

Query: 117 TVGVPE-----IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
            + +P         PH     IQ           SM P+YR GDI++++ A  V  GDR+
Sbjct: 121 RIALPVGDAGIAGDPHAFALTIQGD---------SMDPVYRDGDIIVVSPASPVRTGDRV 171

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +I+   G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 172 VIRTAGGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|295687529|ref|YP_003591222.1| putative phage repressor [Caulobacter segnis ATCC 21756]
 gi|295429432|gb|ADG08604.1| putative phage repressor [Caulobacter segnis ATCC 21756]
          Length = 214

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 127/225 (56%), Gaps = 13/225 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE--GRNRWPSTESI 58
           M + SH +IW AID +A+R ++TPS +AR AGLDPTSFN+SKR   E  GR RWPSTES+
Sbjct: 1   MATLSHGEIWRAIDALADRFDMTPSAMARMAGLDPTSFNRSKRGSTEADGRARWPSTESL 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            K+L AT     +   L           ++  PL+    +G  GFFD+   P G+ W+ V
Sbjct: 61  AKLLEATGVNFSEFAALTEQSPGAGAGGKRGAPLIGLAQAGQEGFFDAAGMPVGSGWDEV 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P++     G++A++           ++ P+YR GD L+++  ++   GDR++ +   G
Sbjct: 121 AAPDL---GQGLFALE-------VSGETLAPVYRDGDRLLVSPTVEPRKGDRVVARTHAG 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++ + L     R+I+L++L        +   ++ WIARI+WASQ
Sbjct: 171 EVLVRELGRVTARTIELLALGRESD-RLLSRDEVAWIARIVWASQ 214


>gi|254504422|ref|ZP_05116573.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
 gi|222440493|gb|EEE47172.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
          Length = 221

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 123/220 (55%), Gaps = 9/220 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+K+W AID +A  + +TPSGLA++AGLDPT+FN+SKRF  +GR RWPSTES+ KIL 
Sbjct: 11  LSHEKVWAAIDALASYNEMTPSGLAKRAGLDPTTFNRSKRFAGDGRPRWPSTESLAKILE 70

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT E++        +           +P+  F        FD+   PTG  W T+  P  
Sbjct: 71  ATGESLKSFAGRVEAPELRPSTTLSALPVAGFSNVHEENAFDTTGRPTGEHWETIVFPTD 130

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +    I+A++           ++LPLYRKGD++++  +  V  GDR+++KP  G +   
Sbjct: 131 HT--QNIFALE-------VSGDALLPLYRKGDLIVVAPSAAVRRGDRIVLKPSEGGLAVY 181

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L+ R  +++ + ++        +  S IEW ARI+WASQ
Sbjct: 182 TLLKRTPKTLQVQTIGDNPENAALLHSAIEWTARIIWASQ 221


>gi|254420759|ref|ZP_05034483.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
 gi|196186936|gb|EDX81912.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
          Length = 211

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 121/223 (54%), Gaps = 17/223 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFKI 61
            SH K+W+A+D +A R  L+PSGLAR+AGLD TSFN SKRFG     R RWPSTES+  +
Sbjct: 3   LSHAKLWKAVDALARREGLSPSGLARRAGLDATSFNPSKRFGAGDPPRPRWPSTESMTLM 62

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L AT  ++ +   L              +PLL    +G  GFFD    P G+ W+   +P
Sbjct: 63  LQATGVSLAEFAAL----ADDAPPTSTTVPLLGLARAGLDGFFDDAGLPVGDGWDQTELP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDI 180
            + +    +          +    SM PLYR+GD +I++     V  GDR++ +  +G++
Sbjct: 119 RVNATTFSL----------RISGDSMAPLYREGDRVIVDRGDPAVRRGDRVVARLTSGEV 168

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VAK L     R+  L S+N  YP   V   +IEW+ARILW SQ
Sbjct: 169 VAKELTGLTARAATLSSINPDYPPRIVPRREIEWMARILWVSQ 211


>gi|27376249|ref|NP_767778.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349389|dbj|BAC46403.1| bll1138 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 123/220 (55%), Gaps = 13/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+A R  L+PSGLA++AGLDPT+FN+SKR   +GR RWPSTESI K LA
Sbjct: 11  LTHDQIWVALDRLAARAGLSPSGLAKRAGLDPTTFNRSKRVTSDGRERWPSTESIAKALA 70

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A   +I     L  SD        + +PLL    +G+ G FD    P+G  W  + +P  
Sbjct: 71  AAGASIDVFAGL-ISD---ETGNSRSVPLLGLAQAGASGAFDESGLPSGKGWTELALP-- 124

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
                   A  +Q    +    ++ P YR GD+++++    +  GDR+++  + G++   
Sbjct: 125 -------TAEDSQTFALEIAGDALAPTYRNGDVILVSPGTPIRKGDRVVVTTKAGEVTVA 177

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  +++DL+ L+      T+   ++ W+ARI+WASQ
Sbjct: 178 TLKRRTAKALDLLPLDASQAERTIAAGELAWVARIVWASQ 217


>gi|148259746|ref|YP_001233873.1| putative phage repressor [Acidiphilium cryptum JF-5]
 gi|146401427|gb|ABQ29954.1| putative phage repressor [Acidiphilium cryptum JF-5]
          Length = 223

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 120/232 (51%), Gaps = 21/232 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL+
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 64  ATNETICQLLDL-------PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           A++  I     L       P    R      + +PL     +G  GFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAMRTVPLASLAQAGQDGFFDEGGNPTGGGWD 120

Query: 117 TVGVPE-----IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
            + +P         PH     IQ           SM P+YR GDI++++ A  V  GDR+
Sbjct: 121 RIALPVGDAGIAGDPHAFALTIQGD---------SMDPVYRDGDIIVVSPASPVRTGDRV 171

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +I+   G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 172 VIRTAGGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|304394055|ref|ZP_07375978.1| dna-binding protein rdga [Ahrensia sp. R2A130]
 gi|303293495|gb|EFL87872.1| dna-binding protein rdga [Ahrensia sp. R2A130]
          Length = 232

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 133/241 (55%), Gaps = 31/241 (12%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           FSHK++W AID +A+ ++++ S LAR AGLD T+FNKSKR G +GR RWPSTES+ KI+ 
Sbjct: 2   FSHKQVWAAIDALAQDNDMSVSKLARTAGLDATTFNKSKRIGADGRQRWPSTESLSKIMD 61

Query: 64  ATNETICQLLDLPFSDGRTT---------------------EKKEKEIPLLYFPPSGSGG 102
           AT   I   +     DG+ +                           IPLL    +GSGG
Sbjct: 62  ATKTDIDGFM-ATMRDGQASFAAGFAGMSETGGTYVPDAPGHPVPVSIPLLGLAQAGSGG 120

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
           FFD    PTG  W  V  P+  S    +YA++           SM PLYR GD ++++  
Sbjct: 121 FFDDAGLPTGEGWEAVEFPQ--SDREPLYALEIAGD-------SMEPLYRDGDRIVVSPT 171

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             V  GDR++++   G+I+AK L  +  ++++L S N  +   T ++++++W+ARI+W S
Sbjct: 172 ASVRRGDRVVVRTSDGEIMAKTLARQTAKTVELDSENPEHQKRTFDLTEVDWVARIMWVS 231

Query: 223 Q 223
           Q
Sbjct: 232 Q 232


>gi|16124337|ref|NP_418901.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|221233019|ref|YP_002515455.1| LexA-like transcriptional repressor [Caulobacter crescentus NA1000]
 gi|13421181|gb|AAK22069.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|220962191|gb|ACL93547.1| LexA-related transcriptional repressor [Caulobacter crescentus
           NA1000]
          Length = 213

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 126/230 (54%), Gaps = 24/230 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE-GRNRWPSTESIF 59
           M + SH +IW AID +AER ++TPS +AR AGLDPTSFN+SKR   E G  RWPSTES+ 
Sbjct: 1   MATLSHGEIWRAIDALAERFDMTPSAMARMAGLDPTSFNRSKRGSAETGHARWPSTESLS 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKK------EKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           K+L AT     +   L       TE+        +  PL+    +G  GFFD    P G 
Sbjct: 61  KLLEATGVNFSEFAAL-------TERSPVRAPGRRGAPLIDLAQAGKDGFFDEAGMPVGA 113

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+    P++     G++A++       T D  + P+YR GD L+++  ++   GDR++ 
Sbjct: 114 GWDEAPAPDL---GEGLFALEV------TGD-DLAPVYRDGDRLLVSPTLEPRKGDRVVT 163

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +   G+++ + L     RSI+L++L+       +   ++ WIARI+W SQ
Sbjct: 164 RTHGGEVLVRELGRVTARSIELLALDRVSGERLLSRDEVAWIARIVWVSQ 213


>gi|296532329|ref|ZP_06895067.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
 gi|296267353|gb|EFH13240.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
          Length = 216

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 131/223 (58%), Gaps = 14/223 (6%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H  IW A+D +A  H L+PSGLARKAGLDPT+FN SKR G +GR RWPSTES+ KILAAT
Sbjct: 3   HDDIWRAVDALAAEHGLSPSGLARKAGLDPTAFNPSKRLGTDGRARWPSTESVAKILAAT 62

Query: 66  NETICQLLDLPFSDGRTTEKKEKE-----IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
              +     L         +  +      IPL+    +G  G+F  G +P G  W+ +  
Sbjct: 63  GTDMESFAALVTGAAAALNRSPRSMPGRRIPLIGLAQAGGDGYFGDGGYPVGAGWDEIST 122

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PE+  P+   YA++           SM P++R GDI+I++    V  GDR++++   G++
Sbjct: 123 PELSDPN--AYALE-------ISGDSMEPVFRDGDIIIVSPNAPVRRGDRVVVRTLKGEV 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK L+ +  R I+L SLN  +P  + ++++I WI RILWASQ
Sbjct: 174 MAKELLRQSARRIELASLNPAHPGYSFDLAEIAWIHRILWASQ 216


>gi|167644106|ref|YP_001681769.1| putative phage repressor [Caulobacter sp. K31]
 gi|167346536|gb|ABZ69271.1| putative phage repressor [Caulobacter sp. K31]
          Length = 219

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 130/227 (57%), Gaps = 16/227 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  SH +IW AID +A+R +++PS +A+ AGLDPTSFN+SKR   + R RWPSTES+ K
Sbjct: 5   MSPLSHTEIWTAIDALAKRFDMSPSAMAKMAGLDPTSFNRSKRGDGDARPRWPSTESLAK 64

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT     +   L     R      + +PL+ F  +G+ G FD    P G  W+ +  
Sbjct: 65  VLEATGVGFSEFAAL---TERVRPLNPRVVPLIGFAQAGAEGVFDETGAPIGAGWDEIDF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +     G+YA++       T D ++ P++R GD ++++ +     GDR++++   G++
Sbjct: 122 PGLG--DEGVYALEI------TGD-ALAPVFRDGDRILVSPSAPPRRGDRVVVRTAGGEL 172

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVD----TVEMSDIEWIARILWASQ 223
           + K L     RS++L  LN     D    T+++ ++ WIARILWASQ
Sbjct: 173 LVKELARVTARSVELAPLNRLDGRDGGDRTLDLGEVVWIARILWASQ 219


>gi|307941488|ref|ZP_07656843.1| peptidase family S24 [Roseibium sp. TrichSKD4]
 gi|307775096|gb|EFO34302.1| peptidase family S24 [Roseibium sp. TrichSKD4]
          Length = 218

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 125/226 (55%), Gaps = 15/226 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SHK+IW AID +A R+ L+PSGLAR+AGLDPT+FN SKRFG +GR RWPSTES+ KIL 
Sbjct: 2   LSHKQIWAAIDTLAARNGLSPSGLARRAGLDPTTFNPSKRFGGDGRPRWPSTESLSKILQ 61

Query: 64  ATNETICQLLDLPFSDGRTTEKKE------KEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT E++  L+++      T  +        + +P+  F  +     FD    P+   W++
Sbjct: 62  ATGESLETLMEVLLGLAPTGPRAAPLAQDGRMVPIAGFSDANQQAAFDPTGRPSSPMWDS 121

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +  P+ +  +     I + D         + P YR GDILI+     +  GDR+L++  +
Sbjct: 122 LLFPDPKEKNLFALEINSDD---------LTPYYRSGDILIVAPVQAIRRGDRVLVRQTS 172

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G +   ++  +   + D  +L   +    +E + I+W+AR++W SQ
Sbjct: 173 GALQLFLMDRQNPSAFDFHALTPPHETVHLERTKIDWVARVMWVSQ 218


>gi|118589338|ref|ZP_01546744.1| repressor protein CI [Stappia aggregata IAM 12614]
 gi|118438038|gb|EAV44673.1| repressor protein CI [Stappia aggregata IAM 12614]
          Length = 227

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 114/222 (51%), Gaps = 11/222 (4%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T  SH+K+W AID +A ++ LTPSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+
Sbjct: 17  TVLSHEKVWAAIDALASQNGLTPSGLARRAGLDPTAFNPSKRVAGDGRPRWPSTESLAKV 76

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           LAAT E +        ++   +      +P+     +     FD+   P+G  W     P
Sbjct: 77  LAATGEALNTFAARVETEDAPSGSVPALVPVAALEAASDRNAFDAAGRPSGATWQQFSFP 136

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +        +A+Q  +   +       PLYR GDI+++     +  GDRL +K  +G + 
Sbjct: 137 Q----PGASFALQVSNEDFQ-------PLYRNGDIVVVAPDAPLRTGDRLALKLTSGRLS 185

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
              L    G  + + ++           S IEW ARI+WASQ
Sbjct: 186 LYTLQEAGGEELSVRTIGENSHSLRFRHSAIEWTARIIWASQ 227


>gi|220924406|ref|YP_002499708.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
 gi|219949013|gb|ACL59405.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
          Length = 209

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 109/219 (49%), Gaps = 16/219 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH++IW AID +A+RH LTPSGLAR+AGLD TSFN+SKR   +GR RWPSTES+ KIL 
Sbjct: 2   LSHERIWLAIDHLAQRHGLTPSGLARRAGLDATSFNRSKRIAPDGRKRWPSTESLAKILT 61

Query: 64  ATNETICQLLDL--PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AT  ++   L L  P                L      +G        P G  W  +  P
Sbjct: 62  ATGASLDDFLQLVEPRPAPPPAILPLIGSAAL-----AAGRRIGPDGRPAGAGWEEMEFP 116

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++ +     +AI+        Q   +LPLY  GD+L++ +      GDR L+      + 
Sbjct: 117 DLGA--QSCFAIE-------VQGEGLLPLYHDGDVLVVCATAPARRGDRTLVCLDGEGLF 167

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           A  L  R  R+ +        PV TV  + I W+AR++W
Sbjct: 168 AADLRRRTVRTTEFAGRTPGEPVRTVPTARIAWMARVMW 206


>gi|114569067|ref|YP_755747.1| putative phage repressor [Maricaulis maris MCS10]
 gi|114339529|gb|ABI64809.1| putative phage repressor [Maricaulis maris MCS10]
          Length = 208

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 117/222 (52%), Gaps = 17/222 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKIL 62
            +H  IW  IDR+A     +PSGLAR+AGLD T+FN SKR   +G + RWPSTESI K L
Sbjct: 2   LTHDDIWRGIDRLARHAQTSPSGLARRAGLDSTTFNPSKRISADGTKPRWPSTESIAKAL 61

Query: 63  AATNETICQLLDLP-FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           AA +      LD   F+   + + +   +P            FD+  +P G  W+ +  P
Sbjct: 62  AAAH------LDFDDFAGLISGQPRTGALPSRALADGEEQDPFDATGYPAGPDWDAIPFP 115

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            + +P    +A+  QDT        MLP+YR GD L+++       GDR++++ R G   
Sbjct: 116 GL-APGEA-FALTVQDTH-------MLPVYRPGDRLVVSHEAPTRVGDRVVVQRRDGSRS 166

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           A  L  +  +++ L  L+   P  T+ ++ + W+ARI+W SQ
Sbjct: 167 AWTLSEKTVQALRLAPLDPLQPALTLPLTQVAWLARIVWVSQ 208


>gi|254471620|ref|ZP_05085021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
 gi|211958822|gb|EEA94021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
          Length = 214

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 113/234 (48%), Gaps = 39/234 (16%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H+ +W A+D+MA+RH LTPSGLAR+AGLDPTSFN SKRF  +GR RWPSTES+ K+L  T
Sbjct: 4   HENLWAALDKMAKRHQLTPSGLARRAGLDPTSFNPSKRFAADGRPRWPSTESLAKVLEVT 63

Query: 66  NETICQLLDL-------------PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
             T      L              F     T  + +E+ L          F DS +FP+ 
Sbjct: 64  QMTFVDFAGLLQDKTEISGTHFRSFPAYLCTSDELREVDLEDLSGFQLDKFCDSFIFPS- 122

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
                       S     +A++           S  P YR+G ILI++    +   D +L
Sbjct: 123 ------------SQSEKFFALE-------VSSNSFEPYYREGQILIVSPESSLRRNDHVL 163

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT---VEMSDIEWIARILWASQ 223
           I  +TGD+    L  +    I+        P DT   V+++D+ W ARILW SQ
Sbjct: 164 IATKTGDLHCGPLQRQTNERIEFRRHT---PDDTPRVVQVADLVWTARILWVSQ 214


>gi|114328547|ref|YP_745704.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
 gi|114316721|gb|ABI62781.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
          Length = 221

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 112/231 (48%), Gaps = 21/231 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A    L+ SGLAR+AGLD T+FN SKR   +GR RWPSTESI KIL 
Sbjct: 1   MKHEDIWRAIDTLAAIKGLSTSGLARRAGLDATTFNLSKRQMPDGRQRWPSTESISKILV 60

Query: 64  ATNETICQLLDLP------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT E++     L        +D        + IPL   P        D  +   GN    
Sbjct: 61  ATGESLGAFTSLVNGAETLSADSGQNTHYGRRIPLFSLPE-----LRDLPIKGEGN---- 111

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
             +P  R   +       +    +  DTS+ PL+R+G ILI++    +  GDR++++   
Sbjct: 112 -ALPSARDETSLPDVADREAYGIEIHDTSLAPLFREGTILIVSPNAPLRRGDRVIVRLAA 170

Query: 178 GD-----IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            D      V      R  R +D+ SLN      ++ ++ + WI RI+WASQ
Sbjct: 171 HDGEPSETVFGHFHRRSARWMDISSLNGDKAERSISLTSLVWIHRIVWASQ 221


>gi|330992988|ref|ZP_08316928.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
 gi|329759941|gb|EGG76445.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
          Length = 223

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 87/188 (46%), Gaps = 12/188 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH  IW AIDR+A    LTPSGLAR AGLD T+FN SKR    GR RWP TES+ + L+
Sbjct: 2   ISHDDIWRAIDRLAAERGLTPSGLARAAGLDSTTFNPSKRITPSGRPRWPGTESLARTLS 61

Query: 64  ATN---ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           AT    E   +LL        T       + +  F        FD    P G +W     
Sbjct: 62  ATGISFEGFSRLLSGHHDPETTNRAHHSHLKIAPFSQLAHPELFDETGLPEGERWEKWEF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
             +   H+  YA+      H   DT M P++RKG  L+++    +   DR+L+    G  
Sbjct: 122 HGMADHHS--YAV------HVDCDT-MEPIFRKGGTLVVSPTAAIRVHDRVLLHTPQGTA 172

Query: 181 VAKVLISR 188
              ++  R
Sbjct: 173 CCGMVTER 180


>gi|162145992|ref|YP_001600450.1| hypothetical protein GDI_0160 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209544371|ref|YP_002276600.1| hypothetical protein Gdia_2230 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161784566|emb|CAP54103.1| conseved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532048|gb|ACI51985.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 217

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 95/192 (49%), Gaps = 20/192 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H  +W+A+D +A    LTPSGLAR AGLD TSFN SKR    GR RWP TES+ ++L AT
Sbjct: 4   HDDLWQALDNLAAERGLTPSGLARAAGLDSTSFNPSKRVTPAGRPRWPGTESLARVLDAT 63

Query: 66  N---ETICQLL---DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
               E+  +L+    LP +       + +   L +      GG FD+   P G  W +  
Sbjct: 64  GLTLESFGRLMAGQALPRASRAAGRSRLRLSALSHLE---QGGMFDAAGLPVGRHWESWD 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           VP +      +YA+          DT    P++R G  L+++SA  +   DR+++     
Sbjct: 121 VPGLGDAE--LYAVMV--------DTDAFEPVFRAGAFLVVSSAAAIRRQDRVILHRADA 170

Query: 179 DIVAKVLISRRG 190
            + A VL  R G
Sbjct: 171 TLCAVVLDPRPG 182


>gi|296114602|ref|ZP_06833255.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978958|gb|EFG85683.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 221

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 10/172 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH+ IW A+D +A    +TPSGLAR AGLD T+FN SKR    GR RWP TES+ + L+
Sbjct: 2   ISHEDIWRALDLLATERGMTPSGLARAAGLDSTTFNPSKRMTSSGRPRWPGTESLARTLS 61

Query: 64  ATNETICQLLDLPFSDG-RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AT  ++     L    G R        + ++ F   G    FD    P+G++W T     
Sbjct: 62  ATGISLEGFGRLMTGHGDRLGGTHHAHLMIVPFSELGQAELFDESGLPSGDRWETWDFHG 121

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           +   H+  YA+            +M P++R G +L+++    +   DR+L+ 
Sbjct: 122 LADHHS--YAVL-------VDSDNMEPIFRAGTVLVVSPTAAIRQHDRVLLH 164


>gi|294853434|ref|ZP_06794106.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
 gi|294819089|gb|EFG36089.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
          Length = 160

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 10/155 (6%)

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  W+ V  P       
Sbjct: 16  IAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--E 72

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           G+YA++           SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +
Sbjct: 73  GVYALEVSGE-------SMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQ 125

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 126 TPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 160


>gi|261318541|ref|ZP_05957738.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|265986342|ref|ZP_06098899.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|261297764|gb|EEY01261.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|264658539|gb|EEZ28800.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
          Length = 170

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 10/155 (6%)

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I  +  LP   G  T+     IPLL    +G+GG+FD   FP G  W+ V  P       
Sbjct: 26  IAGVDSLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--E 82

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           G+YA++           SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +
Sbjct: 83  GVYALEVSGE-------SMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQ 135

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 136 TPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 170


>gi|254710961|ref|ZP_05172772.1| Peptidase family S24 [Brucella pinnipedialis B2/94]
 gi|256029343|ref|ZP_05442957.1| Peptidase family S24 [Brucella pinnipedialis M292/94/1]
          Length = 142

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 84/149 (56%), Gaps = 10/149 (6%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
           LP   G  T+     IPLL    +G+GG+FD   FP G  W+ V  P       G+YA++
Sbjct: 4   LPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--EGVYALE 60

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                      SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+
Sbjct: 61  VSGE-------SMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIE 113

Query: 195 LMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           L SLN  +P    E  DIEWIARILWASQ
Sbjct: 114 LHSLNPEHPNRIFESKDIEWIARILWASQ 142


>gi|260567943|ref|ZP_05838412.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260154608|gb|EEW89689.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 132

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 79/134 (58%), Gaps = 9/134 (6%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           IPLL    +G+GG+FD   FP G  W+ V  P       G+YA++           SMLP
Sbjct: 8   IPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--EGVYALEVSGE-------SMLP 58

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
           LYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+L SLN  +P    E 
Sbjct: 59  LYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFES 118

Query: 210 SDIEWIARILWASQ 223
            DIEWIARILWASQ
Sbjct: 119 KDIEWIARILWASQ 132


>gi|329115279|ref|ZP_08244034.1| Phage Repressor [Acetobacter pomorum DM001]
 gi|326695722|gb|EGE47408.1| Phage Repressor [Acetobacter pomorum DM001]
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 92/220 (41%), Gaps = 21/220 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R    G  RWP+  S+ + L    
Sbjct: 5   ERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGHGVWRWPALPSLLRALDVLR 64

Query: 67  ETICQ----LLDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            ++ Q    L      DG  T      + +PL +      GG  D    P G  W     
Sbjct: 65  VSLAQFEAHLWGYEQPDGAKTPAPCFMRSLPLSWL---DQGGVLDRAGLPAGGLWEQ--- 118

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDT-SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                     +++ +        DT  M P+ R G  L++  A+     DR+++      
Sbjct: 119 ------EETFFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALHPRGADRVVLIRAGQA 172

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            V  +L  +  R+I     +   PV         W+ RI+
Sbjct: 173 PVVGILQEKPVRAIQPFGRSALQPVPAAAAG--VWLHRIV 210


>gi|258541731|ref|YP_003187164.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256632809|dbj|BAH98784.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256635866|dbj|BAI01835.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-03]
 gi|256638921|dbj|BAI04883.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-07]
 gi|256641975|dbj|BAI07930.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-22]
 gi|256645030|dbj|BAI10978.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-26]
 gi|256648085|dbj|BAI14026.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-32]
 gi|256651138|dbj|BAI17072.1| transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654129|dbj|BAI20056.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-12]
          Length = 214

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 94/221 (42%), Gaps = 23/221 (10%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R   +G  RWP+  S+ + L    
Sbjct: 5   ERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGQGVWRWPALPSLLRALDVLR 64

Query: 67  ETICQL------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            ++ Q        + P           + +PL +       G  D    P G  W     
Sbjct: 65  VSLAQFEGHIWGYEQPDGVEAPAPCFMRSLPLSWL---KQEGVLDRAGLPAGGLWEQ--- 118

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDT-SMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTG 178
                     +++ +        DT  M P+ R G  L++  A+     DR +LI+P   
Sbjct: 119 ------EETFFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALYPRGADRVVLIRPGQA 172

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +V  +L  +   +I     +   PV   + +   W+ RI+
Sbjct: 173 PVVG-ILQEKPVLAIQPFGRSALQPVP--QAAAGVWLHRIV 210


>gi|218460494|ref|ZP_03500585.1| putative phage-related transcriptional regulator protein
          [Rhizobium etli Kim 5]
          Length = 36

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 34/35 (97%)

Query: 4  FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSF 38
           SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSF
Sbjct: 2  LSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSF 36


>gi|329889506|ref|ZP_08267849.1| peptidase S24-like family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844807|gb|EGF94371.1| peptidase S24-like family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 152

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 11/137 (8%)

Query: 88  KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM 147
           + IPLL    +G  GFFD    P    W+   +P  +   + ++++            SM
Sbjct: 26  RAIPLLGLARAGDEGFFDDAGLPMAEGWDQTELPAHK---DSLFSL-------TIDGDSM 75

Query: 148 LPLYRKGDILILN-SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT 206
            P+YR GD +I++  A +V  GDR++++   G+ +AK + +  GR + L S+N  Y    
Sbjct: 76  EPVYRPGDRVIVDLDATEVRRGDRVVVRTAEGETLAKEIAALNGREVVLASVNPHYEPRI 135

Query: 207 VEMSDIEWIARILWASQ 223
           +    I W+ARILW SQ
Sbjct: 136 LPRGQIRWMARILWVSQ 152


>gi|296160137|ref|ZP_06842956.1| putative phage repressor [Burkholderia sp. Ch1-1]
 gi|295889611|gb|EFG69410.1| putative phage repressor [Burkholderia sp. Ch1-1]
          Length = 222

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 20/151 (13%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
           +PF  G       K IP+L     G  GF+    +P G+    +  P       GI  + 
Sbjct: 84  IPFPPG-------KRIPVLGMAQLGDNGFWAEVEYPVGHGEGYLDFPSRDRDAYGIRCV- 135

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                      SMLP  + G+ +++     V  GD +L+K + G ++ K+L+ +R     
Sbjct: 136 ---------GDSMLPRIKDGEFVVIEPNHPVENGDEVLVKAKDGRVMIKILLYQRAGRTH 186

Query: 195 LMSLNCCYPVDTVEMSDIE---WIARILWAS 222
           LMS+N  +    +E   IE   ++A I+ +S
Sbjct: 187 LMSVNTEHAPLAIETEKIERLHYVAAIVKSS 217


>gi|213968238|ref|ZP_03396382.1| phage repressor [Pseudomonas syringae pv. tomato T1]
 gi|301381283|ref|ZP_07229701.1| putative phage repressor [Pseudomonas syringae pv. tomato Max13]
 gi|302062899|ref|ZP_07254440.1| putative phage repressor [Pseudomonas syringae pv. tomato K40]
 gi|213926876|gb|EEB60427.1| phage repressor [Pseudomonas syringae pv. tomato T1]
          Length = 228

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 86/215 (40%), Gaps = 27/215 (12%)

Query: 26  GLARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIFKI----------LAATNETICQLLD 74
           GL+++A      +    R G  E   R PS + I KI          L A  +   Q L 
Sbjct: 16  GLSQQALAHACGWESQSRIGNYEKGTRQPSLQDIRKISDTLGVSFVDLVAFTDDNAQPLV 75

Query: 75  LPFSDGR---TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           +   D     T + KE  +P++     G+ G+FD+  FP G+     G   I S     Y
Sbjct: 76  VKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPGHGD---GYLNIHSDDPDAY 132

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            +       K    SMLP  + G+ +++        GD ++++   G  + K  I  R  
Sbjct: 133 GL-------KVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAGRTMIKEYIYLRDG 185

Query: 192 SIDLMSLNCCYP---VDTVEMSDIEWIARILWASQ 223
                S+N  +P   +   E+ +I  +  IL +S+
Sbjct: 186 MYRFDSVNAEHPPIHIAENEILEIHLVGGILKSSR 220


>gi|331017574|gb|EGH97630.1| putative phage repressor [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 228

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 86/215 (40%), Gaps = 27/215 (12%)

Query: 26  GLARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIFKI----------LAATNETICQLLD 74
           GL+++A      +    R G  E   R PS + I KI          L A  +   Q L 
Sbjct: 16  GLSQQALAHACGWESQSRIGNYEKGTRQPSLQDIRKIADTLGVSFVDLVAFTDDNAQPLV 75

Query: 75  LPFSDGR---TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           +   D     T + KE  +P++     G+ G+FD+  FP G+     G   I S     Y
Sbjct: 76  VKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPGHGD---GYLNIHSDDPDAY 132

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            +       K    SMLP  + G+ +++        GD ++++   G  + K  I  R  
Sbjct: 133 GL-------KVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAGRTMIKEYIYLRDG 185

Query: 192 SIDLMSLNCCYP---VDTVEMSDIEWIARILWASQ 223
                S+N  +P   +   E+ +I  +  IL +S+
Sbjct: 186 MYRFDSVNAEHPPIHIAENEILEIHLVGGILKSSR 220


>gi|299529267|ref|ZP_07042709.1| peptidase S24, S26A and S26B [Comamonas testosteroni S44]
 gi|298722745|gb|EFI63660.1| peptidase S24, S26A and S26B [Comamonas testosteroni S44]
          Length = 120

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + +  SM P YR G+ +++  +I+   G  +++K   G  + K L   RG  I L+S+N 
Sbjct: 32  RIKGDSMHPRYRAGEFVVVTPSIEAQPGRDVVVKLHDGKCLLKELNWIRGDEIQLLSINN 91

Query: 201 CYPVDTVEMSDIEWIARI 218
            Y   T+   D+E + R+
Sbjct: 92  GYAPMTISKEDVECVCRV 109


>gi|238762739|ref|ZP_04623708.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
 gi|238699044|gb|EEP91792.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
          Length = 240

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 94/216 (43%), Gaps = 22/216 (10%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           ++ +  +H ++ S LA+ +G+   S+  ++R+ + G  + P  E + KI    N +    
Sbjct: 27  LNSLMSKHEISVSSLAKLSGV---SYEMARRYTL-GTAK-PRDEKMLKIADHLNVSPA-F 80

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-FDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           LD     GR TE   K + L       S G  + +  FP         +  I  P + IY
Sbjct: 81  LDYGTMTGRDTEADSKVVKLRQLEVFASAGHGYINNEFPAV-------ISSIEIPEDKIY 133

Query: 132 AI---QTQDTRH--KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
            +   ++ D  H       SM+P     D+L +++ I    GD + +         K L 
Sbjct: 134 ELFGRKSLDGIHLMNVDGDSMMPTLHPRDLLFIDTKIDHFNGDGVYVFNFEDSTFVKRLQ 193

Query: 187 SRRGRSIDLMSLNCCYP---VDTVEMSDIEWIARIL 219
             +GR + ++S N  YP   ++  EM+++ +  +++
Sbjct: 194 KVKGRRLSVLSDNDKYPPFFIEANEMNELYFFGKLI 229


>gi|317054052|ref|YP_004118077.1| putative phage repressor [Pantoea sp. At-9b]
 gi|316952047|gb|ADU71521.1| putative phage repressor [Pantoea sp. At-9b]
          Length = 230

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 98/226 (43%), Gaps = 35/226 (15%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +D + +  NL+ + LAR AG+ P + N   + G  G+      +S  KI AAT   +  +
Sbjct: 15  LDELLKAANLSKADLARIAGVSPQAVNNWFKRGEIGK------DSAIKISAATGLDLSWV 68

Query: 73  L---DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV----GVPEIRS 125
           L   D  +S        E E+           G   +GV P   K + V    G+ ++  
Sbjct: 69  LGESDQMYSTPHQKPASEVEVV----------GNIMNGVIPV--KGDAVLGMDGLIDMME 116

Query: 126 PHNG---IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
            H G   IY+   +    + +  SM P  + G+ +++    +V+ GD + I+   G  + 
Sbjct: 117 FHAGWLRIYSDDREAYGVRVRGDSMWPRIQSGEFVVIEPNTKVHPGDEVFIRTSDGHNMI 176

Query: 183 KVLISRRGRSIDLMSLNCCY-----PVDTVEMSDIEWIARILWASQ 223
           K+L   R       S+N  +     PV+ V+   I +++ I+ A++
Sbjct: 177 KILNYNRAGDYQFTSINNDHKPFTLPVNQVD--KIHFVSGIIKATR 220


>gi|186476666|ref|YP_001858136.1| putative phage repressor [Burkholderia phymatum STM815]
 gi|184193125|gb|ACC71090.1| putative phage repressor [Burkholderia phymatum STM815]
          Length = 331

 Score = 41.6 bits (96), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ ++L     +N GD +L+K + G ++ K  +      I L+S N  +   
Sbjct: 246 SMRPRIKDGEYVVLEPNQPINPGDEVLVKAKDGRVMVKEFVYEAQGKIFLLSTNEAHGKI 305

Query: 206 TVEMSDIEWIARILWASQ 223
           +VE ++IE +  + W ++
Sbjct: 306 SVERANIEHMHYVGWIAK 323


>gi|212499706|ref|YP_002308514.1| cI [Bacteriophage APSE-2]
 gi|211731675|gb|ACJ10163.1| cI [Bacteriophage APSE-2]
          Length = 232

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + Q  SM+P  + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N 
Sbjct: 143 RCQGESMMPRIQHGEFVVMEPNHKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINS 202

Query: 201 CYPVDTVEMSDIEWIARI 218
            +P   +  S IE I  +
Sbjct: 203 NHPPIRLAASTIEKIIYV 220


>gi|284007338|emb|CBA72703.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 232

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + Q  SM+P  + G+ +++    +   GD +L++   G ++ K  + +R   I L+S+N 
Sbjct: 143 RCQGESMMPRIQHGEFVVMEPNYKYKPGDEVLVQDDNGQVMVKTFLYQRDDVIHLLSINA 202

Query: 201 CYP 203
            +P
Sbjct: 203 DHP 205


>gi|85374557|ref|YP_458619.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
 gi|84787640|gb|ABC63822.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
          Length = 220

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 142 TQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS-IDLMSLN 199
            +  SM PL R GD IL+  S   +  G  ++   R G+ +    +SR G+  I L+S N
Sbjct: 138 VEGDSMEPLLRDGDEILVDRSPGPLRDGIHVV---RLGETLMVKRLSRSGQGRISLLSQN 194

Query: 200 CCYPVDTVEMSDIEWIARILWAS 222
             YP   + + D+E I R++W S
Sbjct: 195 LAYPPLDMALEDVEVIGRVVWKS 217


>gi|171911475|ref|ZP_02926945.1| putative phage repressor [Verrucomicrobium spinosum DSM 4136]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 127 HNGIYAIQTQDTRH---KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK---PRTGDI 180
           H  + A  T D++    + +  SM P Y +GDIL ++       GD +L K      GD+
Sbjct: 155 HESVIAFGTTDSKAFATRLRGDSMEPKYSEGDILYVSPNATPKNGDIVLAKVDEAHGGDV 214

Query: 181 VAKVLISRR-GRSIDLMSLNCCYP 203
           + K+  SR  G++I L S N  YP
Sbjct: 215 MCKLYSSRDGGKNIVLSSYNAAYP 238


>gi|255606333|ref|XP_002538548.1| conserved hypothetical protein [Ricinus communis]
 gi|223511638|gb|EEF23835.1| conserved hypothetical protein [Ricinus communis]
          Length = 331

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           K +  SM P  + G+ ++L     +  GD +LIK + G ++ K  +      I L+S N 
Sbjct: 241 KCKGDSMKPRIKDGEYVVLEPNQPIAPGDEVLIKAKDGRVMVKEFVYEAQGKIYLLSTNE 300

Query: 201 CYPVDTVEMSDIEWIARILWASQ 223
            +   +VE ++IE +  + W ++
Sbjct: 301 AHGKISVERANIEHMHYVGWIAK 323


>gi|114567914|ref|YP_755068.1| transcription termination factor Rho [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114338849|gb|ABI69697.1| transcription termination factor Rho [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 425

 Score = 39.7 bits (91), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + +++ RMA  HNL   PSG     G+DP S +K KRF    RN
Sbjct: 250 EHKKDVVILMDSVTRMARAHNLVVPPSGRTLSGGIDPASLDKPKRFFGAARN 301


>gi|253999361|ref|YP_003051424.1| putative phage repressor [Methylovorus sp. SIP3-4]
 gi|253986040|gb|ACT50897.1| putative phage repressor [Methylovorus sp. SIP3-4]
          Length = 226

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + +  SM P Y  G+  ++         D +LIK  TG+++ K LISRRG  I L S N 
Sbjct: 138 RVEGNSMFPKYAHGEYALVEPNTVPEIEDDVLIKLSTGEVMLKRLISRRG-GIHLSSYNE 196

Query: 201 CYPVDTVEMSDIEWIARI 218
               D  + S+I W+  +
Sbjct: 197 SGTYD-FQDSEIVWMYYV 213


>gi|296282441|ref|ZP_06860439.1| putative transcriptional regulator, repressor [Citromicrobium
           bathyomarinum JL354]
          Length = 231

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVAKVLISRRGRSIDLMSLNC 200
            +  SM PL R GD ++++   +       ++  R GD ++ K L S     I L+S N 
Sbjct: 149 VEGDSMEPLLRHGDEILIDRGSRFERDGVHVV--RMGDTLMVKRLASAGAGRIALLSQNL 206

Query: 201 CYPVDTVEMSDIEWIARILWAS 222
            YP   V + +IE + R++W S
Sbjct: 207 AYPPVEVGLDEIEVLGRVVWKS 228


>gi|238898738|ref|YP_002924420.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466498|gb|ACQ68272.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 260

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + Q  SM+P  + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N 
Sbjct: 171 RCQGESMMPRIQHGEFVVMEPNHKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINS 230

Query: 201 CYPVDTVEMSDIEWIARI 218
            +P   +  S IE I  +
Sbjct: 231 NHPPIRLAASTIEKIIYV 248


>gi|218463233|ref|ZP_03503324.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli Kim 5]
          Length = 30

 Score = 39.7 bits (91), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/28 (60%), Positives = 23/28 (82%)

Query: 196 MSLNCCYPVDTVEMSDIEWIARILWASQ 223
           MSLN  +   T+++SD+EWIARI+WASQ
Sbjct: 3   MSLNPEHANRTLDLSDVEWIARIIWASQ 30


>gi|9633604|ref|NP_050962.1| P1 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118052|gb|AAF04000.1|AF157835_57 P1 [Endosymbiont phage APSE-1]
          Length = 260

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           + Q  SM+P  + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N 
Sbjct: 171 RCQGESMMPRIQHGEFVVMEPNYKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINS 230

Query: 201 CYPVDTVEMSDIEWIARI 218
            +P   + +  IE I  +
Sbjct: 231 NHPPIRLAVPTIEKIIYV 248


>gi|26989752|ref|NP_745177.1| transcriptional repressor pyocin R2_PP [Pseudomonas putida KT2440]
 gi|24984646|gb|AAN68641.1|AE016494_1 pyocin R2_PP, transcriptional repressor, CI/C2 family [Pseudomonas
           putida KT2440]
          Length = 243

 Score = 38.9 bits (89), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 151 YRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSIDLMSLNCCYP-VDTVE 208
           Y  G I+ ++  ++ N GDR++ + PRT ++  KVL+S  GR   L  +N  YP +D  E
Sbjct: 170 YPTGCIIFVDPEVEANTGDRVIARVPRTNEVTFKVLVSDAGRQF-LRPINPQYPIIDITE 228

Query: 209 MSDI 212
            + I
Sbjct: 229 ETHI 232


>gi|260845233|ref|YP_003223011.1| putative phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|257760380|dbj|BAI31877.1| predicted phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|309702933|emb|CBJ02264.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 224

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM+P  ++G+ +I+        GD +L+  R G+++ K  +  R     LMS+N  +P  
Sbjct: 141 SMMPRIKEGEFVIVEPNHDYTPGDEVLVVTREGEVMVKTFLFERDGLFHLMSVNEDHPPV 200

Query: 206 TVEMSDIEWIARI 218
            V   +IE I  +
Sbjct: 201 RVPRENIEKIHYV 213


>gi|260905809|ref|ZP_05914131.1| Helix-turn-helix family protein [Brevibacterium linens BL2]
          Length = 183

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 1  MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
          M+S   ++I  AI R   R +L+ S +AR+AG+      KS   G+E     PS E+++ 
Sbjct: 1  MSSQPREQIAAAIKRERLRADLSLSEVARRAGI-----GKSTMSGLEAGTGNPSVETMWA 55

Query: 61 ILAATNETICQLLDLP 76
          + AA +  + +LLD P
Sbjct: 56 LAAALDIPLARLLDPP 71


>gi|218555126|ref|YP_002388039.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361894|emb|CAQ99494.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 224

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM+P  ++G+ +I+        GD +L+  R G+++ K  +  R     LMS+N  +P  
Sbjct: 141 SMMPRIKEGEFVIVEPNHDYTPGDEVLVVTRDGEVMVKTFLFERDGLFHLMSVNEDHPPV 200

Query: 206 TVEMSDIEWIARI 218
            V   +IE I  +
Sbjct: 201 RVPRENIEKIHYV 213


>gi|297618452|ref|YP_003703611.1| transcription termination factor Rho [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297146289|gb|ADI03046.1| transcription termination factor Rho [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 418

 Score = 38.1 bits (87), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRF 44
           + +++ R+A  HNL   PSG     GLDP S NK KRF
Sbjct: 258 LLDSLTRLARAHNLVIPPSGRTLSGGLDPASLNKPKRF 295


>gi|160898658|ref|YP_001564240.1| putative phage repressor [Delftia acidovorans SPH-1]
 gi|160364242|gb|ABX35855.1| putative phage repressor [Delftia acidovorans SPH-1]
          Length = 236

 Score = 38.1 bits (87), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 16/147 (10%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD--SGVFPTGNKWNTVGVPEIRSPHNGIY 131
           D P   G    +K K IP++     G  GF++  S +   G+     G  E  S     Y
Sbjct: 92  DAPAFAGYPKHQKSK-IPVVGTAKMGDDGFYEEFSAIPGAGD-----GYVEHYSDDKSAY 145

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            +       + +  SM P  R G  +I+      + G+ +LIK   G  + K  + RR  
Sbjct: 146 CL-------RVKGMSMFPAIRDGWYVIVEPNSNPSEGEYVLIKKSDGRRMVKEFLFRRSG 198

Query: 192 SIDLMSLNCCYPVDTVEMSDIEWIARI 218
           SI+LMS+N    + T+EM +I+ I  I
Sbjct: 199 SIELMSVNGGARL-TLEMHEIQDIQPI 224


>gi|83591218|ref|YP_431227.1| transcription termination factor Rho [Moorella thermoacetica ATCC
           39073]
 gi|83574132|gb|ABC20684.1| transcription termination factor Rho [Moorella thermoacetica ATCC
           39073]
          Length = 429

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + ++I R+A  HNL   PSG     G+DPT+  K KRF    RN
Sbjct: 260 EHKKDVVVLLDSITRLARAHNLVVPPSGRTLSGGVDPTALYKPKRFFGAARN 311


>gi|87119745|ref|ZP_01075642.1| ATP-dependent Clp protease ATP-binding subunit [Marinomonas sp.
           MED121]
 gi|86165221|gb|EAQ66489.1| ATP-dependent Clp protease ATP-binding subunit [Marinomonas sp.
           MED121]
          Length = 872

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 21/170 (12%)

Query: 67  ETICQLLDLPFSDG-------RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG---NKWN 116
           ET   L D  F  G        T  K+E +I +L   P+G  GF + GV       N ++
Sbjct: 619 ETAMALADQVFGGGDNLTVINMTEFKEEHKISMLLGSPAGYVGFGEGGVLTEAIRRNPYS 678

Query: 117 TVGVPEIRSPHNGIYAI--QTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNCG--DR 170
            + + E+   H G++ +  Q  D  H  +D+    +  K  I+I+  N+A Q  C   D 
Sbjct: 679 VLLLDEMEKAHPGVHDLFYQIFDKGH-IKDSEGRNVDFKNTIIIMTSNAADQAICDICDE 737

Query: 171 LLIKPRTGDIVAKVLISRRG----RSIDLMSLNCCYPVDTVEMSDIEWIA 216
              +P T D+V ++    +G      +   ++   YP++T E++ I  I+
Sbjct: 738 QEERPSTTDLVEQIRPDLQGFFKPAFLGRATIVPYYPLNTEELTKIAEIS 787


>gi|85058275|ref|YP_453977.1| hypothetical protein SG0297 [Sodalis glossinidius str. 'morsitans']
 gi|84778795|dbj|BAE73572.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 232

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 64/137 (46%), Gaps = 13/137 (9%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
           ++P+L     G GG++D   +  G     V  P   +     +A+       K Q  SM+
Sbjct: 101 KVPMLGTAQLGGGGYWDLQEYAVGQGDGYVLWP---TKDKDAFAL-------KCQGDSMM 150

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP---VD 205
           P  + G+ +++        GD +L++   G+++ K+ + ++   ++L+S+N  +    +D
Sbjct: 151 PRIQHGEFVVVEPNRGYKPGDEVLVQDEQGEVMIKIFLFQKDGIVNLLSVNSKHAPTRLD 210

Query: 206 TVEMSDIEWIARILWAS 222
              +  + ++A I+  S
Sbjct: 211 AHTIKKMFYVAGIVKDS 227


>gi|110633546|ref|YP_673754.1| putative phage repressor [Mesorhizobium sp. BNC1]
 gi|110284530|gb|ABG62589.1| putative phage repressor [Chelativorans sp. BNC1]
          Length = 230

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 90/219 (41%), Gaps = 26/219 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + I E ID       LT S  A+ AGL  ++    +R    G+     +      LA   
Sbjct: 3   RDILERIDERLAEVGLTESRAAKMAGLSDSAIRDMRRAVKSGKEDAGVSTRTLAKLAPVL 62

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG--VFPTGNKWNTVGVPEIR 124
           +T  + L     +G     + + +P++        G+  +G  V P   +    G+ ++ 
Sbjct: 63  QTSAEWLLTGGPEG----IRSRTVPIM--------GYLGAGAEVEPEYEQVPPEGLDQVD 110

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA----IQVNCGDRLLIKPRTGDI 180
            P    +++  +    K +  SMLP+Y+ G ++I+ S     +    G+   ++   G  
Sbjct: 111 VP----FSVPDEMIAFKVRGDSMLPVYKDGAVIIVYSEQKKPLHSFYGEEAAVRTSDGRR 166

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K ++     +++L+S N   P++ V +   EWI  I 
Sbjct: 167 FIKTIMRGPDDTVNLLSHNAS-PIEGVRL---EWIGEIF 201


>gi|34556743|ref|NP_906558.1| hypothetical protein WS0307 [Wolinella succinogenes DSM 1740]
 gi|34482457|emb|CAE09458.1| hypothetical protein WS0307 [Wolinella succinogenes]
          Length = 218

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 146 SMLPLYRKGDILILN-SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
           SM P    GD++ ++    Q++ G   +I+   G I  K L  R    +D++S N  YP 
Sbjct: 138 SMEPTLEDGDLIFIHRQKRQISKGGIFVIQTPHG-IFVKRLQERLDGGVDILSDNSLYPT 196

Query: 205 DTVEMSDIEWIARILWA 221
            T+E   IE I R++ A
Sbjct: 197 QTLERDGIEVIGRVVGA 213


>gi|229051002|ref|ZP_04194551.1| Transcription termination factor Rho [Bacillus cereus AH676]
 gi|228722379|gb|EEL73775.1| Transcription termination factor Rho [Bacillus cereus AH676]
          Length = 292

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 118 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 173


>gi|147679170|ref|YP_001213385.1| transcription termination factor Rho [Pelotomaculum
           thermopropionicum SI]
 gi|146275267|dbj|BAF61016.1| transcription termination factor [Pelotomaculum thermopropionicum
           SI]
          Length = 434

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + ++I R+A  HNL   PSG     G+DP + +K KRF    RN      S+  +  A  
Sbjct: 258 LLDSITRLARAHNLVVPPSGRTLSGGVDPAALHKPKRFFGAARN-LEEGGSLTILATALI 316

Query: 67  ETICQLLDLPFSDGRTTEKKE 87
           ET  ++ D+ F + + T   E
Sbjct: 317 ETGSRMDDVIFEEFKGTGNME 337


>gi|254724688|ref|ZP_05186471.1| transcription termination factor Rho [Bacillus anthracis str.
           A1055]
          Length = 375

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|253577370|ref|ZP_04854687.1| transcription termination factor Rho [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843270|gb|EES71301.1| transcription termination factor Rho [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 454

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 252 EHKKDVVILLDSITRLARAYNLVVPPSGRTLSGGIDPAAFHRPKRFFGSARN 303


>gi|295707232|ref|YP_003600307.1| transcription termination factor Rho [Bacillus megaterium DSM 319]
 gi|294804891|gb|ADF41957.1| transcription termination factor Rho [Bacillus megaterium DSM 319]
          Length = 424

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|134301005|ref|YP_001114501.1| transcription termination factor Rho [Desulfotomaculum reducens
           MI-1]
 gi|134053705|gb|ABO51676.1| transcription termination factor Rho [Desulfotomaculum reducens
           MI-1]
          Length = 450

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + ++I R+A  HNL   PSG     G+DP + +K KRF    RN      S+  +  A  
Sbjct: 266 LLDSITRLARAHNLVIPPSGRTLSGGVDPAALHKPKRFFGAARN-MEEGGSLTILATALI 324

Query: 67  ETICQLLDLPFSDGRTT 83
           ET  ++ D+ F + + T
Sbjct: 325 ETGSRMDDVIFEEFKGT 341


>gi|228968461|ref|ZP_04129450.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228791241|gb|EEM38854.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 419

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|229087824|ref|ZP_04219939.1| Transcription termination factor Rho [Bacillus cereus Rock3-44]
 gi|228695485|gb|EEL48355.1| Transcription termination factor Rho [Bacillus cereus Rock3-44]
          Length = 423

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|228988559|ref|ZP_04148646.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229158893|ref|ZP_04286950.1| Transcription termination factor Rho [Bacillus cereus ATCC 4342]
 gi|228624504|gb|EEK81274.1| Transcription termination factor Rho [Bacillus cereus ATCC 4342]
 gi|228771176|gb|EEM19655.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 423

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|294501884|ref|YP_003565584.1| transcription termination factor Rho [Bacillus megaterium QM B1551]
 gi|51704740|gb|AAU09403.1| putative transcription termination factor Rho [Bacillus megaterium]
 gi|294351821|gb|ADE72150.1| transcription termination factor Rho [Bacillus megaterium QM B1551]
          Length = 424

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|47569757|ref|ZP_00240429.1| transcription termination factor Rho [Bacillus cereus G9241]
 gi|47553553|gb|EAL11932.1| transcription termination factor Rho [Bacillus cereus G9241]
          Length = 404

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|49480416|ref|YP_039325.1| transcription termination factor Rho [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52140230|ref|YP_086601.1| transcription termination factor Rho [Bacillus cereus E33L]
 gi|118480366|ref|YP_897517.1| transcription termination factor Rho [Bacillus thuringiensis str.
           Al Hakam]
 gi|196036945|ref|ZP_03104325.1| transcription termination factor Rho [Bacillus cereus W]
 gi|196041031|ref|ZP_03108328.1| transcription termination factor Rho [Bacillus cereus NVH0597-99]
 gi|218906510|ref|YP_002454344.1| transcription termination factor Rho [Bacillus cereus AH820]
 gi|225867313|ref|YP_002752691.1| transcription termination factor Rho [Bacillus cereus 03BB102]
 gi|228917941|ref|ZP_04081477.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228930341|ref|ZP_04093345.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228936617|ref|ZP_04099411.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228949053|ref|ZP_04111325.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229094444|ref|ZP_04225516.1| Transcription termination factor Rho [Bacillus cereus Rock3-42]
 gi|229124836|ref|ZP_04254014.1| Transcription termination factor Rho [Bacillus cereus 95/8201]
 gi|229187557|ref|ZP_04314697.1| Transcription termination factor Rho [Bacillus cereus BGSC 6E1]
 gi|300117846|ref|ZP_07055613.1| transcription termination factor Rho [Bacillus cereus SJ1]
 gi|301056800|ref|YP_003795011.1| transcription termination factor Rho [Bacillus anthracis CI]
 gi|49331972|gb|AAT62618.1| transcription termination factor Rho [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51973699|gb|AAU15249.1| transcription termination factor Rho [Bacillus cereus E33L]
 gi|118419591|gb|ABK88010.1| transcription termination factor Rho [Bacillus thuringiensis str.
           Al Hakam]
 gi|195990447|gb|EDX54435.1| transcription termination factor Rho [Bacillus cereus W]
 gi|196028199|gb|EDX66809.1| transcription termination factor Rho [Bacillus cereus NVH0597-99]
 gi|218536658|gb|ACK89056.1| transcription termination factor Rho [Bacillus cereus AH820]
 gi|225788441|gb|ACO28658.1| transcription termination factor Rho [Bacillus cereus 03BB102]
 gi|228595924|gb|EEK53604.1| Transcription termination factor Rho [Bacillus cereus BGSC 6E1]
 gi|228658627|gb|EEL14289.1| Transcription termination factor Rho [Bacillus cereus 95/8201]
 gi|228688981|gb|EEL42808.1| Transcription termination factor Rho [Bacillus cereus Rock3-42]
 gi|228810626|gb|EEM56975.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228823052|gb|EEM68890.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228829327|gb|EEM74960.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228841738|gb|EEM86849.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|298724710|gb|EFI65385.1| transcription termination factor Rho [Bacillus cereus SJ1]
 gi|300378969|gb|ADK07873.1| transcription termination factor Rho [Bacillus cereus biovar
           anthracis str. CI]
          Length = 423

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|42784505|ref|NP_981752.1| transcription termination factor Rho [Bacillus cereus ATCC 10987]
 gi|217962821|ref|YP_002341399.1| transcription termination factor Rho [Bacillus cereus AH187]
 gi|222098803|ref|YP_002532861.1| transcription termination factor rho [Bacillus cereus Q1]
 gi|229033965|ref|ZP_04188918.1| Transcription termination factor Rho [Bacillus cereus AH1271]
 gi|229076546|ref|ZP_04209506.1| Transcription termination factor Rho [Bacillus cereus Rock4-18]
 gi|229099765|ref|ZP_04230690.1| Transcription termination factor Rho [Bacillus cereus Rock3-29]
 gi|229105924|ref|ZP_04236548.1| Transcription termination factor Rho [Bacillus cereus Rock3-28]
 gi|229118827|ref|ZP_04248176.1| Transcription termination factor Rho [Bacillus cereus Rock1-3]
 gi|229142075|ref|ZP_04270600.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST26]
 gi|229176008|ref|ZP_04303503.1| Transcription termination factor Rho [Bacillus cereus MM3]
 gi|229199457|ref|ZP_04326120.1| Transcription termination factor Rho [Bacillus cereus m1293]
 gi|42740437|gb|AAS44360.1| transcription termination factor Rho [Bacillus cereus ATCC 10987]
 gi|217063665|gb|ACJ77915.1| transcription termination factor Rho [Bacillus cereus AH187]
 gi|221242862|gb|ACM15572.1| transcription termination factor Rho [Bacillus cereus Q1]
 gi|228584033|gb|EEK42188.1| Transcription termination factor Rho [Bacillus cereus m1293]
 gi|228607440|gb|EEK64767.1| Transcription termination factor Rho [Bacillus cereus MM3]
 gi|228641364|gb|EEK97670.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST26]
 gi|228664628|gb|EEL20121.1| Transcription termination factor Rho [Bacillus cereus Rock1-3]
 gi|228677498|gb|EEL31751.1| Transcription termination factor Rho [Bacillus cereus Rock3-28]
 gi|228683654|gb|EEL37607.1| Transcription termination factor Rho [Bacillus cereus Rock3-29]
 gi|228706579|gb|EEL58792.1| Transcription termination factor Rho [Bacillus cereus Rock4-18]
 gi|228728340|gb|EEL79363.1| Transcription termination factor Rho [Bacillus cereus AH1271]
 gi|324329281|gb|ADY24541.1| transcription termination factor Rho [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|30023363|ref|NP_834994.1| transcription termination factor Rho [Bacillus cereus ATCC 14579]
 gi|75764015|ref|ZP_00743630.1| Transcription termination factor rho [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|206970466|ref|ZP_03231419.1| transcription termination factor Rho [Bacillus cereus AH1134]
 gi|218232465|ref|YP_002370109.1| transcription termination factor Rho [Bacillus cereus B4264]
 gi|218900458|ref|YP_002448869.1| transcription termination factor Rho [Bacillus cereus G9842]
 gi|228903807|ref|ZP_04067923.1| Transcription termination factor Rho [Bacillus thuringiensis IBL
           4222]
 gi|228911171|ref|ZP_04074977.1| Transcription termination factor Rho [Bacillus thuringiensis IBL
           200]
 gi|228924068|ref|ZP_04087344.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228942479|ref|ZP_04105016.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228955580|ref|ZP_04117581.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228961596|ref|ZP_04123205.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228975411|ref|ZP_04135967.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228982048|ref|ZP_04142341.1| Transcription termination factor Rho [Bacillus thuringiensis Bt407]
 gi|229072799|ref|ZP_04205998.1| Transcription termination factor Rho [Bacillus cereus F65185]
 gi|229082546|ref|ZP_04215009.1| Transcription termination factor Rho [Bacillus cereus Rock4-2]
 gi|229112745|ref|ZP_04242278.1| Transcription termination factor Rho [Bacillus cereus Rock1-15]
 gi|229130581|ref|ZP_04259537.1| Transcription termination factor Rho [Bacillus cereus BDRD-Cer4]
 gi|229147872|ref|ZP_04276213.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST24]
 gi|229153495|ref|ZP_04281673.1| Transcription termination factor Rho [Bacillus cereus m1550]
 gi|229181581|ref|ZP_04308906.1| Transcription termination factor Rho [Bacillus cereus 172560W]
 gi|229193584|ref|ZP_04320528.1| Transcription termination factor Rho [Bacillus cereus ATCC 10876]
 gi|296505756|ref|YP_003667456.1| transcription termination factor Rho [Bacillus thuringiensis
           BMB171]
 gi|29898924|gb|AAP12195.1| Transcription termination factor rho [Bacillus cereus ATCC 14579]
 gi|74488496|gb|EAO52097.1| Transcription termination factor rho [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|206735043|gb|EDZ52212.1| transcription termination factor Rho [Bacillus cereus AH1134]
 gi|218160422|gb|ACK60414.1| transcription termination factor Rho [Bacillus cereus B4264]
 gi|218543153|gb|ACK95547.1| transcription termination factor Rho [Bacillus cereus G9842]
 gi|228589889|gb|EEK47764.1| Transcription termination factor Rho [Bacillus cereus ATCC 10876]
 gi|228601777|gb|EEK59273.1| Transcription termination factor Rho [Bacillus cereus 172560W]
 gi|228630099|gb|EEK86750.1| Transcription termination factor Rho [Bacillus cereus m1550]
 gi|228635522|gb|EEK92011.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST24]
 gi|228652920|gb|EEL08802.1| Transcription termination factor Rho [Bacillus cereus BDRD-Cer4]
 gi|228670726|gb|EEL26037.1| Transcription termination factor Rho [Bacillus cereus Rock1-15]
 gi|228700978|gb|EEL53501.1| Transcription termination factor Rho [Bacillus cereus Rock4-2]
 gi|228710290|gb|EEL62265.1| Transcription termination factor Rho [Bacillus cereus F65185]
 gi|228777712|gb|EEM25986.1| Transcription termination factor Rho [Bacillus thuringiensis Bt407]
 gi|228784393|gb|EEM32416.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228798078|gb|EEM45082.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228804083|gb|EEM50701.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228817221|gb|EEM63309.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228835558|gb|EEM80923.1| Transcription termination factor Rho [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228848534|gb|EEM93382.1| Transcription termination factor Rho [Bacillus thuringiensis IBL
           200]
 gi|228855834|gb|EEN00378.1| Transcription termination factor Rho [Bacillus thuringiensis IBL
           4222]
 gi|296326808|gb|ADH09736.1| transcription termination factor Rho [Bacillus thuringiensis
           BMB171]
 gi|326943130|gb|AEA19026.1| transcription termination factor Rho [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|229020551|ref|ZP_04177295.1| Transcription termination factor Rho [Bacillus cereus AH1273]
 gi|229026771|ref|ZP_04183103.1| Transcription termination factor Rho [Bacillus cereus AH1272]
 gi|228734494|gb|EEL85156.1| Transcription termination factor Rho [Bacillus cereus AH1272]
 gi|228740746|gb|EEL91000.1| Transcription termination factor Rho [Bacillus cereus AH1273]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|229164280|ref|ZP_04292213.1| Transcription termination factor Rho [Bacillus cereus R309803]
 gi|228619220|gb|EEK76113.1| Transcription termination factor Rho [Bacillus cereus R309803]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|152977518|ref|YP_001377035.1| transcription termination factor Rho [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152026270|gb|ABS24040.1| transcription termination factor Rho [Bacillus cytotoxicus NVH
           391-98]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|154687823|ref|YP_001422984.1| transcription termination factor Rho [Bacillus amyloliquefaciens
           FZB42]
 gi|308175436|ref|YP_003922141.1| transcription termination factor Rho [Bacillus amyloliquefaciens
           DSM 7]
 gi|154353674|gb|ABS75753.1| Rho [Bacillus amyloliquefaciens FZB42]
 gi|307608300|emb|CBI44671.1| transcription termination factor Rho [Bacillus amyloliquefaciens
           DSM 7]
 gi|328555416|gb|AEB25908.1| transcription termination factor Rho [Bacillus amyloliquefaciens
           TA208]
 gi|328913786|gb|AEB65382.1| transcription termination factor Rho [Bacillus amyloliquefaciens
           LL3]
          Length = 428

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|30265355|ref|NP_847732.1| transcription termination factor Rho [Bacillus anthracis str. Ames]
 gi|49188167|ref|YP_031420.1| transcription termination factor Rho [Bacillus anthracis str.
           Sterne]
 gi|50196969|ref|YP_052656.1| transcription termination factor Rho [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|165871258|ref|ZP_02215907.1| transcription termination factor Rho [Bacillus anthracis str.
           A0488]
 gi|167636685|ref|ZP_02394973.1| transcription termination factor Rho [Bacillus anthracis str.
           A0442]
 gi|167640450|ref|ZP_02398714.1| transcription termination factor Rho [Bacillus anthracis str.
           A0193]
 gi|170688189|ref|ZP_02879400.1| transcription termination factor Rho [Bacillus anthracis str.
           A0465]
 gi|170709367|ref|ZP_02899780.1| transcription termination factor Rho [Bacillus anthracis str.
           A0389]
 gi|177651843|ref|ZP_02934426.1| transcription termination factor Rho [Bacillus anthracis str.
           A0174]
 gi|190569097|ref|ZP_03021996.1| transcription termination factor Rho [Bacillus anthracis
           Tsiankovskii-I]
 gi|227818095|ref|YP_002818104.1| transcription termination factor Rho [Bacillus anthracis str. CDC
           684]
 gi|229602998|ref|YP_002869547.1| transcription termination factor Rho [Bacillus anthracis str.
           A0248]
 gi|254687226|ref|ZP_05151084.1| transcription termination factor Rho [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735261|ref|ZP_05192970.1| transcription termination factor Rho [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744464|ref|ZP_05202144.1| transcription termination factor Rho [Bacillus anthracis str.
           Kruger B]
 gi|254755802|ref|ZP_05207834.1| transcription termination factor Rho [Bacillus anthracis str.
           Vollum]
 gi|254762142|ref|ZP_05213988.1| transcription termination factor Rho [Bacillus anthracis str.
           Australia 94]
 gi|30260033|gb|AAP29218.1| transcription termination factor Rho [Bacillus anthracis str. Ames]
 gi|49182094|gb|AAT57470.1| transcription termination factor Rho [Bacillus anthracis str.
           Sterne]
 gi|50083031|gb|AAT70164.1| transcription termination factor Rho [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|164712925|gb|EDR18453.1| transcription termination factor Rho [Bacillus anthracis str.
           A0488]
 gi|167511670|gb|EDR87052.1| transcription termination factor Rho [Bacillus anthracis str.
           A0193]
 gi|167527885|gb|EDR90707.1| transcription termination factor Rho [Bacillus anthracis str.
           A0442]
 gi|170125715|gb|EDS94629.1| transcription termination factor Rho [Bacillus anthracis str.
           A0389]
 gi|170667882|gb|EDT18634.1| transcription termination factor Rho [Bacillus anthracis str.
           A0465]
 gi|172082547|gb|EDT67611.1| transcription termination factor Rho [Bacillus anthracis str.
           A0174]
 gi|190559765|gb|EDV13751.1| transcription termination factor Rho [Bacillus anthracis
           Tsiankovskii-I]
 gi|227003371|gb|ACP13114.1| transcription termination factor Rho [Bacillus anthracis str. CDC
           684]
 gi|229267406|gb|ACQ49043.1| transcription termination factor Rho [Bacillus anthracis str.
           A0248]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|853769|emb|CAA89877.1| transcriptional terminator Rho [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 427

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKYVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|228994051|ref|ZP_04153952.1| Transcription termination factor Rho [Bacillus pseudomycoides DSM
           12442]
 gi|229000119|ref|ZP_04159689.1| Transcription termination factor Rho [Bacillus mycoides Rock3-17]
 gi|229007639|ref|ZP_04165233.1| Transcription termination factor Rho [Bacillus mycoides Rock1-4]
 gi|228753650|gb|EEM03094.1| Transcription termination factor Rho [Bacillus mycoides Rock1-4]
 gi|228759656|gb|EEM08632.1| Transcription termination factor Rho [Bacillus mycoides Rock3-17]
 gi|228765699|gb|EEM14352.1| Transcription termination factor Rho [Bacillus pseudomycoides DSM
           12442]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|196233812|ref|ZP_03132651.1| putative phage repressor [Chthoniobacter flavus Ellin428]
 gi|196222174|gb|EDY16705.1| putative phage repressor [Chthoniobacter flavus Ellin428]
          Length = 311

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG-RSIDLMSLN 199
           K +  SM P    GDI ++ S I+   G  +L++   GD+  K   +R G R + L S+N
Sbjct: 225 KIEGDSMYPEINPGDIAVVRSDIEPRPGQVVLVRTLDGDVWCKRYSTRDGNRFVVLSSIN 284

Query: 200 CCYPVDTVEMSDIEWI 215
             Y    +    I WI
Sbjct: 285 DTYRPFEISAESIAWI 300


>gi|221311669|ref|ZP_03593516.1| transcription termination factor Rho [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315997|ref|ZP_03597802.1| transcription termination factor Rho [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320908|ref|ZP_03602202.1| transcription termination factor Rho [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325192|ref|ZP_03606486.1| transcription termination factor Rho [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767787|ref|NP_391589.2| transcription termination factor Rho [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|296331347|ref|ZP_06873819.1| transcription termination factor Rho [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676333|ref|YP_003868005.1| transcription termination factor Rho [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|321313258|ref|YP_004205545.1| transcription termination factor Rho [Bacillus subtilis BSn5]
 gi|254763405|sp|Q03222|RHO_BACSU RecName: Full=Transcription termination factor Rho; AltName:
           Full=ATP-dependent helicase Rho
 gi|143434|gb|AAA02900.1| Rho Factor [Bacillus subtilis]
 gi|225185415|emb|CAB15725.2| transcriptional terminator Rho [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291486292|dbj|BAI87367.1| transcription termination factor Rho [Bacillus subtilis subsp.
           natto BEST195]
 gi|296151462|gb|EFG92339.1| transcription termination factor Rho [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414577|gb|ADM39696.1| transcription termination factor Rho [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|320019532|gb|ADV94518.1| transcription termination factor Rho [Bacillus subtilis BSn5]
          Length = 427

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|311070227|ref|YP_003975150.1| transcription termination factor Rho [Bacillus atrophaeus 1942]
 gi|310870744|gb|ADP34219.1| transcription termination factor Rho [Bacillus atrophaeus 1942]
          Length = 427

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|56965637|ref|YP_177371.1| transcription termination factor Rho [Bacillus clausii KSM-K16]
 gi|56911883|dbj|BAD66410.1| transcriptional termination factor Rho [Bacillus clausii KSM-K16]
          Length = 422

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|323702613|ref|ZP_08114275.1| transcription termination factor Rho [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532432|gb|EGB22309.1| transcription termination factor Rho [Desulfotomaculum nigrificans
           DSM 574]
          Length = 446

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + ++I R+A  HNL   PSG     G+DP + +K KRF    RN      S+  +  A  
Sbjct: 265 LLDSITRLARAHNLVIPPSGRTLSGGVDPAALHKPKRFFGAARN-MEEGGSLTILATALI 323

Query: 67  ETICQLLDLPFSDGRTT 83
           ET  ++ D+ F + + T
Sbjct: 324 ETGSRMDDVIFEEFKGT 340


>gi|310639617|ref|YP_003944375.1| transcription termination factor rho [Paenibacillus polymyxa SC2]
 gi|309244567|gb|ADO54134.1| transcription termination factor Rho [Paenibacillus polymyxa SC2]
          Length = 445

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 303


>gi|169333724|ref|ZP_02860917.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259573|gb|EDS73539.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
          Length = 197

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 85/207 (41%), Gaps = 28/207 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +  + + H +T   LA    LD +S  K +  GI      PS +++ KI A  N +I 
Sbjct: 4   EKLRSLRKEHGMTQVDLANALDLDKSSIAKYESAGI-----IPSVDTLQKISALFNVSID 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            LL+ PF D       E    ++    +G  G            +  +G+ +  + +N  
Sbjct: 59  YLLNAPFGDINNVMNVE----IIGTVVAGRDGI---------ATYEFLGISQAININN-- 103

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR--LLIKPRTGDIVAKVLISR 188
              + +    K +  SM P   +GD+ ++     ++ GD   ++I    G ++ KV   +
Sbjct: 104 ---KDEYKYLKVRGDSMAPQILEGDLALVRLQPDIDSGDLAVVIIGGEEG-VIKKV--QK 157

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWI 215
              SI L+S N  Y        D+E +
Sbjct: 158 TDNSISLISFNPMYDTRVFIGKDMEQL 184


>gi|308066970|ref|YP_003868575.1| transcription termination factor rho [Paenibacillus polymyxa E681]
 gi|305856249|gb|ADM68037.1| Transcription termination factor rho [Paenibacillus polymyxa E681]
          Length = 445

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 303


>gi|261404004|ref|YP_003240245.1| transcription termination factor Rho [Paenibacillus sp. Y412MC10]
 gi|261280467|gb|ACX62438.1| transcription termination factor Rho [Paenibacillus sp. Y412MC10]
          Length = 442

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 303


>gi|194016545|ref|ZP_03055159.1| transcription termination factor Rho [Bacillus pumilus ATCC 7061]
 gi|194012018|gb|EDW21586.1| transcription termination factor Rho [Bacillus pumilus ATCC 7061]
          Length = 427

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|171910721|ref|ZP_02926191.1| hypothetical protein VspiD_06095 [Verrucomicrobium spinosum DSM
           4136]
          Length = 407

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRT----GDIVAKVLISRRGRSIDLMSLNCC 201
           +M P Y +G I I+   +    GD +L + R     G I+  V   + G S+ L S +  
Sbjct: 323 AMAPHYPEGCIAIICPGLPSRNGDLVLARLRDERGGGTILRLVHFIQDGESLVLTSTHAA 382

Query: 202 YPVDTVEMSDIEWIARI 218
           YP  TV+  D+ W+A +
Sbjct: 383 YPPLTVQKEDLLWLAPV 399


>gi|329930193|ref|ZP_08283806.1| transcription termination factor Rho [Paenibacillus sp. HGF5]
 gi|328935215|gb|EGG31696.1| transcription termination factor Rho [Paenibacillus sp. HGF5]
          Length = 442

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 303


>gi|15616343|ref|NP_244648.1| transcription termination factor Rho [Bacillus halodurans C-125]
 gi|10176406|dbj|BAB07500.1| transcriptional terminator [Bacillus halodurans C-125]
          Length = 423

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|251794176|ref|YP_003008907.1| transcription termination factor Rho [Paenibacillus sp. JDR-2]
 gi|247541802|gb|ACS98820.1| transcription termination factor Rho [Paenibacillus sp. JDR-2]
          Length = 449

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 254 HKKDVVILLDSITRLARAYNLVVPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|226315070|ref|YP_002774966.1| transcription termination factor [Brevibacillus brevis NBRC 100599]
 gi|226098020|dbj|BAH46462.1| transcription termination factor [Brevibacillus brevis NBRC 100599]
          Length = 426

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 EHKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 301


>gi|315644455|ref|ZP_07897588.1| transcription termination factor Rho [Paenibacillus vortex V453]
 gi|315280205|gb|EFU43498.1| transcription termination factor Rho [Paenibacillus vortex V453]
          Length = 445

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 303


>gi|166240889|ref|ZP_02240761.1| transcription termination factor Rho [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 290

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 201 HKKDVVILLDSITRLARAYNLVVPPSGRTLSGGIDPGAFHRPKRFFGSARN 251


>gi|317130778|ref|YP_004097060.1| transcription termination factor Rho [Bacillus cellulosilyticus DSM
           2522]
 gi|315475726|gb|ADU32329.1| transcription termination factor Rho [Bacillus cellulosilyticus DSM
           2522]
          Length = 453

 Score = 36.2 bits (82), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP SF++ KRF    RN
Sbjct: 290 LMDSITRLARAYNLVIPPSGRTLSGGIDPASFHRPKRFFGAARN 333


>gi|289662784|ref|ZP_06484365.1| transcriptional regulator [Xanthomonas campestris pv. vasculorum
          NCPPB702]
          Length = 184

 Score = 36.2 bits (82), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 6/53 (11%)

Query: 13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
          + R+ +RH LT + LAR+ GL P+  N+     IE RN+ P T +I + L AT
Sbjct: 16 LQRLRQRHGLTQAELARRLGLSPSYLNQ-----IE-RNQRPLTLAIQQRLKAT 62


>gi|304393973|ref|ZP_07375897.1| XRE family transcriptional regulator [Ahrensia sp. R2A130]
 gi|303293948|gb|EFL88324.1| XRE family transcriptional regulator [Ahrensia sp. R2A130]
          Length = 271

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 146 SMLPLYRKGDILILNSAI---QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
           SM P+Y    I+  +  +    V    R ++K   G I+ K L  RRG + +L +L+   
Sbjct: 191 SMFPVYEDRAIIYYSDNVTDPSVMLNKRCVVKLANGRILVKKL--RRGTTDELWNLDSFN 248

Query: 203 PV-DTVEMSDIEWIARILWASQ 223
           P   T+E   +EW+A+I W  +
Sbjct: 249 PAFPTMEDQIVEWVAKIDWVKE 270


>gi|258513423|ref|YP_003189645.1| transcription termination factor Rho [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777128|gb|ACV61022.1| transcription termination factor Rho [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 436

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI 58
            HKK    + ++I R+A  HNL   PSG     G+DP + +K KRF    R +     S+
Sbjct: 250 EHKKDVVILMDSITRLARAHNLIVPPSGRTLSGGVDPAALHKPKRFFGAAR-KLEEGGSL 308

Query: 59  FKILAATNETICQLLDLPFSDGRTT 83
             +  A  ET  ++ D+ F + + T
Sbjct: 309 TILATALVETGSRMDDVIFEEFKGT 333


>gi|229542472|ref|ZP_04431532.1| transcription termination factor Rho [Bacillus coagulans 36D1]
 gi|229326892|gb|EEN92567.1| transcription termination factor Rho [Bacillus coagulans 36D1]
          Length = 426

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|260583442|ref|ZP_05851190.1| transcription termination factor Rho [Granulicatella elegans ATCC
           700633]
 gi|260158068|gb|EEW93136.1| transcription termination factor Rho [Granulicatella elegans ATCC
           700633]
          Length = 426

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NLT  PSG     G+DP +F + KRF    RN
Sbjct: 271 LLDSITRLARAYNLTIPPSGRTLSGGIDPAAFYRPKRFFGSARN 314


>gi|289679295|ref|ZP_06500185.1| transcriptional repressor pyocin R2_PP [Pseudomonas syringae pv.
           syringae FF5]
          Length = 244

 Score = 35.8 bits (81), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 151 YRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
           Y  G I+ ++  I+ N GDR++ + PRT ++  KVL+   GR   L  +N  YP+
Sbjct: 171 YPAGCIIFVDPDIEANPGDRVIARVPRTDEMTFKVLVEDAGRQF-LRPINPQYPI 224


>gi|149184889|ref|ZP_01863206.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. SD-21]
 gi|148831000|gb|EDL49434.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. SD-21]
          Length = 211

 Score = 35.8 bits (81), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRL-----LIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           SM P    GD ++++++ Q   G RL     +++     +V +V +   GR I + S N 
Sbjct: 129 SMEPTLSDGDEVLVDASDQ---GSRLRDGIYVLRADDALVVKRVTLKPGGRKITISSDNS 185

Query: 201 CYPV-DTVEMSDIEWIARILW 220
            YP  D V+ S+I+ + R++W
Sbjct: 186 AYPSWDDVDRSEIQVVGRVIW 206


>gi|52082242|ref|YP_081033.1| transcription termination factor Rho [Bacillus licheniformis ATCC
           14580]
 gi|52787634|ref|YP_093463.1| transcription termination factor Rho [Bacillus licheniformis ATCC
           14580]
 gi|319648116|ref|ZP_08002333.1| transcription termination factor rho [Bacillus sp. BT1B_CT2]
 gi|52005453|gb|AAU25395.1| transcriptional terminator Rho [Bacillus licheniformis ATCC 14580]
 gi|52350136|gb|AAU42770.1| Rho [Bacillus licheniformis ATCC 14580]
 gi|317389751|gb|EFV70561.1| transcription termination factor rho [Bacillus sp. BT1B_CT2]
          Length = 427

 Score = 35.8 bits (81), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPGAFHRPKRFFGAARN 305


>gi|297585445|ref|YP_003701225.1| transcription termination factor Rho [Bacillus selenitireducens
           MLS10]
 gi|297143902|gb|ADI00660.1| transcription termination factor Rho [Bacillus selenitireducens
           MLS10]
          Length = 427

 Score = 35.8 bits (81), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP SF++ KRF    RN
Sbjct: 261 LMDSITRLARAYNLVVPPSGRTLSGGIDPASFHRPKRFFGAARN 304


>gi|295400665|ref|ZP_06810642.1| transcription termination factor Rho [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112645|ref|YP_003990961.1| transcription termination factor Rho [Geobacillus sp. Y4.1MC1]
 gi|294977246|gb|EFG52847.1| transcription termination factor Rho [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217746|gb|ADP76350.1| transcription termination factor Rho [Geobacillus sp. Y4.1MC1]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|56421917|ref|YP_149235.1| transcription termination factor Rho [Geobacillus kaustophilus
           HTA426]
 gi|56381759|dbj|BAD77667.1| transcriptional terminator [Geobacillus kaustophilus HTA426]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|261420787|ref|YP_003254469.1| transcription termination factor Rho [Geobacillus sp. Y412MC61]
 gi|297531582|ref|YP_003672857.1| transcription termination factor Rho [Geobacillus sp. C56-T3]
 gi|319768457|ref|YP_004133958.1| transcription termination factor Rho [Geobacillus sp. Y412MC52]
 gi|261377244|gb|ACX79987.1| transcription termination factor Rho [Geobacillus sp. Y412MC61]
 gi|297254834|gb|ADI28280.1| transcription termination factor Rho [Geobacillus sp. C56-T3]
 gi|317113323|gb|ADU95815.1| transcription termination factor Rho [Geobacillus sp. Y412MC52]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|138896958|ref|YP_001127411.1| transcription termination factor Rho [Geobacillus
           thermodenitrificans NG80-2]
 gi|196249776|ref|ZP_03148472.1| transcription termination factor Rho [Geobacillus sp. G11MC16]
 gi|134268471|gb|ABO68666.1| Rho Factor [Geobacillus thermodenitrificans NG80-2]
 gi|196210652|gb|EDY05415.1| transcription termination factor Rho [Geobacillus sp. G11MC16]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|212640543|ref|YP_002317063.1| transcription termination factor Rho [Anoxybacillus flavithermus
           WK1]
 gi|212562023|gb|ACJ35078.1| Transcriptional terminator Rho [Anoxybacillus flavithermus WK1]
          Length = 428

 Score = 35.8 bits (81), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 252 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 307


>gi|229014501|ref|ZP_04171619.1| Transcription termination factor Rho [Bacillus mycoides DSM 2048]
 gi|228746851|gb|EEL96736.1| Transcription termination factor Rho [Bacillus mycoides DSM 2048]
          Length = 421

 Score = 35.8 bits (81), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 247 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 302


>gi|239828611|ref|YP_002951235.1| transcription termination factor Rho [Geobacillus sp. WCH70]
 gi|239808904|gb|ACS25969.1| transcription termination factor Rho [Geobacillus sp. WCH70]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|163943020|ref|YP_001647904.1| transcription termination factor Rho [Bacillus weihenstephanensis
           KBAB4]
 gi|229064982|ref|ZP_04200280.1| Transcription termination factor Rho [Bacillus cereus AH603]
 gi|229136151|ref|ZP_04264904.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST196]
 gi|229170041|ref|ZP_04297732.1| Transcription termination factor Rho [Bacillus cereus AH621]
 gi|163865217|gb|ABY46276.1| transcription termination factor Rho [Bacillus weihenstephanensis
           KBAB4]
 gi|228613388|gb|EEK70522.1| Transcription termination factor Rho [Bacillus cereus AH621]
 gi|228647310|gb|EEL03392.1| Transcription termination factor Rho [Bacillus cereus BDRD-ST196]
 gi|228716283|gb|EEL67995.1| Transcription termination factor Rho [Bacillus cereus AH603]
          Length = 423

 Score = 35.8 bits (81), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|205375308|ref|ZP_03228098.1| transcription termination factor Rho [Bacillus coahuilensis m4-4]
          Length = 424

 Score = 35.8 bits (81), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|23100456|ref|NP_693923.1| transcription termination factor Rho [Oceanobacillus iheyensis
           HTE831]
 gi|22778689|dbj|BAC14957.1| transcriptional termination factor rho [Oceanobacillus iheyensis
           HTE831]
          Length = 426

 Score = 35.8 bits (81), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 252 MRLVEHKRDVIVLMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 307


>gi|322382237|ref|ZP_08056150.1| transcription termination factor Rho-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153818|gb|EFX46186.1| transcription termination factor Rho-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 419

 Score = 35.8 bits (81), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 243 EHKKDVVILLDSITRLARAYNLVVPPSGRTLSGGIDPGAFHRPKRFFGSARN 294


>gi|323490899|ref|ZP_08096094.1| transcription termination factor Rho [Planococcus donghaensis
           MPA1U2]
 gi|323395379|gb|EGA88230.1| transcription termination factor Rho [Planococcus donghaensis
           MPA1U2]
          Length = 427

 Score = 35.8 bits (81), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|89095596|ref|ZP_01168490.1| transcription termination factor Rho [Bacillus sp. NRRL B-14911]
 gi|89089342|gb|EAR68449.1| transcription termination factor Rho [Bacillus sp. NRRL B-14911]
          Length = 424

 Score = 35.4 bits (80), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|288554413|ref|YP_003426348.1| transcription termination factor Rho [Bacillus pseudofirmus OF4]
 gi|288545573|gb|ADC49456.1| transcription termination factor Rho [Bacillus pseudofirmus OF4]
          Length = 424

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    H+K    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 250 MRLVEHRKDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|319650901|ref|ZP_08005037.1| transcription termination factor Rho [Bacillus sp. 2_A_57_CT2]
 gi|317397394|gb|EFV78096.1| transcription termination factor Rho [Bacillus sp. 2_A_57_CT2]
          Length = 421

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 249 MRLVEHKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|166032750|ref|ZP_02235579.1| hypothetical protein DORFOR_02465 [Dorea formicigenerans ATCC
           27755]
 gi|166027107|gb|EDR45864.1| hypothetical protein DORFOR_02465 [Dorea formicigenerans ATCC
           27755]
          Length = 450

 Score = 35.4 bits (80), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HKK    + ++I R+A  +NLT  PSG     GLDP + +  KRF    RN
Sbjct: 284 HKKDVMILLDSITRLARAYNLTVSPSGRTLSGGLDPAALHMPKRFFGAARN 334


>gi|3860233|gb|AAC73004.1| Sir2 homolog [Trypanosoma brucei]
          Length = 351

 Score = 35.4 bits (80), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
             G+P+ RSPH G+YA  ++   +  +D   LPL R+   +  N
Sbjct: 43  AAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYN 86


>gi|261329219|emb|CBH12198.1| NAD-dependent SIR2 [Trypanosoma brucei gambiense DAL972]
          Length = 352

 Score = 35.4 bits (80), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
             G+P+ RSPH G+YA  ++   +  +D   LPL R+
Sbjct: 43  AAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQ 79


>gi|299537963|ref|ZP_07051249.1| transcription termination factor Rho [Lysinibacillus fusiformis
           ZC1]
 gi|298726545|gb|EFI67134.1| transcription termination factor Rho [Lysinibacillus fusiformis
           ZC1]
          Length = 427

 Score = 35.4 bits (80), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 254 EHKRDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 305


>gi|332971808|gb|EGK10756.1| transcription termination factor Rho [Desmospora sp. 8437]
          Length = 420

 Score = 35.4 bits (80), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 6   HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           HK+    + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 253 HKRDVVILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 303


>gi|317121000|ref|YP_004101003.1| transcription termination factor Rho [Thermaerobacter marianensis
           DSM 12885]
 gi|315590980|gb|ADU50276.1| transcription termination factor Rho [Thermaerobacter marianensis
           DSM 12885]
          Length = 865

 Score = 35.4 bits (80), Expect = 6.2,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 11  EAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           +++ R+   HNL   PSG     GLDP +F K KRF    RN
Sbjct: 709 DSLTRLTRAHNLVTPPSGRTLSGGLDPAAFYKPKRFFGAARN 750


>gi|313903654|ref|ZP_07837044.1| transcription termination factor Rho [Thermaerobacter subterraneus
           DSM 13965]
 gi|313466207|gb|EFR61731.1| transcription termination factor Rho [Thermaerobacter subterraneus
           DSM 13965]
          Length = 672

 Score = 35.4 bits (80), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 11  EAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           +++ R+   HNL   PSG     GLDP +F K KRF    RN
Sbjct: 516 DSLTRLTRAHNLVTPPSGRTLSGGLDPAAFYKPKRFFGAARN 557


>gi|212712325|ref|ZP_03320453.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
 gi|212685071|gb|EEB44599.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
          Length = 224

 Score = 35.4 bits (80), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP-- 203
           SM+P  ++G+ +I+        GD +L+   T + + K  +  R   I L S+N  +P  
Sbjct: 138 SMIPRIKEGEFVIIEPNHTYRPGDEVLLVTSTEETMVKTYLYERDGYIHLSSINDAHPPI 197

Query: 204 -VDTVEMSDIEWIARI----LWASQ 223
            V+ +++  I ++A I    LW  +
Sbjct: 198 KVEQIKVDKIHYVAGIAKPSLWYEK 222


>gi|72390998|ref|XP_845793.1| silent information regulator 2 [Trypanosoma brucei TREU927]
 gi|62176420|gb|AAX70528.1| silent information regulator 2 [Trypanosoma brucei]
 gi|70802329|gb|AAZ12234.1| silent information regulator 2 [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
          Length = 351

 Score = 35.4 bits (80), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
             G+P+ RSPH G+YA  ++   +  +D   LPL R+   +  N
Sbjct: 43  AAGIPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYN 86


>gi|327441451|dbj|BAK17816.1| transcription termination factor [Solibacillus silvestris StLB046]
          Length = 427

 Score = 35.4 bits (80), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 305


>gi|304407310|ref|ZP_07388963.1| transcription termination factor Rho [Paenibacillus curdlanolyticus
           YK9]
 gi|304343751|gb|EFM09592.1| transcription termination factor Rho [Paenibacillus curdlanolyticus
           YK9]
          Length = 456

 Score = 35.0 bits (79), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 261 LLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARN 304


>gi|315304808|ref|ZP_07874967.1| transcription termination factor Rho [Listeria ivanovii FSL F6-596]
 gi|313626823|gb|EFR95797.1| transcription termination factor Rho [Listeria ivanovii FSL F6-596]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|313622337|gb|EFR92824.1| transcription termination factor Rho [Listeria innocua FSL J1-023]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|289435818|ref|YP_003465690.1| hypothetical protein lse_2457 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172062|emb|CBH28608.1| rho [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|16801757|ref|NP_472025.1| transcription termination factor Rho [Listeria innocua Clip11262]
 gi|16415232|emb|CAC97922.1| rho [Listeria innocua Clip11262]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|313631901|gb|EFR99050.1| transcription termination factor Rho [Listeria seeligeri FSL
           N1-067]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|313636259|gb|EFS02077.1| transcription termination factor Rho [Listeria seeligeri FSL
           S4-171]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|254825314|ref|ZP_05230315.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J1-194]
 gi|254828127|ref|ZP_05232814.1| transcription termination factor Rho [Listeria monocytogenes FSL
           N3-165]
 gi|254831026|ref|ZP_05235681.1| transcription termination factor Rho [Listeria monocytogenes
           10403S]
 gi|254853921|ref|ZP_05243269.1| transcription termination factor Rho [Listeria monocytogenes FSL
           R2-503]
 gi|255520817|ref|ZP_05388054.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J1-175]
 gi|284802989|ref|YP_003414854.1| transcription termination factor Rho [Listeria monocytogenes
           08-5578]
 gi|284996130|ref|YP_003417898.1| transcription termination factor Rho [Listeria monocytogenes
           08-5923]
 gi|15054717|gb|AAK82680.1| transcription termination factor Rho [Listeria monocytogenes]
 gi|258600512|gb|EEW13837.1| transcription termination factor Rho [Listeria monocytogenes FSL
           N3-165]
 gi|258607308|gb|EEW19916.1| transcription termination factor Rho [Listeria monocytogenes FSL
           R2-503]
 gi|284058551|gb|ADB69492.1| transcription termination factor Rho [Listeria monocytogenes
           08-5578]
 gi|284061597|gb|ADB72536.1| transcription termination factor Rho [Listeria monocytogenes
           08-5923]
 gi|293594560|gb|EFG02321.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J1-194]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|16804589|ref|NP_466074.1| transcription termination factor Rho [Listeria monocytogenes EGD-e]
 gi|47097667|ref|ZP_00235183.1| transcription termination factor Rho [Listeria monocytogenes str.
           1/2a F6854]
 gi|224500705|ref|ZP_03669054.1| transcription termination factor Rho [Listeria monocytogenes
           Finland 1988]
 gi|224503209|ref|ZP_03671516.1| transcription termination factor Rho [Listeria monocytogenes FSL
           R2-561]
 gi|254900310|ref|ZP_05260234.1| transcription termination factor Rho [Listeria monocytogenes J0161]
 gi|254913451|ref|ZP_05263463.1| rho [Listeria monocytogenes J2818]
 gi|254937832|ref|ZP_05269529.1| transcription termination factor Rho [Listeria monocytogenes F6900]
 gi|255025427|ref|ZP_05297413.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J2-003]
 gi|16412039|emb|CAD00629.1| rho [Listeria monocytogenes EGD-e]
 gi|47013959|gb|EAL04976.1| transcription termination factor Rho [Listeria monocytogenes str.
           1/2a F6854]
 gi|258610436|gb|EEW23044.1| transcription termination factor Rho [Listeria monocytogenes F6900]
 gi|293591458|gb|EFF99792.1| rho [Listeria monocytogenes J2818]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|315283722|ref|ZP_07871821.1| transcription termination factor Rho [Listeria marthii FSL S4-120]
 gi|313612637|gb|EFR86680.1| transcription termination factor Rho [Listeria marthii FSL S4-120]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|311033348|ref|ZP_07711438.1| transcription termination factor Rho [Bacillus sp. m3-13]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 261 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 304


>gi|116873917|ref|YP_850698.1| transcription termination factor Rho [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116742795|emb|CAK21919.1| transcription termination factor [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|299821835|ref|ZP_07053723.1| transcription termination factor Rho [Listeria grayi DSM 20601]
 gi|299817500|gb|EFI84736.1| transcription termination factor Rho [Listeria grayi DSM 20601]
          Length = 431

 Score = 35.0 bits (79), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 270 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 313


>gi|167759402|ref|ZP_02431529.1| hypothetical protein CLOSCI_01749 [Clostridium scindens ATCC 35704]
 gi|167662959|gb|EDS07089.1| hypothetical protein CLOSCI_01749 [Clostridium scindens ATCC 35704]
          Length = 447

 Score = 35.0 bits (79), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
            HKK    + ++I R+A  +NLT  PSG     GLDP + +  KRF    RN
Sbjct: 280 EHKKDVMILLDSITRLARAYNLTVPPSGRTLSGGLDPAALHMPKRFFGAARN 331


>gi|46908722|ref|YP_015111.1| transcription termination factor Rho [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|226225098|ref|YP_002759205.1| transcription terminator factor rho [Listeria monocytogenes
           Clip81459]
 gi|46881994|gb|AAT05288.1| transcription termination factor Rho [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|225877560|emb|CAS06274.1| Putative transcription terminator factor rho [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|328465153|gb|EGF36421.1| transcription termination factor Rho [Listeria monocytogenes 1816]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|217963346|ref|YP_002349024.1| transcription termination factor Rho [Listeria monocytogenes HCC23]
 gi|290892713|ref|ZP_06555705.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J2-071]
 gi|217332616|gb|ACK38410.1| transcription termination factor Rho [Listeria monocytogenes HCC23]
 gi|290557773|gb|EFD91295.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J2-071]
 gi|307572077|emb|CAR85256.1| rho [Listeria monocytogenes L99]
 gi|313606709|gb|EFR83438.1| transcription termination factor Rho [Listeria monocytogenes FSL
           F2-208]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|254932208|ref|ZP_05265567.1| transcription termination factor Rho [Listeria monocytogenes
           HPB2262]
 gi|9247160|gb|AAD09997.2| transcription termination factor Rho [Listeria monocytogenes]
 gi|293583763|gb|EFF95795.1| transcription termination factor Rho [Listeria monocytogenes
           HPB2262]
 gi|328471065|gb|EGF41972.1| transcription termination factor Rho [Listeria monocytogenes 220]
 gi|332312980|gb|EGJ26075.1| Transcription termination factor Rho [Listeria monocytogenes str.
           Scott A]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|47093877|ref|ZP_00231619.1| transcription termination factor Rho [Listeria monocytogenes str.
           4b H7858]
 gi|47017751|gb|EAL08542.1| transcription termination factor Rho [Listeria monocytogenes str.
           4b H7858]
          Length = 423

 Score = 35.0 bits (79), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|188492331|ref|ZP_02999601.1| bacteriophage CI repressor protein [Escherichia coli 53638]
 gi|188487530|gb|EDU62633.1| bacteriophage CI repressor protein [Escherichia coli 53638]
          Length = 129

 Score = 35.0 bits (79), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 9/90 (10%)

Query: 11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
          E +D ++++H+L+ S LAR AG+  +S N  K+ G        S +S  KI  ATN ++ 
Sbjct: 14 ERLDTISQQHHLSGSDLARIAGVGRSSVNAWKKRGT------ISKDSAAKIAEATNVSLS 67

Query: 71 QLLDLPFSDGRTT-EKKEKEIPLLY--FPP 97
           LL       R T +  EK +  +Y   PP
Sbjct: 68 WLLTGKEDSNRETLDDDEKALLDVYRNLPP 97


>gi|255028931|ref|ZP_05300882.1| transcription termination factor Rho [Listeria monocytogenes LO28]
          Length = 370

 Score = 35.0 bits (79), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 209 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 252


>gi|225568384|ref|ZP_03777409.1| hypothetical protein CLOHYLEM_04461 [Clostridium hylemonae DSM
          15053]
 gi|225162612|gb|EEG75231.1| hypothetical protein CLOHYLEM_04461 [Clostridium hylemonae DSM
          15053]
          Length = 207

 Score = 35.0 bits (79), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 6  HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
          HKK    + ++I R+A  +NLT  PSG     GLDP + +  KRF    RN
Sbjct: 41 HKKDVMILLDSITRLARAYNLTVPPSGRTLSGGLDPAALHMPKRFFGAARN 91


>gi|254992825|ref|ZP_05275015.1| transcription termination factor Rho [Listeria monocytogenes FSL
           J2-064]
          Length = 449

 Score = 35.0 bits (79), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 262 LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 305


>gi|229917068|ref|YP_002885714.1| transcription termination factor Rho [Exiguobacterium sp. AT1b]
 gi|229468497|gb|ACQ70269.1| transcription termination factor Rho [Exiguobacterium sp. AT1b]
          Length = 445

 Score = 35.0 bits (79), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 1   MTSFSHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           M    HKK    + ++I R+   +NL+  PSG     G+DP +F+K K+F    RN
Sbjct: 265 MRLVEHKKDVVILLDSITRLTRAYNLSVPPSGRTLSGGIDPAAFHKPKKFFGAARN 320


>gi|85375768|ref|YP_459830.1| prophage MuMc02, S24 family peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84788851|gb|ABC65033.1| prophage MuMc02, peptidase, family S24 [Erythrobacter litoralis
           HTCC2594]
          Length = 211

 Score = 35.0 bits (79), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRL-----LIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           SM P    GD ++++++   + G RL     +++     +V +V +   GR I + S N 
Sbjct: 129 SMEPTLSDGDEVLVDAS---DEGSRLRDGIYVLRADDALVVKRVTLKPGGRKITISSDNA 185

Query: 201 CYPV-DTVEMSDIEWIARILW 220
            YP  D V+ S+I+ + R++W
Sbjct: 186 AYPSWDDVDRSEIQVVGRVIW 206


>gi|291520816|emb|CBK79109.1| transcription termination factor Rho [Coprococcus catus GD/7]
          Length = 593

 Score = 35.0 bits (79), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 5   SHKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI 58
            HKK    + ++I R+A  +NLT  PSG     GLDP + +  K+F    RN      S+
Sbjct: 426 EHKKDVVILLDSITRLARAYNLTVPPSGRTLSGGLDPAALHMPKKFFGAARNMREGG-SL 484

Query: 59  FKILAATNETICQLLDLPFSDGRTT 83
             +  A  ET  ++ D+ F + + T
Sbjct: 485 TVLATALVETGSKMDDVVFEEFKGT 509


>gi|332160963|ref|YP_004297540.1| putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665193|gb|ADZ41837.1| Putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862119|emb|CBX72283.1| hypothetical protein YEW_AK02200 [Yersinia enterocolitica W22703]
          Length = 225

 Score = 34.7 bits (78), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 15/143 (10%)

Query: 62  LAATNETICQLLD-----LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           ++  + T C L+D     +    G   E   ++IP++     G+GGF++   +P G+   
Sbjct: 63  VSVIDLTECNLMDGTAKTVIDVGGDPHEMHFRDIPVVGNAQLGNGGFWNDMEYPIGSGDG 122

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            +  P   S     YA+       K    SM+P  ++G+ +I+        GD +L+   
Sbjct: 123 FIRWP---SYDPDAYAL-------KCVGDSMMPRIKEGEFVIIEPGHNYIPGDEVLVVTD 172

Query: 177 TGDIVAKVLISRRGRSIDLMSLN 199
             +++ K  +  R   I L+ +N
Sbjct: 173 KDEVMVKTFLFERDGYIHLLPVN 195


>gi|65317308|ref|ZP_00390267.1| COG1158: Transcription termination factor [Bacillus anthracis
          str. A2012]
          Length = 167

 Score = 34.7 bits (78), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9  IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
          + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 5  LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 48


>gi|168702920|ref|ZP_02735197.1| hypothetical protein GobsU_25546 [Gemmata obscuriglobus UQM 2246]
          Length = 248

 Score = 34.7 bits (78), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 10/95 (10%)

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK-----KEKEIPLLYFPPSGSGGFF 104
           N+  STE   + LAA  + +   L LPF     T +     + +++P+L F     GGF 
Sbjct: 128 NKQESTE---RWLAA--QRLPDRLPLPFDYDLLTYRGHETVQGRDVPVLVFRSRTDGGFA 182

Query: 105 DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
              VFP  + +N   VPE+ S H     +  Q +R
Sbjct: 183 VVYVFPHDSGFNLKNVPEVSSSHARAQVLVKQGSR 217


>gi|300764949|ref|ZP_07074937.1| hypothetical protein LMHG_11601 [Listeria monocytogenes FSL N1-017]
 gi|300514249|gb|EFK41308.1| hypothetical protein LMHG_11601 [Listeria monocytogenes FSL N1-017]
          Length = 238

 Score = 34.7 bits (78), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 9   IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50
           + ++I R+A  +NL   PSG     G+DP +F++ KRF    RN
Sbjct: 77  LMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARN 120


Searching..................................................done


Results from round 2




>gi|75674664|ref|YP_317085.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
 gi|74419534|gb|ABA03733.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
          Length = 210

 Score =  339 bits (871), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 101/223 (45%), Positives = 140/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT   I   +         TE+  K +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATGTAIDTFVQFIED----TERAAKAVPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PCVNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  R+I+L SLN  +   T+  S++EWIARI+WASQ
Sbjct: 168 MVKELKRRTARTIELQSLNPSHANRTLPASEVEWIARIVWASQ 210


>gi|239834343|ref|ZP_04682671.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
 gi|239822406|gb|EEQ93975.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
          Length = 227

 Score =  339 bits (871), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 104/228 (45%), Positives = 144/228 (63%), Gaps = 14/228 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K
Sbjct: 9   MTMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAK 68

Query: 61  ILAATNETICQLLDLPFSDGRTTE-----KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           ++ AT  T  +   L   + RT +     +  + IPLL    +G+GG+FD   FP G  W
Sbjct: 69  VMEATGSTFDEFTRLIGGETRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGW 128

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P   S   G+YA++           SMLPLYR GD LI+     +  GDR++++ 
Sbjct: 129 DIVEFPA--STGEGVYALE-------VSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRT 179

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + G+++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 180 KDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESRDIEWVARILWASQ 227


>gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040121|gb|ACT56917.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 223

 Score =  339 bits (869), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 223/223 (100%), Positives = 223/223 (100%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK
Sbjct: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV
Sbjct: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI
Sbjct: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ
Sbjct: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223


>gi|153011349|ref|YP_001372563.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
 gi|151563237|gb|ABS16734.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
          Length = 217

 Score =  337 bits (864), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 101/226 (44%), Positives = 140/226 (61%), Gaps = 14/226 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTE-----KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
            AT  T  +   L     RT +     +  + IPLL    +G+GG+FD   FP G  W+ 
Sbjct: 61  EATGSTFDEFTRLIRGGNRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGWDI 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           V  P       G+YA++           SMLPLYR GD LI+     +  GDR++++ + 
Sbjct: 121 VEFPA--GSGEGVYALE-------VSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRTKD 171

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 172 GEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWVARILWASQ 217


>gi|85713691|ref|ZP_01044681.1| peptidase S24 [Nitrobacter sp. Nb-311A]
 gi|85699595|gb|EAQ37462.1| peptidase S24 [Nitrobacter sp. Nb-311A]
          Length = 210

 Score =  334 bits (857), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +       R  +     +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIEDSARAAQA----VPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PAVNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  ++I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKTIELQSLNPSHANRTLPASDVEWIARIVWASQ 210


>gi|92116178|ref|YP_575907.1| putative phage repressor [Nitrobacter hamburgensis X14]
 gi|91799072|gb|ABE61447.1| putative phage repressor [Nitrobacter hamburgensis X14]
          Length = 210

 Score =  333 bits (855), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 101/223 (45%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MAMLTHAQIWTALDRLAERSGLSPSGLARKAGLDPTTFNKSKRITGDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +       R T+     +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIEDTARATQA----VPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PSVHDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGTSIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKMIELQSLNPNHVNRTLAASDVEWIARIVWASQ 210


>gi|316932334|ref|YP_004107316.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
 gi|315600048|gb|ADU42583.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 137/223 (61%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L         +  + +PLL    +GSGG+FD G FP G  W  +G+
Sbjct: 61  ALQATNTAIDTFVQLIHDR----PRVVQSVPLLGLAQAGSGGYFDDGGFPVGKGWEEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA+Q           SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSISDEH--AYALQ-------ISGDSMKPAYRHGDIVVVSPSAAVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +P  T+  S++EWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVIELASLNPSHPDRTLAPSEVEWIGRIVWASQ 210


>gi|299134039|ref|ZP_07027232.1| putative phage repressor [Afipia sp. 1NLS2]
 gi|298590786|gb|EFI50988.1| putative phage repressor [Afipia sp. 1NLS2]
          Length = 207

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 97/221 (43%), Positives = 139/221 (62%), Gaps = 14/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTSDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++   +    S  R+ +     +PLL F  +GSGG+FD G FP G  W+ VG+P 
Sbjct: 61  AATGISVDTFVHFIESSSRSVQ-----VPLLGFAEAGSGGYFDDGGFPVGKGWDEVGLPS 115

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   YA++           SM P YR GD+++++ +  +  GDR+++K + G+++ 
Sbjct: 116 VNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPSAPIRRGDRVVVKTKDGEVMV 166

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  + I+L SLN  +   T+  S+IEWIARILWASQ
Sbjct: 167 KELRRRTQKVIELQSLNPAHSDRTLPTSEIEWIARILWASQ 207


>gi|39933872|ref|NP_946148.1| S24 family peptidase [Rhodopseudomonas palustris CGA009]
 gi|192289291|ref|YP_001989896.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|39647719|emb|CAE26239.1| Peptidase family S24 [Rhodopseudomonas palustris CGA009]
 gi|192283040|gb|ACE99420.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  331 bits (849), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 99/223 (44%), Positives = 138/223 (61%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L         +  + +PLL    +GSGG+FD G FP G  W+ VG+
Sbjct: 61  ALQATNTAIDTFVQLIHDR----PRVVQSVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA++           SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSITDEH--AYALE-------ISGDSMKPAYRSGDIVVVSPSATVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  S+IEWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVVELASLNPSHPDRTLAPSEIEWIGRIVWASQ 210


>gi|90422277|ref|YP_530647.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
 gi|90104291|gb|ABD86328.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
          Length = 208

 Score =  331 bits (848), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 95/221 (42%), Positives = 140/221 (63%), Gaps = 13/221 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+AER  L+PSGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAERAGLSPSGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AATN  I   + L         +  + +PLL    +GSGG+FD G FP G  W+ VG+P 
Sbjct: 61  AATNTAIDAFVQLI----GDGPRAVQSVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGLPS 116

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   YA++           SM P YR GD+++++    +  GDR+++K R G+++ 
Sbjct: 117 VNDEH--AYALE-------ISGDSMKPAYRAGDVIVVSPGSPIRRGDRVVVKTRDGEVMV 167

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L+SLN  +P  T+  +++EWIARI+WASQ
Sbjct: 168 KELKRRTAKTLELLSLNPSHPDRTLAPAEVEWIARIVWASQ 208


>gi|13474687|ref|NP_106256.1| repressor protein CI [Mesorhizobium loti MAFF303099]
 gi|14025442|dbj|BAB52042.1| repressor protein CI [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  330 bits (847), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 98/221 (44%), Positives = 139/221 (62%), Gaps = 9/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKII 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ +   L      T     + +PLL F  +G+GGFFD   FP G  W+ V +P 
Sbjct: 61  EATGASLDEFTGLIEGRMSTAPAHRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDLVELPA 120

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K  +G+++A
Sbjct: 121 QSTESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTSGEVMA 171

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           KVL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 172 KVLDRQTVKSIALVSLNPDHPDRDIPMREVEWVARIVWASQ 212


>gi|115522745|ref|YP_779656.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
 gi|115516692|gb|ABJ04676.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
          Length = 208

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 98/221 (44%), Positives = 140/221 (63%), Gaps = 13/221 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AATN  I   + L     R  +     +PLL F  +G+GG+FD G FP G  W+ VG+P+
Sbjct: 61  AATNTAIDSFVRLIGDRARPVQ----SVPLLGFAQAGAGGYFDDGGFPVGKGWDEVGLPQ 116

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   YA++           SM P YR GD+++++    V  GDR+++K   G+++ 
Sbjct: 117 VNDEH--AYALE-------ISGDSMKPAYRAGDVIVVSPGTPVRRGDRVVVKTNNGEVMV 167

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 168 KELKRRTSKTLELASLNPSHPDRTLAPADVEWIARIVWASQ 208


>gi|298290079|ref|YP_003692018.1| phage repressor [Starkeya novella DSM 506]
 gi|296926590|gb|ADH87399.1| putative phage repressor [Starkeya novella DSM 506]
          Length = 206

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 94/221 (42%), Positives = 135/221 (61%), Gaps = 15/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW AID++AERH L+ S LA++AGLDPT+FN+SKR   +GR RWPSTESI KIL
Sbjct: 1   MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPDGRARWPSTESIAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++   + L     R      + IPL+ F  +G GG+FD   FP G  W+ +  P 
Sbjct: 61  AATGASLDDFMALIGGGTR------RAIPLIGFAQAGRGGYFDDAGFPVGGAWDEIEFPN 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   YA++           SMLPLYR GD+++++ A     GDR+++K R G+++A
Sbjct: 115 VGDEH--AYALE-------IAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEVMA 165

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L SLN  +     +  +I WIAR+LWASQ
Sbjct: 166 KELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ 206


>gi|323135593|ref|ZP_08070676.1| putative phage repressor [Methylocystis sp. ATCC 49242]
 gi|322398684|gb|EFY01203.1| putative phage repressor [Methylocystis sp. ATCC 49242]
          Length = 213

 Score =  328 bits (842), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 95/220 (43%), Positives = 134/220 (60%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            SH +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR    GR RWPSTESI K+L 
Sbjct: 5   LSHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRETASGRQRWPSTESIAKVLQ 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT  ++ + + L  ++     K  +  PL+    +G+GGFFD   F  G  W+ + V   
Sbjct: 65  ATGASLDEFMALVSANSSACRKHTR--PLIGLAQAGAGGFFDDAGFAIGAGWDEIDVLAD 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H+  YA++           SM PLYR GD++I++ A  V  GDR+++K   G+I+AK
Sbjct: 123 ADEHS--YALE-------ISGDSMFPLYRDGDVVIVSPAAPVRRGDRVVVKTTDGEIMAK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  +  R+++L S+N  YP   +   ++ WIARILWASQ
Sbjct: 174 ELKRQTARTVELRSINPAYPDRVIPREEVSWIARILWASQ 213


>gi|288957020|ref|YP_003447361.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
 gi|288909328|dbj|BAI70817.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
          Length = 210

 Score =  325 bits (833), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 88/221 (39%), Positives = 137/221 (61%), Gaps = 11/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AIDR+A +H L+ SGLAR+AGLDPT+FNKSKR   +G+ RWPSTESI K+L
Sbjct: 1   MLKHTDIWRAIDRLAAQHGLSASGLARRAGLDPTTFNKSKRTTNDGKLRWPSTESISKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ + + L      T     + +P++ +  +GS G+FD   FP G+ W+ +  P 
Sbjct: 61  DATGASLSEFVSLVGDGAGTGP--LQRVPVIGYAQAGSAGYFDDAGFPAGSGWDELLFPS 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +  PH   YA++           SM P+YR GD +I++ A Q+   DR++++ + G+++A
Sbjct: 119 LGDPH--AYALE-------ISGDSMEPVYRDGDTIIVSPAAQIRRNDRVVVRTKGGEVMA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K LI      I+L+S+N  +P  ++ ++D+ W+ARI+WASQ
Sbjct: 170 KQLIRETATKIELLSINRAHPDRSIPLADVAWMARIIWASQ 210


>gi|260461922|ref|ZP_05810167.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
 gi|259032169|gb|EEW33435.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
          Length = 216

 Score =  322 bits (826), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 97/225 (43%), Positives = 139/225 (61%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKII 60

Query: 63  AATNETICQLLDLPFSDGR----TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ +   L            + + + +PLL F  +G+GGFFD   FP G  W+ V
Sbjct: 61  EATGASLDEFTGLIEGRAGLVHDARDGRRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDLV 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P   +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K   G
Sbjct: 121 ELPAQSTESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAATRKGDRVVVKTTAG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 172 EVMAKVLERQTVKSISLVSLNPDHPDRDISMREVEWVARIVWASQ 216


>gi|319785581|ref|YP_004145057.1| peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171469|gb|ADV15007.1| Peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 216

 Score =  322 bits (826), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 97/225 (43%), Positives = 139/225 (61%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLA++AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLAKRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKIM 60

Query: 63  AATNETICQLLDLPFSDGRTTE----KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ +   L       +      +   +PLL F  +G+GGFFD   FP G  W+ +
Sbjct: 61  EATGASLDEFTGLIEGRAGASHAASVARRSSVPLLGFAQAGAGGFFDDAGFPAGQGWDLI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P   +  +  YA+Q        Q  SMLPLYR GD+LI+        GDR+++K  +G
Sbjct: 121 ELPTQSTESS--YALQ-------VQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTSG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  RSI L+SLN  +P   + M D+EW+ARI+WASQ
Sbjct: 172 EVMAKVLERQTVRSIALVSLNPDHPDRDIPMRDVEWVARIVWASQ 216


>gi|144899439|emb|CAM76303.1| Peptidase S24, S26A and S26B [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 212

 Score =  322 bits (825), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 90/221 (40%), Positives = 130/221 (58%), Gaps = 9/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H  IW A+D +A  + LT S LAR+AGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLTHADIWAALDSLARDNGLTASALARRAGLDPTTFNKSKRITREGKLRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ QLL+           K   IPL+    +G  G+FD   +P G  W+ +  PE
Sbjct: 61  DATGSSLGQLLNYIDDSLPAPVVKGATIPLIGSAQAGDRGYFDDAGYPCGGGWDEIPFPE 120

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  YA++           SM PLYR GDI+I++ A  V  GDR+++K   G+++ 
Sbjct: 121 VGD--SNAYALE-------VSGDSMEPLYRDGDIVIVSPAASVRRGDRVVVKTLEGEVMV 171

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K LI +  + I+L SLN  +P  ++   ++ W+ARILWASQ
Sbjct: 172 KQLIRQTAKRIELASLNPAHPGRSLAAEEVSWLARILWASQ 212


>gi|154250891|ref|YP_001411715.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
 gi|154154841|gb|ABS62058.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
          Length = 214

 Score =  321 bits (822), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 92/221 (41%), Positives = 132/221 (59%), Gaps = 10/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +A RH LT SGLA+ AGLDPT+FNKSKR    GR RWP+TES+ +IL
Sbjct: 4   KLSHNRLWAAIDALAGRHGLTASGLAKAAGLDPTTFNKSKRVTAAGRPRWPNTESLARIL 63

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++   L L  +DG      ++ +PL+    +G GGFFD   FP G+ W  V  P+
Sbjct: 64  DATGSSLEDFLVLV-ADGEVAFTPQRHVPLIGLAQAGRGGFFDDAGFPVGSGWEEVAFPD 122

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
            +  H   YA++           SM P YR GDI++++   ++  GDR+++K    +++A
Sbjct: 123 FKDEH--AYALE-------VSGDSMEPFYRAGDIIVVSPGAEIRRGDRVVVKTAGDEVMA 173

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           KVL  +    IDL SLN  Y   +++  +I W+ARI+WASQ
Sbjct: 174 KVLARKTATRIDLQSLNPAYEDRSLKPEEIVWMARIIWASQ 214


>gi|296446773|ref|ZP_06888712.1| putative phage repressor [Methylosinus trichosporium OB3b]
 gi|296255776|gb|EFH02864.1| putative phage repressor [Methylosinus trichosporium OB3b]
          Length = 213

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 92/220 (41%), Positives = 131/220 (59%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR   +G  RWPSTESI K+L 
Sbjct: 5   LTHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRQTADGHLRWPSTESIAKVLQ 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT   + + + L  S G    +  +  PL+    +G GGFFD   F  G  W  + V   
Sbjct: 65  ATGAGLDEFMTLVSSKGARPSRSAR--PLIGLAQAGVGGFFDDAGFAIGAGWEEIDVLAD 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H+  YA++           SM PLYR GDI+I++ +  V  GDR+++K   G+I+AK
Sbjct: 123 TDEHS--YALE-------ISGDSMAPLYRDGDIVIVSPSAPVRRGDRVVVKTIAGEILAK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  +  ++++L SLN  +P   +   ++ W+ARILWASQ
Sbjct: 174 ELKRQTAKTVELKSLNPAFPDRVLPKEEVSWMARILWASQ 213


>gi|154245416|ref|YP_001416374.1| putative phage repressor [Xanthobacter autotrophicus Py2]
 gi|154159501|gb|ABS66717.1| putative phage repressor [Xanthobacter autotrophicus Py2]
          Length = 225

 Score =  319 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 89/234 (38%), Positives = 134/234 (57%), Gaps = 22/234 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H ++W AID++AE+H L+ SGLAR++GLDPT+FN+SKR   +GR RWPSTESI K L
Sbjct: 1   MLTHGQVWRAIDQLAEQHGLSTSGLARRSGLDPTTFNRSKRITTDGRLRWPSTESIAKAL 60

Query: 63  AATNETICQLLDLPFS-------------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           +AT  +      +                + +        IP + F  +GSGGFFD   F
Sbjct: 61  SATGTSAELFFAMMVPADERHGGAHGFAEESQPLTGPIHAIPQIGFAQAGSGGFFDDAGF 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G  W+ +  PE+   H   YA++           SM P+YR GDI++++    V  GD
Sbjct: 121 PVGTGWDEIAFPEVEDQH--AYALE-------IAGDSMQPVYRNGDIVVVSPGTPVRRGD 171

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R+++K R G+++AK L+ +  R ++L SLN  +    + +  +EW+ARI+WASQ
Sbjct: 172 RVVVKTREGEVLAKELVRKTTRHVELRSLNPAHEDRQIPLDQLEWMARIIWASQ 225


>gi|209883821|ref|YP_002287678.1| peptidase S24 [Oligotropha carboxidovorans OM5]
 gi|209872017|gb|ACI91813.1| peptidase S24 [Oligotropha carboxidovorans OM5]
          Length = 207

 Score =  319 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 97/221 (43%), Positives = 137/221 (61%), Gaps = 14/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MMTHDQIWAALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++        S  RT +     +PLL F  +GSGG+FD G FP G  WN VG+P 
Sbjct: 61  AATGVSVDTFAHFIESSSRTVQ-----VPLLGFAEAGSGGYFDDGGFPVGEGWNEVGLPS 115

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H   YA++           SM P YR GD+++++    +  GDR+++K + G+++ 
Sbjct: 116 VNDEH--AYALE-------ISGDSMKPAYRDGDVIVVSPGAPIRRGDRVVVKTKDGEVMV 166

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  + I+L SLN  +P  T   ++I+WIARI+WASQ
Sbjct: 167 KELRRRTQKVIELQSLNPAHPDRTFPTAEIDWIARIVWASQ 207


>gi|239787365|emb|CAX83841.1| Predicted transcriptional regulator [uncultured bacterium]
          Length = 210

 Score =  319 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 91/221 (41%), Positives = 135/221 (61%), Gaps = 11/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AIDR+A +H LT SGLARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLRHADIWHAIDRLAFKHGLTASGLARKAGLDPTTFNKSKRTSPEGKLRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  +I + + +  +   T     + IPL+    +GS G+FD   +PTG  W+ +  PE
Sbjct: 61  TATGASIAEFVTMIDNPDETGA--VQRIPLIGLAQAGSDGYFDDAGYPTGAGWDEIPFPE 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +    +  YA++           SM PLYR+GDI+I++ A Q+   DR+++K   G+++ 
Sbjct: 119 MGD--SKAYALE-------ITGDSMEPLYREGDIVIVSPAAQIRRADRVIVKTNDGEVMV 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L+ R  + +DL SLN  +P  ++ + ++  I R++WASQ
Sbjct: 170 KQLLRRTAKFVDLQSLNDQHPNRSLPIEEVALIHRVVWASQ 210


>gi|315122107|ref|YP_004062596.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495509|gb|ADR52108.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 216

 Score =  319 bits (819), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 182/223 (81%), Positives = 195/223 (87%), Gaps = 7/223 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+KIWEAID+MA+RHNLTPSGLARKAGLDPTSFNKSKRFG+EGRNRWPSTESI K
Sbjct: 1   MTKFSHEKIWEAIDQMAKRHNLTPSGLARKAGLDPTSFNKSKRFGVEGRNRWPSTESISK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL ATNETICQ   + F + +  EKKEKEIPLL FPPS S GFFDSG FP GNKWNTVGV
Sbjct: 61  ILEATNETICQFFGILFLEEKNIEKKEKEIPLLDFPPSESSGFFDSGGFPAGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYAIQ        QDTSMLPLYRKGDILILN+AIQVNCGDR+LIKP  GDI
Sbjct: 121 PEIRSPHNGIYAIQ-------IQDTSMLPLYRKGDILILNAAIQVNCGDRVLIKPHEGDI 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            AKVLIS+RGRSIDLMSLNCCYPVDT++ SDIEWIA+ILWASQ
Sbjct: 174 EAKVLISQRGRSIDLMSLNCCYPVDTIDASDIEWIAKILWASQ 216


>gi|227820746|ref|YP_002824716.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
 gi|227339745|gb|ACP23963.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
          Length = 217

 Score =  318 bits (814), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 143/224 (63%), Gaps = 10/224 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI K+L
Sbjct: 1   MLSHDSIWRAIDALAERHQLSPSGLARRAGLDPTSFNKSKRQSPDGRDRWPSTESISKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEK---KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            AT  TI Q + L  S    + +       IPL+ F  +G+GGFFD G FP G  W+ V 
Sbjct: 61  EATGATIDQFMALLQSGSGPSSRTGLPAAGIPLIGFAQAGAGGFFDDGGFPVGQGWDEVD 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P        +YA++        Q  SMLPLYR GD+LI++    V  GDR+++K   G+
Sbjct: 121 FPVAAQSKASVYALE-------VQGDSMLPLYRDGDVLIVDPGASVRRGDRVVLKSCEGE 173

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK+L  +  R ++L+SLN  +P  + EM D+EWIARI+WASQ
Sbjct: 174 VMAKILARQTSRGVELLSLNPDHPNRSFEMKDVEWIARIVWASQ 217


>gi|15887830|ref|NP_353511.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
 gi|15155410|gb|AAK86296.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
          Length = 216

 Score =  318 bits (814), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 111/223 (49%), Positives = 146/223 (65%), Gaps = 9/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AID +AERH LTPS LA++AGLDPTSFNKSKRFG +GR RWPSTES+ K+L
Sbjct: 1   MLSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGPDGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK--EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  ++ Q     F   +T +       IPLL F  +GSGGFFD G FP G  W+ V  
Sbjct: 61  EATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+YA++        Q  SM+PLYR GDILI+     V  GDR+++K R G++
Sbjct: 121 PSSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAPVRRGDRVVLKSRDGEV 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 174 MAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|158422012|ref|YP_001523304.1| S24 family peptidase [Azorhizobium caulinodans ORS 571]
 gi|158328901|dbj|BAF86386.1| peptidase family S24 protein [Azorhizobium caulinodans ORS 571]
          Length = 222

 Score =  317 bits (813), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 96/231 (41%), Positives = 141/231 (61%), Gaps = 19/231 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW AIDR+AE + L+ SGLA++AGLD T+FN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLTHGQIWTAIDRLAEANGLSASGLAKRAGLDSTAFNRSKRITSDGRPRWPSTESVSKIL 60

Query: 63  AATNETICQLLDLPFSD----------GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
           +ATN ++   L L   +               + ++ IP +    +G GGFFD   FP G
Sbjct: 61  SATNTSMRAFLALLEGEDIGPSGFSEEPAPPFRPQRAIPHIGLAQAGDGGFFDDAGFPVG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           + W+ +  PE+   H   YA++           SMLPLYR GD+++++ A  V  GDR++
Sbjct: 121 SGWDEILFPEVEDEH--AYALE-------ISGDSMLPLYRPGDLVVVSPAASVRKGDRVV 171

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +K R G+++AK L+ R  R+++L SLN  Y   T+  +D+ WIARI+WASQ
Sbjct: 172 VKTRDGEVLAKELVRRTARTVELRSLNPEYEGRTLAATDVLWIARIIWASQ 222


>gi|222147460|ref|YP_002548417.1| bacteriophage repressor protein [Agrobacterium vitis S4]
 gi|221734450|gb|ACM35413.1| bacteriophage repressor protein [Agrobacterium vitis S4]
          Length = 224

 Score =  316 bits (809), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 112/233 (48%), Positives = 145/233 (62%), Gaps = 21/233 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AIDR+AE+++LTPSGLARKAGLDPTSFNKSKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHETIWNAIDRLAEQYHLTPSGLARKAGLDPTSFNKSKRVGPDGRMRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTT------------EKKEKEIPLLYFPPSGSGGFFDSGVFP 110
            AT   I Q + L  +D                  +   IPLL    +GSGGFFD G FP
Sbjct: 61  EATGARIDQFVTLISNDNHQVNAVHETLPDGNFPPQIGTIPLLGLAQAGSGGFFDDGGFP 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G  W+ V +P    P  G+YA++        Q  SM PLYR GDILI+     V  GDR
Sbjct: 121 AGQGWDLVDLPTSAKP--GVYALE-------IQGDSMKPLYRDGDILIVEPGAPVRRGDR 171

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++K   G+++AKVL  +  R++DL+S+N  +P   ++M D+EWIARI+W SQ
Sbjct: 172 VVVKTCDGEVMAKVLGRQTARTVDLISINPDHPNRVLDMQDVEWIARIIWVSQ 224


>gi|325291874|ref|YP_004277738.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
 gi|325059727|gb|ADY63418.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
          Length = 216

 Score =  315 bits (807), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 110/223 (49%), Positives = 146/223 (65%), Gaps = 9/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AID +A+RH LTPS LA++AGLD TSFNKSKRFG +GR RWPSTES+ K+L
Sbjct: 1   MLSHETIWSAIDTLAKRHQLTPSALAKRAGLDSTSFNKSKRFGPDGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK--EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  ++ Q     F   +T +       IPLL F  +GSGGFFD G FP G  W+ V  
Sbjct: 61  EATGASVDQFFGYAFGRTQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+YA++        Q  SM+PLYR GDILI+    QV  GDR+++K R G++
Sbjct: 121 PSSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAQVRRGDRVVLKSRDGEV 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 174 MAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|15964281|ref|NP_384634.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307307018|ref|ZP_07586757.1| putative phage repressor [Sinorhizobium meliloti BL225C]
 gi|307320672|ref|ZP_07600085.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|15073458|emb|CAC45100.1| Transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306893707|gb|EFN24480.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306901958|gb|EFN32557.1| putative phage repressor [Sinorhizobium meliloti BL225C]
          Length = 218

 Score =  314 bits (806), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 113/225 (50%), Positives = 149/225 (66%), Gaps = 11/225 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL
Sbjct: 1   MLSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRQSTDGRDRWPSTESIAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKE----IPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ Q L L   +   +E+++      IPL+ F  +G+GGFFD G FP G  W+T+
Sbjct: 61  HATGASVDQFLALMEPNAAGSEREDASAAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDTI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P       G YA++        Q  SMLPLYR GD+LI++ + QV   DR+++K R G
Sbjct: 121 EFPTPERRQGGTYALE-------VQGDSMLPLYRDGDVLIVDPSAQVRRNDRVVVKTRGG 173

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  R I+L+SLN  +P    EM+D+EWIARI+WASQ
Sbjct: 174 EVMAKVLARQTPRGIELVSLNPDHPNRNFEMNDVEWIARIIWASQ 218


>gi|222084796|ref|YP_002543325.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722244|gb|ACM25400.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 221

 Score =  314 bits (806), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 111/228 (48%), Positives = 149/228 (65%), Gaps = 14/228 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AID++AER+ LTPSGLAR+AGLDPTSFNKSKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWSAIDKLAERYALTPSGLARRAGLDPTSFNKSKRLGQDGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGR-------TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
            AT  ++ Q L +     R        +      IPLL F  +GSGGFFD G FP G  W
Sbjct: 61  GATGASMEQFLGILRPVERGDGNADHASSPPASSIPLLGFAQAGSGGFFDDGGFPAGQGW 120

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++        Q  SMLPLYR GD+LI+    Q+   DR+++K 
Sbjct: 121 DMVEFPAAPGQKGGVYALE-------VQGESMLPLYRDGDVLIVEPGAQIRRSDRVVVKT 173

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AKVL+ +  +SI+L+SLN  +P  + +++D+EWIARI+WASQ
Sbjct: 174 REGEVMAKVLLRQSAKSIELLSLNPEHPNRSFDLADVEWIARIIWASQ 221


>gi|83859576|ref|ZP_00953096.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
 gi|83851935|gb|EAP89789.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
          Length = 210

 Score =  314 bits (805), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 89/224 (39%), Positives = 124/224 (55%), Gaps = 15/224 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIF 59
           M   +H +IW  IDR+A R  LTPSGLAR+AGLDPT+FN SKR   +G + RWPSTES+ 
Sbjct: 1   MPMLTHAQIWSGIDRLAHRAGLTPSGLARRAGLDPTTFNPSKRTSADGAKPRWPSTESLA 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K L AT  +      L            + +PLL F  +G  G+FD   FPTG  W  + 
Sbjct: 61  KALEATRVSFDDFAALAMGHTA-----GRSVPLLGFAQAGDHGYFDDAGFPTGEGWEDIR 115

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P       G YA++           SM P+YR GD ++++       GDR+++K R+G+
Sbjct: 116 FP--GDEGEGAYALE-------ISGESMSPVYRHGDRIVVSPDAPPRRGDRVVVKTRSGE 166

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK L      S++L+SLN  Y    +   D+ W+ARI+WASQ
Sbjct: 167 VMAKELGRVTAESVELISLNPSYDNRILSTRDLVWMARIVWASQ 210


>gi|188581313|ref|YP_001924758.1| phage repressor [Methylobacterium populi BJ001]
 gi|179344811|gb|ACB80223.1| putative phage repressor [Methylobacterium populi BJ001]
          Length = 210

 Score =  311 bits (796), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 92/222 (41%), Positives = 132/222 (59%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           +AT  ++   L L  S   +       +PL+    +GSG  F     PTG   W+ +  P
Sbjct: 61  SATGASLDDFLHLVDSGQASART---MVPLIGLTQAGSGRLFTEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++   H   +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G++V
Sbjct: 118 DLGGDH--AFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVV 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|218530341|ref|YP_002421157.1| phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240138699|ref|YP_002963171.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
 gi|218522644|gb|ACK83229.1| putative phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240008668|gb|ACS39894.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
          Length = 210

 Score =  310 bits (795), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 92/222 (41%), Positives = 132/222 (59%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQGPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++       +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGGDR--AFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|163851531|ref|YP_001639574.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163663136|gb|ABY30503.1| peptidase S24 and S26 domain protein [Methylobacterium extorquens
           PA1]
          Length = 210

 Score =  310 bits (794), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 93/222 (41%), Positives = 132/222 (59%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQGPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++       +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGGDR--AFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++D+ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLADVAWMARVMWVRQ 210


>gi|254561298|ref|YP_003068393.1| LexA/Signal peptidase [Methylobacterium extorquens DM4]
 gi|254268576|emb|CAX24533.1| putative LexA/Signal peptidase [Methylobacterium extorquens DM4]
          Length = 210

 Score =  310 bits (794), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 92/222 (41%), Positives = 132/222 (59%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQAPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++       +A++        Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGGDR--AFALE-------VQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|170746983|ref|YP_001753243.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
 gi|170653505|gb|ACB22560.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
          Length = 210

 Score =  309 bits (791), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 86/222 (38%), Positives = 131/222 (59%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTES+ K+L
Sbjct: 1   MLSHEQIWNAIDRLAERHGYSASGLARRAGLDATSFNRSKRVGADGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++ + L L  +           +PL+    +G+G  F     PTG   W  +  P
Sbjct: 61  AATGSSLDEFLRLIEAREIPART---MVPLIGLTQAGAGRLFTDEGMPTGGAGWEEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++       +A++        Q  SMLPL+R GD+LI++    V  GDR++++   G+++
Sbjct: 118 DLG--EERAFALE-------IQGDSMLPLFRDGDVLIVSPTASVRKGDRVVVRLHGGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+++L SLN  +    + + ++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTVELASLNPEHEDRVLNLGEVAWMARVMWVRQ 210


>gi|86751722|ref|YP_488218.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
 gi|86574750|gb|ABD09307.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 98/223 (43%), Positives = 139/223 (62%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L         +  + +PLL    +G+GGFFD G FP G  W+ +G+
Sbjct: 61  ALAATNTAIDTFVQLITDR----PRVVQSVPLLGLAQAGAGGFFDDGGFPAGKGWDEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H   YA++           SM P YR GDI++++    +  GDR+++K  +G++
Sbjct: 117 PSINDEH--AYALE-------ISGESMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTSGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHPDRTLAPADVEWIARIVWASQ 210


>gi|23015760|ref|ZP_00055528.1| COG2932: Predicted transcriptional regulator [Magnetospirillum
           magnetotacticum MS-1]
          Length = 211

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 91/221 (41%), Positives = 129/221 (58%), Gaps = 10/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRVTREGKPRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  T+   +     D     +    IPL+ F  +G  G+FD   +P G  W+ +  PE
Sbjct: 61  EATGATMTAFVGYIE-DTAQARQTANTIPLIGFAQAGDCGYFDDAGYPVGGSWDEIPFPE 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           I  PH   YA++           SM PLYR GD++I++ A  V  GDR++++   G+++ 
Sbjct: 120 IGDPH--AYALE-------VSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEVMV 170

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L+ +  + I+L S+N  +P  ++   ++ WIARILW+SQ
Sbjct: 171 KQLVRQTAKRIELASINPAHPGRSLATEEVAWIARILWSSQ 211


>gi|225629264|ref|ZP_03787297.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237816924|ref|ZP_04595916.1| Repressor protein C [Brucella abortus str. 2308 A]
 gi|225615760|gb|EEH12809.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237787737|gb|EEP61953.1| Repressor protein C [Brucella abortus str. 2308 A]
          Length = 234

 Score =  303 bits (776), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 136/228 (59%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 16  TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 75

Query: 62  LAATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  +   L                    IPLL    +G+GG+FD   FP G  W
Sbjct: 76  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 135

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 136 DIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 186

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 187 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 234


>gi|265999054|ref|ZP_05464836.2| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
 gi|263092030|gb|EEZ16327.1| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
          Length = 223

 Score =  303 bits (776), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 137/228 (60%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  + + L                    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|189022624|ref|YP_001932365.1| Peptidase family S24 [Brucella abortus S19]
 gi|260544608|ref|ZP_05820429.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261756989|ref|ZP_06000698.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306839063|ref|ZP_07471883.1| Peptidase family S24 [Brucella sp. NF 2653]
 gi|306841676|ref|ZP_07474363.1| Peptidase family S24 [Brucella sp. BO2]
 gi|189021198|gb|ACD73919.1| Peptidase family S24 [Brucella abortus S19]
 gi|260097879|gb|EEW81753.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261736973|gb|EEY24969.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306288206|gb|EFM59590.1| Peptidase family S24 [Brucella sp. BO2]
 gi|306405886|gb|EFM62145.1| Peptidase family S24 [Brucella sp. NF 2653]
          Length = 223

 Score =  303 bits (775), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 136/228 (59%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  +   L                    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|254712567|ref|ZP_05174378.1| Peptidase family S24 [Brucella ceti M644/93/1]
 gi|254715639|ref|ZP_05177450.1| Peptidase family S24 [Brucella ceti M13/05/1]
 gi|261217388|ref|ZP_05931669.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320261|ref|ZP_05959458.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922477|gb|EEX89045.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292951|gb|EEX96447.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 218

 Score =  303 bits (775), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 103/227 (45%), Positives = 136/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +   L                    IPLL    +G+GG+FD   FPTG  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPTGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|225686559|ref|YP_002734531.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|256111295|ref|ZP_05452321.1| DNA-binding protein RDGA [Brucella melitensis bv. 3 str. Ether]
 gi|265992801|ref|ZP_06105358.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225642664|gb|ACO02577.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|262763671|gb|EEZ09703.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|326410945|gb|ADZ68009.1| Repressor protein C [Brucella melitensis M28]
 gi|326554236|gb|ADZ88875.1| Repressor protein C [Brucella melitensis M5-90]
          Length = 218

 Score =  303 bits (775), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 102/227 (44%), Positives = 136/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  + + L                    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|260564858|ref|ZP_05835343.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
 gi|260152501|gb|EEW87594.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
          Length = 223

 Score =  303 bits (775), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 137/228 (60%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  + + L                    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAKAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|23500526|ref|NP_699966.1| S24 family peptidase [Brucella suis 1330]
 gi|62317372|ref|YP_223225.1| S24 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|83269348|ref|YP_418639.1| S24 family peptidase [Brucella melitensis biovar Abortus 2308]
 gi|148558376|ref|YP_001257738.1| S24 family peptidase [Brucella ovis ATCC 25840]
 gi|161620851|ref|YP_001594737.1| repressor protein C [Brucella canis ATCC 23365]
 gi|163844918|ref|YP_001622573.1| hypothetical protein BSUIS_B0784 [Brucella suis ATCC 23445]
 gi|254695818|ref|ZP_05157646.1| Peptidase family S24 [Brucella abortus bv. 3 str. Tulya]
 gi|254698652|ref|ZP_05160480.1| Peptidase family S24 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700006|ref|ZP_05161834.1| Peptidase family S24 [Brucella suis bv. 5 str. 513]
 gi|254703127|ref|ZP_05164955.1| Peptidase family S24 [Brucella suis bv. 3 str. 686]
 gi|254705728|ref|ZP_05167556.1| Peptidase family S24 [Brucella pinnipedialis M163/99/10]
 gi|254720098|ref|ZP_05181909.1| Peptidase family S24 [Brucella sp. 83/13]
 gi|254732099|ref|ZP_05190677.1| Peptidase family S24 [Brucella abortus bv. 4 str. 292]
 gi|256015557|ref|YP_003105566.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|256157535|ref|ZP_05455453.1| Peptidase family S24 [Brucella ceti M490/95/1]
 gi|256253490|ref|ZP_05459026.1| Peptidase family S24 [Brucella ceti B1/94]
 gi|256256056|ref|ZP_05461592.1| Peptidase family S24 [Brucella abortus bv. 9 str. C68]
 gi|260167569|ref|ZP_05754380.1| Peptidase family S24 [Brucella sp. F5/99]
 gi|260759885|ref|ZP_05872233.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763123|ref|ZP_05875455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882275|ref|ZP_05893889.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216238|ref|ZP_05930519.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261220617|ref|ZP_05934898.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313149|ref|ZP_05952346.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261750489|ref|ZP_05994198.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753747|ref|ZP_05997456.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265985104|ref|ZP_06097839.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265996036|ref|ZP_06108593.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297249410|ref|ZP_06933111.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306846010|ref|ZP_07478577.1| Peptidase family S24 [Brucella sp. BO1]
 gi|23464158|gb|AAN33971.1| peptidase, S24 family [Brucella suis 1330]
 gi|62197565|gb|AAX75864.1| peptidase, S24 family [Brucella abortus bv. 1 str. 9-941]
 gi|82939622|emb|CAJ12611.1| Peptidase family S24:Peptidase S24, C-terminal [Brucella melitensis
           biovar Abortus 2308]
 gi|148369661|gb|ABQ62533.1| peptidase, S24 family [Brucella ovis ATCC 25840]
 gi|161337662|gb|ABX63966.1| Repressor protein C [Brucella canis ATCC 23365]
 gi|163675641|gb|ABY39751.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|255998217|gb|ACU49904.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|260670203|gb|EEX57143.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673544|gb|EEX60365.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260871803|gb|EEX78872.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917845|gb|EEX84706.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919201|gb|EEX85854.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261302175|gb|EEY05672.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740242|gb|EEY28168.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743500|gb|EEY31426.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550333|gb|EEZ06494.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264663696|gb|EEZ33957.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|297173279|gb|EFH32643.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306273645|gb|EFM55490.1| Peptidase family S24 [Brucella sp. BO1]
          Length = 218

 Score =  302 bits (774), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 102/227 (44%), Positives = 135/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +   L                    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|17988843|ref|NP_541476.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. 16M]
 gi|256043668|ref|ZP_05446593.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265990088|ref|ZP_06102645.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984666|gb|AAL53740.1| DNA-binding protein rdga [Brucella melitensis bv. 1 str. 16M]
 gi|263000757|gb|EEZ13447.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 218

 Score =  302 bits (774), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 102/227 (44%), Positives = 136/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  + + L                    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAKAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|110632380|ref|YP_672588.1| putative phage repressor [Mesorhizobium sp. BNC1]
 gi|110283364|gb|ABG61423.1| putative phage repressor [Chelativorans sp. BNC1]
          Length = 214

 Score =  302 bits (773), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 94/223 (42%), Positives = 138/223 (61%), Gaps = 11/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+K+W AID +A RH+L+ SGLARKAGLD T+FN+SKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHEKVWAAIDALAARHSLSASGLARKAGLDSTAFNRSKRHSPDGRPRWPSTESLAKIM 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEI--PLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  T+ +   L      +  +K   I  PL+ F  +G+GG+F    FP G  W  V +
Sbjct: 61  DATGVTLGEFTALIEEMAESGRRKPGRISVPLIGFAQAGAGGYFTDAGFPVGQGWEQVEL 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P   S     YA++        Q  SMLPLYR GD+L++  +  V  GDR++++   G++
Sbjct: 121 PGQVS--EAAYALE-------VQGDSMLPLYRNGDVLVVEPSAPVRRGDRVVVRTLDGEV 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK+L+ +  R ++L+SLN  +P   +   +++WIARI+WASQ
Sbjct: 172 MAKILLRQTSRQMELLSLNPDHPNRVLGHEEVDWIARIVWASQ 214


>gi|91975266|ref|YP_567925.1| putative phage repressor [Rhodopseudomonas palustris BisB5]
 gi|91681722|gb|ABE38024.1| peptidase S24, S26A and S26B [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  302 bits (773), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 95/223 (42%), Positives = 135/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+ SGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MHMLTHDQIWTALDRLAERAGLSASGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L         +  + +PLL    +G+GGFFD G FP G  W  VG+
Sbjct: 61  ALAATNTAIDTFVQLITDR----PRVVQSVPLLGLAQAGAGGFFDDGGFPAGKGWEEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H   YA++           SM P YR GDI++++    +  GDR+++K   G++
Sbjct: 117 PSVNDEH--AYALE-------ISGDSMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTGGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +   T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHADRTLAPADVEWIARIVWASQ 210


>gi|83313328|ref|YP_423592.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82948169|dbj|BAE53033.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 223

 Score =  301 bits (772), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 90/223 (40%), Positives = 130/223 (58%), Gaps = 10/223 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           +    H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K
Sbjct: 11  LPMLKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRITREGKPRWPSTESVAK 70

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT  ++   +     D      +   IPL+ F  +G  G+FD   +P G  W+ +  
Sbjct: 71  VLEATGASMTAFVAYIE-DLAQPHNQASTIPLVGFAQAGDRGYFDDAGYPVGGSWDEIPF 129

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEI  PH   YA++           SM PLYR GD++I++ A  V  GDR++++   G++
Sbjct: 130 PEIGDPH--AYALE-------VSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEV 180

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L+ +  R I+L S+N  +P  ++   ++ W+ARILW+SQ
Sbjct: 181 MVKQLLRQTARRIELGSINPAHPGRSLATEEVAWMARILWSSQ 223


>gi|256059031|ref|ZP_05449240.1| Peptidase family S24 [Brucella neotomae 5K33]
 gi|261322976|ref|ZP_05962173.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261298956|gb|EEY02453.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 218

 Score =  301 bits (772), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 101/227 (44%), Positives = 135/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AER++L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERYSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +   L                    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|254690871|ref|ZP_05154125.1| Peptidase family S24 [Brucella abortus bv. 6 str. 870]
 gi|260756453|ref|ZP_05868801.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260676561|gb|EEX63382.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 218

 Score =  299 bits (767), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 101/227 (44%), Positives = 135/227 (59%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +   L                    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SL+  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLDPEHPNRIFESKDIEWIARILWASQ 218


>gi|328544878|ref|YP_004304987.1| peptidase S24-like domain protein [polymorphum gilvum SL003B-26A1]
 gi|326414620|gb|ADZ71683.1| Peptidase S24-like domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 215

 Score =  298 bits (762), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 85/224 (37%), Positives = 128/224 (57%), Gaps = 12/224 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+++W AID +A R  L+PSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+L
Sbjct: 1   MLSHERVWAAIDALATRKGLSPSGLARRAGLDPTTFNPSKRIAGDGRPRWPSTESLAKVL 60

Query: 63  AATNETICQLLDLPFS---DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            AT   + + + L      D          +P          G+FD    P G  W+ + 
Sbjct: 61  EATGAPLAEFVALAAPLETDSAPPATSPMTVPFAGLDRVACEGYFDPTGNPIGRNWDEIP 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P++R     +YA++           ++LP+YR GDIL++   + V  GDR+++K ++G+
Sbjct: 121 FPDLRG--EILYALE-------VSGNALLPVYRDGDILVVAPDVPVRRGDRVIVKVKSGE 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++ ++L  R  R+++L SL     V   E+  IEWIARI+WASQ
Sbjct: 172 VIIRLLHRRTARTVELHSLAPSGTVHQCELDSIEWIARIVWASQ 215


>gi|114799918|ref|YP_759340.1| S24 family peptidase [Hyphomonas neptunium ATCC 15444]
 gi|114740092|gb|ABI78217.1| peptidase, S24 family [Hyphomonas neptunium ATCC 15444]
          Length = 205

 Score =  297 bits (761), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 88/220 (40%), Positives = 119/220 (54%), Gaps = 15/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             HK IW  +D +A  H LT S LA++AGLDPTSFN SKR   +GR RWPSTES+ ++L 
Sbjct: 1   MQHKDIWRGLDLLAAHHGLTASALAKRAGLDPTSFNPSKREAADGRPRWPSTESLARVLD 60

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A          L         ++    PL+ F  +G  GFFD   FP G  W  V  P +
Sbjct: 61  AVGAGFDDFAALVEG------RRGGSAPLIGFAQAGQDGFFDDAGFPVGAGWEEVRFPGL 114

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +    +YA++           SM P YR GD +I+    +V  GDR++ K   G+++AK
Sbjct: 115 GA--ETVYALE-------ISGDSMEPAYRAGDRIIVAPGAEVKPGDRVVAKTVAGEVMAK 165

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VL  +  R I+L SLN  YP    + S++ W+ARILWASQ
Sbjct: 166 VLARKNTRLIELASLNPAYPAREFKPSEVAWLARILWASQ 205


>gi|315499624|ref|YP_004088427.1| phage repressor [Asticcacaulis excentricus CB 48]
 gi|315417636|gb|ADU14276.1| putative phage repressor [Asticcacaulis excentricus CB 48]
          Length = 209

 Score =  296 bits (758), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 92/224 (41%), Positives = 129/224 (57%), Gaps = 19/224 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE--GRNRWPSTESIFK 60
           S SH +IW AIDR+A     +PSGLAR AGLDPT+FNKSKR   E   R RWPSTES+ K
Sbjct: 2   SLSHAQIWNAIDRLARNLGTSPSGLARLAGLDPTAFNKSKRQSTEDPPRPRWPSTESLAK 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT ++      L            K +PL+ F  +G+ G FD   FP G  W+ +G+
Sbjct: 62  VLDATGQSFPDFAALTEP-----RPVPKGVPLIGFAQAGNDGLFDDAGFPVGQGWDEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGD 179
           P       G+YA++           SMLPLYR GD +I++   Q +  GDR+++K   G+
Sbjct: 117 PA----GEGLYALE-------ISGDSMLPLYRDGDRIIVDPLRQNLRRGDRVVVKTSEGE 165

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK L+    + ++L SLN  +    +E S + W+ARI+WASQ
Sbjct: 166 VMAKELVRLTEKQVELRSLNPDFSNRVLERSQVTWLARIVWASQ 209


>gi|209966574|ref|YP_002299489.1| peptidase family S24, putative [Rhodospirillum centenum SW]
 gi|209960040|gb|ACJ00677.1| peptidase family S24, putative [Rhodospirillum centenum SW]
          Length = 214

 Score =  296 bits (758), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 91/223 (40%), Positives = 136/223 (60%), Gaps = 11/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H +IW AIDR+A RH L+ SGLA++ GLDPT+FN+SKR   +G+ RWPSTES+ K+L
Sbjct: 1   MIKHAEIWRAIDRLAARHGLSASGLAKRGGLDPTTFNRSKRVTHDGKLRWPSTESLAKVL 60

Query: 63  AATNETICQLLDLPF--SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            ATN T   L+ L      G+      + +P++ +  +GS GFFD   +P GN W+ +  
Sbjct: 61  EATNSTFADLVALAGDGPVGQAAPVHVQRVPVIGYAQAGSDGFFDDAGYPVGNGWDELEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +  P+   YA++           SM PLYR GD++I++    V  GDR++++ R G++
Sbjct: 121 PHLGDPN--AYALE-------ISGDSMEPLYRDGDVIIVSPGASVRRGDRVVVRTREGEV 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK L       ++L SLN  +P  T+ M+++ W+ARILWASQ
Sbjct: 172 MAKQLARLTANRLELQSLNKAHPDRTLAMTEVAWMARILWASQ 214


>gi|116250339|ref|YP_766177.1| phage-related transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254987|emb|CAK06061.1| putative phage-related transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 225

 Score =  295 bits (755), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 114/232 (49%), Positives = 153/232 (65%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK-----------EIPLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q L     D   +E++ +            IPLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASMEQFLAFMRPDAGPSEQQARQQENAFQPQGGSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|241202972|ref|YP_002974068.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856862|gb|ACS54529.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 225

 Score =  292 bits (748), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 112/232 (48%), Positives = 149/232 (64%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTT-----------EKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q +     D   +             +   IPLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P   S   G+YA++        Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPAAPSQKAGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|218671565|ref|ZP_03521235.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli GR56]
          Length = 223

 Score =  291 bits (744), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 116/230 (50%), Positives = 151/230 (65%), Gaps = 16/230 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDG---------RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            AT  ++ Q L                R        IPLL F  +G+GGFFD G FP G 
Sbjct: 61  DATGASMEQFLAFMRPGANSSAELPGERAKPPHGGAIPLLGFAQAGAGGFFDDGGFPAGQ 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+++
Sbjct: 121 GWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVV 173

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 RTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 223


>gi|209547798|ref|YP_002279715.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533554|gb|ACI53489.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 225

 Score =  291 bits (744), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 112/232 (48%), Positives = 148/232 (63%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IW AIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHDQIWGAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTT-----------EKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q L     D   +             +   IPLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASVEQFLAFLQPDAGFSKRPAGQSDGAFPPQGSSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P   +  + +YA++        Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPAAPAQKSAVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+LMSLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTCEGEVMAKVLLRQSPRSIELMSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|86356189|ref|YP_468081.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280291|gb|ABC89354.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 223

 Score =  290 bits (743), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 115/230 (50%), Positives = 151/230 (65%), Gaps = 16/230 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SHK+IWEAIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHKQIWEAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFS---------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            AT  ++ Q L                R        IPLL F  +G+GGFFD G FP G+
Sbjct: 61  DATGASMEQFLAFMQPASSSSGERIGERAGPSPGGAIPLLGFAQAGAGGFFDDGGFPAGH 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+++
Sbjct: 121 GWDVVEFPPKPSQRSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVV 173

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +  TG+++AKVL+ +  RSI+LMSLN  +P  T++++D++WIARI+WASQ
Sbjct: 174 RTCTGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLADVDWIARIIWASQ 223


>gi|167644106|ref|YP_001681769.1| putative phage repressor [Caulobacter sp. K31]
 gi|167346536|gb|ABZ69271.1| putative phage repressor [Caulobacter sp. K31]
          Length = 219

 Score =  290 bits (743), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 79/227 (34%), Positives = 127/227 (55%), Gaps = 16/227 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  SH +IW AID +A+R +++PS +A+ AGLDPTSFN+SKR   + R RWPSTES+ K
Sbjct: 5   MSPLSHTEIWTAIDALAKRFDMSPSAMAKMAGLDPTSFNRSKRGDGDARPRWPSTESLAK 64

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT     +   L     R      + +PL+ F  +G+ G FD    P G  W+ +  
Sbjct: 65  VLEATGVGFSEFAAL---TERVRPLNPRVVPLIGFAQAGAEGVFDETGAPIGAGWDEIDF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +     G+YA++           ++ P++R GD ++++ +     GDR++++   G++
Sbjct: 122 PGLGD--EGVYALE-------ITGDALAPVFRDGDRILVSPSAPPRRGDRVVVRTAGGEL 172

Query: 181 VAKVLISRRGRSIDLMSLN----CCYPVDTVEMSDIEWIARILWASQ 223
           + K L     RS++L  LN          T+++ ++ WIARILWASQ
Sbjct: 173 LVKELARVTARSVELAPLNRLDGRDGGDRTLDLGEVVWIARILWASQ 219


>gi|114704909|ref|ZP_01437817.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
 gi|114539694|gb|EAU42814.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
          Length = 216

 Score =  289 bits (740), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 96/225 (42%), Positives = 141/225 (62%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH +IW AID +A+R+ LTPSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ KI 
Sbjct: 1   MFSHDEIWSAIDALAKRNGLTPSGLARKAGLDPTTFNKSKRQSTDGRPRWPSTESLSKIF 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK----EIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            A N +      L   D   ++ K +     +PLL    +G GGFFD   FP G+ W+ +
Sbjct: 61  EAVNSSFGDFAQLVSGDDAESDSKVRSKPVSVPLLGLAEAGGGGFFDDAGFPAGHGWDEI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P+ +     +YA++           SM PLYR+GD ++++    V  GDR+++K R G
Sbjct: 121 TLPDGKD--EPMYALE-------VSGRSMEPLYREGDRIVVSPTASVRRGDRVVVKTREG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK+L  +  R+I+L SLN  +P+    + +I+W+ARI+WA+Q
Sbjct: 172 EVMAKILQRQTARTIELSSLNPDFPLRQFAVEEIDWLARIVWATQ 216


>gi|150395367|ref|YP_001325834.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150026882|gb|ABR58999.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 215

 Score =  288 bits (738), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 112/222 (50%), Positives = 147/222 (66%), Gaps = 8/222 (3%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL
Sbjct: 1   MLSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRRSADGRDRWPSTESISKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK-EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
            AT  T+ Q + L   +   +EK+    IPL+ F  +G+GGFFD G FP G  W+++  P
Sbjct: 61  QATGATVDQFMALMQPNAAGSEKESAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDSIEFP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                  G YA++        Q  SMLPLYR GDILI++ + QV   DR++++ R G+++
Sbjct: 121 TAERRQTGAYALE-------VQGDSMLPLYRDGDILIVDPSAQVRRNDRVVVRTREGEVM 173

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AKVL  +  R I+L+SLN  +P    EM ++EWIARI+WASQ
Sbjct: 174 AKVLARQTPRGIELVSLNPDHPNRNFEMKEVEWIARIIWASQ 215


>gi|327190883|gb|EGE57941.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CNPAF512]
          Length = 228

 Score =  287 bits (735), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 118/235 (50%), Positives = 154/235 (65%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTE--------------KKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q L L    G   E               +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQQPDSRFQPQGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|190890233|ref|YP_001976775.1| phage-related transcriptional regulator protein [Rhizobium etli
           CIAT 652]
 gi|190695512|gb|ACE89597.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CIAT 652]
          Length = 228

 Score =  287 bits (735), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 118/235 (50%), Positives = 154/235 (65%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTE--------------KKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q L L    G   E               +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPQGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|254292703|ref|YP_003058726.1| phage repressor [Hirschia baltica ATCC 49814]
 gi|254041234|gb|ACT58029.1| putative phage repressor [Hirschia baltica ATCC 49814]
          Length = 206

 Score =  287 bits (735), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 88/221 (39%), Positives = 123/221 (55%), Gaps = 16/221 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKIL 62
             H  IW  ID +A RH L+ S LAR AGLD T+FNKSKR   +G + RWPSTES+ K L
Sbjct: 1   MRHSDIWNGIDALAARHGLSVSALARAAGLDATAFNKSKRASADGSKPRWPSTESLSKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AA      +  D+         ++ + IPL+    +G GGFFD   FP G  W+ +  P+
Sbjct: 61  AAVGTGWEEFADMAQG------RQGRTIPLIGLAQAGDGGFFDDAGFPVGASWDDIHFPD 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +      +YA++           SM P++R+GD +I+   + V  GDR++ K + G+++A
Sbjct: 115 MGD--ETVYALE-------ISGDSMEPVFREGDRIIVAPGMDVRRGDRVVAKTKEGEVLA 165

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L       ++L+S N  YP      SDIEWIARILWASQ
Sbjct: 166 KFLGHLSASRVELISANPAYPPREFAASDIEWIARILWASQ 206


>gi|218516275|ref|ZP_03513115.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli 8C-3]
          Length = 228

 Score =  287 bits (735), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 118/235 (50%), Positives = 154/235 (65%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTE--------------KKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q L L    G   E               +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPEGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|163761294|ref|ZP_02168369.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162281451|gb|EDQ31747.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 226

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 145/231 (62%), Gaps = 16/231 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              SH++IW A+D +AERH LT SGLAR+AGLDPT+FNKSKR G +GR+RWPSTES+ K+
Sbjct: 3   PMLSHERIWSALDALAERHGLTASGLARRAGLDPTAFNKSKRRGADGRDRWPSTESLAKV 62

Query: 62  LAATNETICQLLDLPFS---------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
           L AT  ++   + L                   +   IPLL F  +GSGGFFD G FP G
Sbjct: 63  LDATGSSLNDFMSLVVGGQRNDASAIPEGAFPPQAGSIPLLGFAQAGSGGFFDDGGFPAG 122

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             W+ V  P   S   G+YA++        Q  SMLPLYR GDILI+    QV  GDR++
Sbjct: 123 QGWDVVDFPAQPSERPGVYALE-------VQGDSMLPLYRDGDILIVEPGAQVRRGDRVV 175

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++   G+++AKVL     RS++L+SLN  +P  + E+S+I+W+ARI+WASQ
Sbjct: 176 VRSGEGEVMAKVLNRLSPRSVELISLNPDHPNRSFELSEIDWMARIIWASQ 226


>gi|326403286|ref|YP_004283367.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
 gi|325050147|dbj|BAJ80485.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
          Length = 223

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 88/227 (38%), Positives = 120/227 (52%), Gaps = 11/227 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL+
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 64  ATNETICQLLDL-------PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           A++  I     L       P    R      + +PL     +G GGFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAVRTVPLASLAQAGQGGFFDEGGNPTGGGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            + +P      +   A          Q  SM P+YR GDI++++ A  V  GDR++I+  
Sbjct: 121 RIALPV----GDAGIAGDPHAFALTIQGDSMDPVYRDGDIIVVSPASPVRTGDRVVIRTA 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 177 GGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|148259746|ref|YP_001233873.1| putative phage repressor [Acidiphilium cryptum JF-5]
 gi|146401427|gb|ABQ29954.1| putative phage repressor [Acidiphilium cryptum JF-5]
          Length = 223

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 87/227 (38%), Positives = 119/227 (52%), Gaps = 11/227 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL+
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 64  ATNETICQLLDL-------PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           A++  I     L       P    R      + +PL     +G  GFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAMRTVPLASLAQAGQDGFFDEGGNPTGGGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            + +P      +   A          Q  SM P+YR GDI++++ A  V  GDR++I+  
Sbjct: 121 RIALPV----GDAGIAGDPHAFALTIQGDSMDPVYRDGDIIVVSPASPVRTGDRVVIRTA 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 177 GGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|254504422|ref|ZP_05116573.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
 gi|222440493|gb|EEE47172.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
          Length = 221

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 81/222 (36%), Positives = 122/222 (54%), Gaps = 9/222 (4%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              SH+K+W AID +A  + +TPSGLA++AGLDPT+FN+SKRF  +GR RWPSTES+ KI
Sbjct: 9   PMLSHEKVWAAIDALASYNEMTPSGLAKRAGLDPTTFNRSKRFAGDGRPRWPSTESLAKI 68

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L AT E++        +           +P+  F        FD+   PTG  W T+  P
Sbjct: 69  LEATGESLKSFAGRVEAPELRPSTTLSALPVAGFSNVHEENAFDTTGRPTGEHWETIVFP 128

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                   I+A++           ++LPLYRKGD++++  +  V  GDR+++KP  G + 
Sbjct: 129 T--DHTQNIFALE-------VSGDALLPLYRKGDLIVVAPSAAVRRGDRIVLKPSEGGLA 179

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
              L+ R  +++ + ++        +  S IEW ARI+WASQ
Sbjct: 180 VYTLLKRTPKTLQVQTIGDNPENAALLHSAIEWTARIIWASQ 221


>gi|295687529|ref|YP_003591222.1| putative phage repressor [Caulobacter segnis ATCC 21756]
 gi|295429432|gb|ADG08604.1| putative phage repressor [Caulobacter segnis ATCC 21756]
          Length = 214

 Score =  278 bits (711), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 79/225 (35%), Positives = 127/225 (56%), Gaps = 13/225 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG--IEGRNRWPSTESI 58
           M + SH +IW AID +A+R ++TPS +AR AGLDPTSFN+SKR     +GR RWPSTES+
Sbjct: 1   MATLSHGEIWRAIDALADRFDMTPSAMARMAGLDPTSFNRSKRGSTEADGRARWPSTESL 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            K+L AT     +   L           ++  PL+    +G  GFFD+   P G+ W+ V
Sbjct: 61  AKLLEATGVNFSEFAALTEQSPGAGAGGKRGAPLIGLAQAGQEGFFDAAGMPVGSGWDEV 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P++     G++A++           ++ P+YR GD L+++  ++   GDR++ +   G
Sbjct: 121 AAPDLG---QGLFALE-------VSGETLAPVYRDGDRLLVSPTVEPRKGDRVVARTHAG 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++ + L     R+I+L++L        +   ++ WIARI+WASQ
Sbjct: 171 EVLVRELGRVTARTIELLALGRES-DRLLSRDEVAWIARIVWASQ 214


>gi|304394055|ref|ZP_07375978.1| dna-binding protein rdga [Ahrensia sp. R2A130]
 gi|303293495|gb|EFL87872.1| dna-binding protein rdga [Ahrensia sp. R2A130]
          Length = 232

 Score =  277 bits (709), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 87/241 (36%), Positives = 129/241 (53%), Gaps = 29/241 (12%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSHK++W AID +A+ ++++ S LAR AGLD T+FNKSKR G +GR RWPSTES+ KI+
Sbjct: 1   MFSHKQVWAAIDALAQDNDMSVSKLARTAGLDATTFNKSKRIGADGRQRWPSTESLSKIM 60

Query: 63  AATNETICQLLDLPFS--------------------DGRTTEKKEKEIPLLYFPPSGSGG 102
            AT   I   +                                    IPLL    +GSGG
Sbjct: 61  DATKTDIDGFMATMRDGQASFAAGFAGMSETGGTYVPDAPGHPVPVSIPLLGLAQAGSGG 120

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
           FFD    PTG  W  V  P+  S    +YA++           SM PLYR GD ++++  
Sbjct: 121 FFDDAGLPTGEGWEAVEFPQ--SDREPLYALE-------IAGDSMEPLYRDGDRIVVSPT 171

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             V  GDR++++   G+I+AK L  +  ++++L S N  +   T ++++++W+ARI+W S
Sbjct: 172 ASVRRGDRVVVRTSDGEIMAKTLARQTAKTVELDSENPEHQKRTFDLTEVDWVARIMWVS 231

Query: 223 Q 223
           Q
Sbjct: 232 Q 232


>gi|307941488|ref|ZP_07656843.1| peptidase family S24 [Roseibium sp. TrichSKD4]
 gi|307775096|gb|EFO34302.1| peptidase family S24 [Roseibium sp. TrichSKD4]
          Length = 218

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 78/227 (34%), Positives = 127/227 (55%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SHK+IW AID +A R+ L+PSGLAR+AGLDPT+FN SKRFG +GR RWPSTES+ KIL
Sbjct: 1   MLSHKQIWAAIDTLAARNGLSPSGLARRAGLDPTTFNPSKRFGGDGRPRWPSTESLSKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKE------KEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT E++  L+++      T  +        + +P+  F  +     FD    P+   W+
Sbjct: 61  QATGESLETLMEVLLGLAPTGPRAAPLAQDGRMVPIAGFSDANQQAAFDPTGRPSSPMWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           ++  P+ +  +  ++A++            + P YR GDILI+     +  GDR+L++  
Sbjct: 121 SLLFPDPKEKN--LFALE-------INSDDLTPYYRSGDILIVAPVQAIRRGDRVLVRQT 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +G +   ++  +   + D  +L   +    +E + I+W+AR++W SQ
Sbjct: 172 SGALQLFLMDRQNPSAFDFHALTPPHETVHLERTKIDWVARVMWVSQ 218


>gi|16124337|ref|NP_418901.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|221233019|ref|YP_002515455.1| LexA-like transcriptional repressor [Caulobacter crescentus NA1000]
 gi|13421181|gb|AAK22069.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|220962191|gb|ACL93547.1| LexA-related transcriptional repressor [Caulobacter crescentus
           NA1000]
          Length = 213

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 79/224 (35%), Positives = 122/224 (54%), Gaps = 12/224 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE-GRNRWPSTESIF 59
           M + SH +IW AID +AER ++TPS +AR AGLDPTSFN+SKR   E G  RWPSTES+ 
Sbjct: 1   MATLSHGEIWRAIDALAERFDMTPSAMARMAGLDPTSFNRSKRGSAETGHARWPSTESLS 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K+L AT     +   L          + +  PL+    +G  GFFD    P G  W+   
Sbjct: 61  KLLEATGVNFSEFAALTERSPVRAPGR-RGAPLIDLAQAGKDGFFDEAGMPVGAGWDEAP 119

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P++     G++A++            + P+YR GD L+++  ++   GDR++ +   G+
Sbjct: 120 APDLG---EGLFALE-------VTGDDLAPVYRDGDRLLVSPTLEPRKGDRVVTRTHGGE 169

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++ + L     RSI+L++L+       +   ++ WIARI+W SQ
Sbjct: 170 VLVRELGRVTARSIELLALDRVSGERLLSRDEVAWIARIVWVSQ 213


>gi|27376249|ref|NP_767778.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349389|dbj|BAC46403.1| bll1138 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score =  267 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 124/220 (56%), Gaps = 13/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+A R  L+PSGLA++AGLDPT+FN+SKR   +GR RWPSTESI K LA
Sbjct: 11  LTHDQIWVALDRLAARAGLSPSGLAKRAGLDPTTFNRSKRVTSDGRERWPSTESIAKALA 70

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A   +I     L   +   +    + +PLL    +G+ G FD    P+G  W  + +P  
Sbjct: 71  AAGASIDVFAGLISDETGNS----RSVPLLGLAQAGASGAFDESGLPSGKGWTELALPTA 126

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
               +  +A++           ++ P YR GD+++++    +  GDR+++  + G++   
Sbjct: 127 ED--SQTFALE-------IAGDALAPTYRNGDVILVSPGTPIRKGDRVVVTTKAGEVTVA 177

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  +++DL+ L+      T+   ++ W+ARI+WASQ
Sbjct: 178 TLKRRTAKALDLLPLDASQAERTIAAGELAWVARIVWASQ 217


>gi|170741440|ref|YP_001770095.1| peptidase S24/S26 domain-containing protein [Methylobacterium sp.
           4-46]
 gi|168195714|gb|ACA17661.1| peptidase S24 and S26 domain protein [Methylobacterium sp. 4-46]
          Length = 209

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 83/219 (37%), Positives = 120/219 (54%), Gaps = 12/219 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IW AID +A+RH LTPSGLA++AGLDPTSFN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLSHDRIWSAIDHLAQRHRLTPSGLAKRAGLDPTSFNRSKRVAPDGRRRWPSTESLAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  T+ + + L              +PL+        G       PTG+ W+ +  P+
Sbjct: 61  AATGATLDEFVQLVSPRAAAG---AAVVPLIGSAALAVAGRIGPDGRPTGSAWDELDFPD 117

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           + +     +AI+        Q   + PLY  GD+L++ +   +  GDR+L+  RTG +V 
Sbjct: 118 LGTQD--CFAIE-------VQGNDLRPLYHDGDVLVVCATAPMRRGDRILVSLRTGALVG 168

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
            VL  R  R  DL  +       ++  ++I W+ARI+W 
Sbjct: 169 AVLRRRTARVADLAPVMPGEAARSIATAEIAWMARIMWV 207


>gi|254420759|ref|ZP_05034483.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
 gi|196186936|gb|EDX81912.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
          Length = 211

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 87/224 (38%), Positives = 119/224 (53%), Gaps = 17/224 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFK 60
             SH K+W+A+D +A R  L+PSGLAR+AGLD TSFN SKRFG     R RWPSTES+  
Sbjct: 2   PLSHAKLWKAVDALARREGLSPSGLARRAGLDATSFNPSKRFGAGDPPRPRWPSTESMTL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT  ++ +   L              +PLL    +G  GFFD    P G+ W+   +
Sbjct: 62  MLQATGVSLAEFAALADD----APPTSTTVPLLGLARAGLDGFFDDAGLPVGDGWDQTEL 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGD 179
           P           +       +    SM PLYR+GD +I++     V  GDR++ +  +G+
Sbjct: 118 PR----------VNATTFSLRISGDSMAPLYREGDRVIVDRGDPAVRRGDRVVARLTSGE 167

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +VAK L     R+  L S+N  YP   V   +IEW+ARILW SQ
Sbjct: 168 VVAKELTGLTARAATLSSINPDYPPRIVPRREIEWMARILWVSQ 211


>gi|90418702|ref|ZP_01226613.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336782|gb|EAS50487.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 215

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 100/224 (44%), Positives = 140/224 (62%), Gaps = 12/224 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH +IW AID +A RH ++PSGLAR+AGLDPT+FNKSKR   +GR RWPSTESI K++
Sbjct: 1   MFSHDRIWLAIDALATRHRMSPSGLARRAGLDPTTFNKSKRNASDGRPRWPSTESIAKVI 60

Query: 63  AATNETICQLLDLPFSDGR---TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           AAT  +I +   L   +      +      +PLL F  +G GGFFD   FP G  W+ + 
Sbjct: 61  AATGTSIEEFAALMRGETPGVPRSPSPAMSVPLLGFAEAGGGGFFDDSGFPAGQGWDEIA 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           +P        +YA++           SM+PLYR GDILI++ A  V  GDR++++ R G+
Sbjct: 121 LPSTGD--ETVYALE-------VSGQSMMPLYRDGDILIVSPAAAVRRGDRVVVRTREGE 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK+L  +  R+I+L S N  +P    +M ++EW+ARILWASQ
Sbjct: 172 VMAKILQRQTSRTIELASTNPDFPDRQFQMDEVEWMARILWASQ 215


>gi|302383458|ref|YP_003819281.1| phage repressor [Brevundimonas subvibrioides ATCC 15264]
 gi|302194086|gb|ADL01658.1| putative phage repressor [Brevundimonas subvibrioides ATCC 15264]
          Length = 211

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 85/224 (37%), Positives = 126/224 (56%), Gaps = 17/224 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFK 60
           S SH ++W A+D +A R  L+ S LARKAGLD T+FN SKRFG     R RWPSTES+  
Sbjct: 2   SLSHDRLWTALDTLARRQGLSSSALARKAGLDATAFNPSKRFGPGVPPRPRWPSTESLNL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL AT  ++ +   L          +    PLL    +G+ GFFD    PTG+ W    +
Sbjct: 62  ILEATGTSLAEFAALADD----APARIATAPLLGMAQAGADGFFDDAGLPTGDGWEQTDL 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGD 179
           P   SP   ++++            SM+PLYR+GD ++++     V  GDR++ + R+G+
Sbjct: 118 P---SPKESLFSL-------LISGDSMVPLYREGDRVLVDRERTDVRKGDRVVARTRSGE 167

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            +AK + +   R++ L S+N  YP   +  +D++W+ARILW SQ
Sbjct: 168 TLAKQIEALTARTVTLASINPAYPPRVLARADVDWMARILWVSQ 211


>gi|296532329|ref|ZP_06895067.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
 gi|296267353|gb|EFH13240.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
          Length = 216

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 91/225 (40%), Positives = 130/225 (57%), Gaps = 14/225 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H  IW A+D +A  H L+PSGLARKAGLDPT+FN SKR G +GR RWPSTES+ KILA
Sbjct: 1   MRHDDIWRAVDALAAEHGLSPSGLARKAGLDPTAFNPSKRLGTDGRARWPSTESVAKILA 60

Query: 64  ATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           AT   +     L                 + IPL+    +G  G+F  G +P G  W+ +
Sbjct: 61  ATGTDMESFAALVTGAAAALNRSPRSMPGRRIPLIGLAQAGGDGYFGDGGYPVGAGWDEI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             PE+  P+   YA++           SM P++R GDI+I++    V  GDR++++   G
Sbjct: 121 STPELSDPN--AYALE-------ISGDSMEPVFRDGDIIIVSPNAPVRRGDRVVVRTLKG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK L+ +  R I+L SLN  +P  + ++++I WI RILWASQ
Sbjct: 172 EVMAKELLRQSARRIELASLNPAHPGYSFDLAEIAWIHRILWASQ 216


>gi|220924406|ref|YP_002499708.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
 gi|219949013|gb|ACL59405.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
          Length = 209

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 77/219 (35%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AID +A+RH LTPSGLAR+AGLD TSFN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLSHERIWLAIDHLAQRHGLTPSGLARRAGLDATSFNRSKRIAPDGRKRWPSTESLAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++   L L                 +      +G        P G  W  +  P+
Sbjct: 61  TATGASLDDFLQLVEPRPAPPPAILPL---IGSAALAAGRRIGPDGRPAGAGWEEMEFPD 117

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           + +     +AI+        Q   +LPLY  GD+L++ +      GDR L+      + A
Sbjct: 118 LGAQ--SCFAIE-------VQGEGLLPLYHDGDVLVVCATAPARRGDRTLVCLDGEGLFA 168

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
             L  R  R+ +        PV TV  + I W+AR++W 
Sbjct: 169 ADLRRRTVRTTEFAGRTPGEPVRTVPTARIAWMARVMWV 207


>gi|254471620|ref|ZP_05085021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
 gi|211958822|gb|EEA94021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
          Length = 214

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 80/234 (34%), Positives = 110/234 (47%), Gaps = 33/234 (14%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H+ +W A+D+MA+RH LTPSGLAR+AGLDPTSFN SKRF  +GR RWPSTES+ K+L
Sbjct: 1   MLDHENLWAALDKMAKRHQLTPSGLARRAGLDPTSFNPSKRFAADGRPRWPSTESLAKVL 60

Query: 63  AATNETICQLLDLP-------------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
             T  T      L              F     T  + +E+ L          F DS +F
Sbjct: 61  EVTQMTFVDFAGLLQDKTEISGTHFRSFPAYLCTSDELREVDLEDLSGFQLDKFCDSFIF 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P+             S     +A++           S  P YR+G ILI++    +   D
Sbjct: 121 PS-------------SQSEKFFALE-------VSSNSFEPYYREGQILIVSPESSLRRND 160

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            +LI  +TGD+    L  +    I+            V+++D+ W ARILW SQ
Sbjct: 161 HVLIATKTGDLHCGPLQRQTNERIEFRRHTPDDTPRVVQVADLVWTARILWVSQ 214


>gi|118589338|ref|ZP_01546744.1| repressor protein CI [Stappia aggregata IAM 12614]
 gi|118438038|gb|EAV44673.1| repressor protein CI [Stappia aggregata IAM 12614]
          Length = 227

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/222 (35%), Positives = 114/222 (51%), Gaps = 11/222 (4%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T  SH+K+W AID +A ++ LTPSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+
Sbjct: 17  TVLSHEKVWAAIDALASQNGLTPSGLARRAGLDPTAFNPSKRVAGDGRPRWPSTESLAKV 76

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           LAAT E +        ++   +      +P+     +     FD+   P+G  W     P
Sbjct: 77  LAATGEALNTFAARVETEDAPSGSVPALVPVAALEAASDRNAFDAAGRPSGATWQQFSFP 136

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +  +     +A+Q         +    PLYR GDI+++     +  GDRL +K  +G + 
Sbjct: 137 QPGAS----FALQ-------VSNEDFQPLYRNGDIVVVAPDAPLRTGDRLALKLTSGRLS 185

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
              L    G  + + ++           S IEW ARI+WASQ
Sbjct: 186 LYTLQEAGGEELSVRTIGENSHSLRFRHSAIEWTARIIWASQ 227


>gi|114569067|ref|YP_755747.1| putative phage repressor [Maricaulis maris MCS10]
 gi|114339529|gb|ABI64809.1| putative phage repressor [Maricaulis maris MCS10]
          Length = 208

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 109/222 (49%), Gaps = 15/222 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKI 61
             +H  IW  IDR+A     +PSGLAR+AGLD T+FN SKR   +G + RWPSTESI K 
Sbjct: 1   MLTHDDIWRGIDRLARHAQTSPSGLARRAGLDSTTFNPSKRISADGTKPRWPSTESIAKA 60

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           LAA +        L     RT       +P            FD+  +P G  W+ +  P
Sbjct: 61  LAAAHLDFDDFAGLISGQPRTG-----ALPSRALADGEEQDPFDATGYPAGPDWDAIPFP 115

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +            +      QDT MLP+YR GD L+++       GDR++++ R G   
Sbjct: 116 GLA---------PGEAFALTVQDTHMLPVYRPGDRLVVSHEAPTRVGDRVVVQRRDGSRS 166

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           A  L  +  +++ L  L+   P  T+ ++ + W+ARI+W SQ
Sbjct: 167 AWTLSEKTVQALRLAPLDPLQPALTLPLTQVAWLARIVWVSQ 208


>gi|114328547|ref|YP_745704.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
 gi|114316721|gb|ABI62781.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
          Length = 221

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 78/231 (33%), Positives = 112/231 (48%), Gaps = 21/231 (9%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A    L+ SGLAR+AGLD T+FN SKR   +GR RWPSTESI KIL 
Sbjct: 1   MKHEDIWRAIDTLAAIKGLSTSGLARRAGLDATTFNLSKRQMPDGRQRWPSTESISKILV 60

Query: 64  ATNETICQLLDLP------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT E++     L        +D        + IPL   P        D  +   GN    
Sbjct: 61  ATGESLGAFTSLVNGAETLSADSGQNTHYGRRIPLFSLPE-----LRDLPIKGEGN---- 111

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
             +P  R   +       +    +  DTS+ PL+R+G ILI++    +  GDR++++   
Sbjct: 112 -ALPSARDETSLPDVADREAYGIEIHDTSLAPLFREGTILIVSPNAPLRRGDRVIVRLAA 170

Query: 178 G-----DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
                 + V      R  R +D+ SLN      ++ ++ + WI RI+WASQ
Sbjct: 171 HDGEPSETVFGHFHRRSARWMDISSLNGDKAERSISLTSLVWIHRIVWASQ 221


>gi|330992988|ref|ZP_08316928.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
 gi|329759941|gb|EGG76445.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
          Length = 223

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 60/189 (31%), Positives = 83/189 (43%), Gaps = 12/189 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AIDR+A    LTPSGLAR AGLD T+FN SKR    GR RWP TES+ + L
Sbjct: 1   MISHDDIWRAIDRLAAERGLTPSGLARAAGLDSTTFNPSKRITPSGRPRWPGTESLARTL 60

Query: 63  AATNETICQLLDLPFS---DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +AT  +      L         T       + +  F        FD    P G +W    
Sbjct: 61  SATGISFEGFSRLLSGHHDPETTNRAHHSHLKIAPFSQLAHPELFDETGLPEGERWEKWE 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              +   H+  YA+            +M P++RKG  L+++    +   DR+L+    G 
Sbjct: 121 FHGMADHHS--YAV-------HVDCDTMEPIFRKGGTLVVSPTAAIRVHDRVLLHTPQGT 171

Query: 180 IVAKVLISR 188
               ++  R
Sbjct: 172 ACCGMVTER 180


>gi|296114602|ref|ZP_06833255.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978958|gb|EFG85683.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 221

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 59/202 (29%), Positives = 92/202 (45%), Gaps = 13/202 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW A+D +A    +TPSGLAR AGLD T+FN SKR    GR RWP TES+ + L
Sbjct: 1   MISHEDIWRALDLLATERGMTPSGLARAAGLDSTTFNPSKRMTSSGRPRWPGTESLARTL 60

Query: 63  AATNETICQLLDLPFSDG-RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +AT  ++     L    G R        + ++ F   G    FD    P+G++W T    
Sbjct: 61  SATGISLEGFGRLMTGHGDRLGGTHHAHLMIVPFSELGQAELFDESGLPSGDRWETWDFH 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +   H+  YA+            +M P++R G +L+++    +   DR+L+        
Sbjct: 121 GLADHHS--YAV-------LVDSDNMEPIFRAGTVLVVSPTAAIRQHDRVLLHGPDSHAC 171

Query: 182 AKVLISRRGRSIDLMSLNCCYP 203
             ++     R  D+      + 
Sbjct: 172 CGIV---TDRWHDVPLTAPLHE 190


>gi|162145992|ref|YP_001600450.1| hypothetical protein GDI_0160 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209544371|ref|YP_002276600.1| hypothetical protein Gdia_2230 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161784566|emb|CAP54103.1| conseved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532048|gb|ACI51985.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 217

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 68/225 (30%), Positives = 99/225 (44%), Gaps = 16/225 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  +W+A+D +A    LTPSGLAR AGLD TSFN SKR    GR RWP TES+ ++L
Sbjct: 1   MMRHDDLWQALDNLAAERGLTPSGLARAAGLDSTSFNPSKRVTPAGRPRWPGTESLARVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEK---EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            AT  T+     L          +      + L        GG FD+   P G  W +  
Sbjct: 61  DATGLTLESFGRLMAGQALPRASRAAGRSRLRLSALSHLEQGGMFDAAGLPVGRHWESWD 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           VP +      +YA+            +  P++R G  L+++SA  +   DR+++      
Sbjct: 121 VPGLGDAE--LYAVMVDT-------DAFEPVFRAGAFLVVSSAAAIRRQDRVILHRADAT 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVD---TVEMSDIEWIARILWA 221
           + A VL  R G + D   L           +E    + + RI+ A
Sbjct: 172 LCAVVLDPRPG-AYDPGPLLGGIGARDGMEIETGPTDHLHRIMMA 215


>gi|329115279|ref|ZP_08244034.1| Phage Repressor [Acetobacter pomorum DM001]
 gi|326695722|gb|EGE47408.1| Phage Repressor [Acetobacter pomorum DM001]
          Length = 214

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 60/227 (26%), Positives = 92/227 (40%), Gaps = 21/227 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
               ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R    G  RWP+  S+ + L
Sbjct: 1   MIPAERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGHGVWRWPALPSLLRAL 60

Query: 63  AATNETICQL----LDLPFSDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
                ++ Q           DG  T      + +PL +      GG  D    P G  W 
Sbjct: 61  DVLRVSLAQFEAHLWGYEQPDGAKTPAPCFMRSLPLSWLDQ---GGVLDRAGLPAGGLWE 117

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDT-SMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                         +++ +        DT  M P+ R G  L++  A+     DR+++  
Sbjct: 118 Q---------EETFFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALHPRGADRVVLIR 168

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
                V  +L  +  R+I     +   PV         W+ RI+  S
Sbjct: 169 AGQAPVVGILQEKPVRAIQPFGRSALQPVPAAAAG--VWLHRIVLIS 213


>gi|258541731|ref|YP_003187164.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256632809|dbj|BAH98784.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256635866|dbj|BAI01835.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-03]
 gi|256638921|dbj|BAI04883.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-07]
 gi|256641975|dbj|BAI07930.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-22]
 gi|256645030|dbj|BAI10978.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-26]
 gi|256648085|dbj|BAI14026.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-32]
 gi|256651138|dbj|BAI17072.1| transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654129|dbj|BAI20056.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-12]
          Length = 214

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 56/227 (24%), Positives = 92/227 (40%), Gaps = 21/227 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
               ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R   +G  RWP+  S+ + L
Sbjct: 1   MIPAERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGQGVWRWPALPSLLRAL 60

Query: 63  AATNETICQL------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
                ++ Q        + P           + +PL +       G  D    P G  W 
Sbjct: 61  DVLRVSLAQFEGHIWGYEQPDGVEAPAPCFMRSLPLSWLKQ---EGVLDRAGLPAGGLWE 117

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDT-SMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                         +++ +        DT  M P+ R G  L++  A+     DR+++  
Sbjct: 118 Q---------EETFFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALYPRGADRVVLIR 168

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
                V  +L  +   +I     +   PV   + +   W+ RI+  S
Sbjct: 169 PGQAPVVGILQEKPVLAIQPFGRSALQPVP--QAAAGVWLHRIVLIS 213


>gi|294853434|ref|ZP_06794106.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
 gi|294819089|gb|EFG36089.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
          Length = 160

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 86/169 (50%), Gaps = 15/169 (8%)

Query: 61  ILAATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           ++ AT  T  +   L                    IPLL    +G+GG+FD   FP G  
Sbjct: 1   MMEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQG 60

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W+ V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++
Sbjct: 61  WDIVEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVR 111

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 112 TRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 160


>gi|261318541|ref|ZP_05957738.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|265986342|ref|ZP_06098899.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|261297764|gb|EEY01261.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|264658539|gb|EEZ28800.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
          Length = 170

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 63/166 (37%), Positives = 84/166 (50%), Gaps = 15/166 (9%)

Query: 64  ATNETICQLLDLPFSDGRTTEK------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           AT  T  +   L                    IPLL    +G+GG+FD   FP G  W+ 
Sbjct: 14  ATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWDI 73

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           V  P       G+YA++           SMLPLYR GD LI+     V  GDR++++ R 
Sbjct: 74  VEFPARTG--EGVYALE-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRD 124

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 125 GEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 170


>gi|254710961|ref|ZP_05172772.1| Peptidase family S24 [Brucella pinnipedialis B2/94]
 gi|256029343|ref|ZP_05442957.1| Peptidase family S24 [Brucella pinnipedialis M292/94/1]
          Length = 142

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 63/150 (42%), Positives = 84/150 (56%), Gaps = 10/150 (6%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            LP   G  T+     IPLL    +G+GG+FD   FP G  W+ V  P       G+YA+
Sbjct: 3   SLPRHLGEYTQDPHP-IPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--EGVYAL 59

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +           SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I
Sbjct: 60  E-------VSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTI 112

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +L SLN  +P    E  DIEWIARILWASQ
Sbjct: 113 ELHSLNPEHPNRIFESKDIEWIARILWASQ 142


>gi|260567943|ref|ZP_05838412.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260154608|gb|EEW89689.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 132

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 80/139 (57%), Gaps = 9/139 (6%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
            +   IPLL    +G+GG+FD   FP G  W+ V  P       G+YA++          
Sbjct: 3   ARPAPIPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTG--EGVYALE-------VSG 53

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
            SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+L SLN  +P 
Sbjct: 54  ESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEHPN 113

Query: 205 DTVEMSDIEWIARILWASQ 223
              E  DIEWIARILWASQ
Sbjct: 114 RIFESKDIEWIARILWASQ 132


>gi|329889506|ref|ZP_08267849.1| peptidase S24-like family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844807|gb|EGF94371.1| peptidase S24-like family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 152

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 15/165 (9%)

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           ++L A+  ++ +   L            + IPLL    +G  GFFD    P    W+   
Sbjct: 2   RVLQASGLSLGEFAALADD----AAPHPRAIPLLGLARAGDEGFFDDAGLPMAEGWDQTE 57

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN-SAIQVNCGDRLLIKPRTG 178
           +P  +                     SM P+YR GD +I++  A +V  GDR++++   G
Sbjct: 58  LPAHKD----------SLFSLTIDGDSMEPVYRPGDRVIVDLDATEVRRGDRVVVRTAEG 107

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + +AK + +  GR + L S+N  Y    +    I W+ARILW SQ
Sbjct: 108 ETLAKEIAALNGREVVLASVNPHYEPRILPRGQIRWMARILWVSQ 152


>gi|296160137|ref|ZP_06842956.1| putative phage repressor [Burkholderia sp. Ch1-1]
 gi|295889611|gb|EFG69410.1| putative phage repressor [Burkholderia sp. Ch1-1]
          Length = 222

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 66/156 (42%), Gaps = 20/156 (12%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
                +PF  G       K IP+L     G  GF+    +P G+    +  P       G
Sbjct: 79  DAFNPIPFPPG-------KRIPVLGMAQLGDNGFWAEVEYPVGHGEGYLDFPSRDRDAYG 131

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I  +            SMLP  + G+ +++     V  GD +L+K + G ++ K+L+ +R
Sbjct: 132 IRCV----------GDSMLPRIKDGEFVVIEPNHPVENGDEVLVKAKDGRVMIKILLYQR 181

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIE---WIARILWAS 222
                LMS+N  +    +E   IE   ++A I+ +S
Sbjct: 182 AGRTHLMSVNTEHAPLAIETEKIERLHYVAAIVKSS 217


>gi|331017574|gb|EGH97630.1| putative phage repressor [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 228

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 80/218 (36%), Gaps = 29/218 (13%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-EGRNRWPSTESIFKILAATNETICQ 71
           I ++ +   L+   LA   G +  S     R G  E   R PS + I KI      +   
Sbjct: 8   IRKLRKEKGLSQQALAHACGWESQS-----RIGNYEKGTRQPSLQDIRKIADTLGVSFVD 62

Query: 72  LLDLPFSDGRT-------------TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           L+     + +               + KE  +P++     G+ G+FD+  FP G+    +
Sbjct: 63  LVAFTDDNAQPLVVKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPGHGDGYL 122

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +        G+          K    SMLP  + G+ +++        GD ++++   G
Sbjct: 123 NIHSDDPDAYGL----------KVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAG 172

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
             + K  I  R       S+N  +P   +  ++I  I 
Sbjct: 173 RTMIKEYIYLRDGMYRFDSVNAEHPPIHIAENEILEIH 210


>gi|213968238|ref|ZP_03396382.1| phage repressor [Pseudomonas syringae pv. tomato T1]
 gi|301381283|ref|ZP_07229701.1| putative phage repressor [Pseudomonas syringae pv. tomato Max13]
 gi|302062899|ref|ZP_07254440.1| putative phage repressor [Pseudomonas syringae pv. tomato K40]
 gi|213926876|gb|EEB60427.1| phage repressor [Pseudomonas syringae pv. tomato T1]
          Length = 228

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 80/218 (36%), Gaps = 29/218 (13%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-EGRNRWPSTESIFKILAATNETICQ 71
           I ++ +   L+   LA   G +  S     R G  E   R PS + I KI      +   
Sbjct: 8   IRKLRKEKGLSQQALAHACGWESQS-----RIGNYEKGTRQPSLQDIRKISDTLGVSFVD 62

Query: 72  LLDLPFSDGRT-------------TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           L+     + +               + KE  +P++     G+ G+FD+  FP G+    +
Sbjct: 63  LVAFTDDNAQPLVVKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPGHGDGYL 122

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +        G+          K    SMLP  + G+ +++        GD ++++   G
Sbjct: 123 NIHSDDPDAYGL----------KVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAG 172

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
             + K  I  R       S+N  +P   +  ++I  I 
Sbjct: 173 RTMIKEYIYLRDGMYRFDSVNAEHPPIHIAENEILEIH 210


>gi|218555126|ref|YP_002388039.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361894|emb|CAQ99494.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 224

 Score = 93.5 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+L     G GG +    +  G+    +  P   +     YA+       K    SM+P
Sbjct: 95  VPVLGNTQLGVGGLWSDTQYSVGSSDGFIYWP---TKDEDAYAL-------KCVGDSMMP 144

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             ++G+ +I+        GD +L+  R G+++ K  +  R     LMS+N  +P   V  
Sbjct: 145 RIKEGEFVIVEPNHDYTPGDEVLVVTRDGEVMVKTFLFERDGLFHLMSVNEDHPPVRVPR 204

Query: 210 SDIEWIA 216
            +IE I 
Sbjct: 205 ENIEKIH 211


>gi|260845233|ref|YP_003223011.1| putative phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|257760380|dbj|BAI31877.1| predicted phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|309702933|emb|CBJ02264.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 224

 Score = 93.1 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+L     G GG +    +  G+    +  P   +     YA+       K    SM+P
Sbjct: 95  VPVLGNTQLGVGGLWSDTQYSVGSSDGFIYWP---TKDEDAYAL-------KCVGDSMMP 144

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             ++G+ +I+        GD +L+  R G+++ K  +  R     LMS+N  +P   V  
Sbjct: 145 RIKEGEFVIVEPNHDYTPGDEVLVVTREGEVMVKTFLFERDGLFHLMSVNEDHPPVRVPR 204

Query: 210 SDIEWIA 216
            +IE I 
Sbjct: 205 ENIEKIH 211


>gi|73542066|ref|YP_296586.1| peptidase S24, S26A and S26B [Ralstonia eutropha JMP134]
 gi|72119479|gb|AAZ61742.1| Peptidase S24, S26A and S26B [Ralstonia eutropha JMP134]
          Length = 421

 Score = 92.3 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 59/152 (38%), Gaps = 13/152 (8%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            L F      +   ++IP+      G  G F    +P G+    V  P         YA+
Sbjct: 275 SLAFDVFPIPQNSFRKIPVRGMAQLGDNGHFVDIEYPVGHGDGYVFFPTKDPD---AYAL 331

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +           SM P  +  + +++    Q+  GD +L K + G ++ K L   R   +
Sbjct: 332 RCN-------GESMRPRVKHNEFVVVEPNTQIQNGDEVLAKSQDGRVMVKELAYIRDGIV 384

Query: 194 DLMSLNCCYPVDTVEMSDIE---WIARILWAS 222
            L S+N  + +  +    IE   ++A I+  S
Sbjct: 385 HLSSVNERHGMVRIPQDQIERLHFVAGIVKRS 416


>gi|330445051|ref|ZP_08308704.1| peptidase S24-like family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489242|dbj|GAA03201.1| peptidase S24-like family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 169

 Score = 92.3 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 63/161 (39%), Gaps = 11/161 (6%)

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            ++    N ++ + L     +          IP++    +G    +    +P G     V
Sbjct: 9   ARVAEKLNVSL-EWLYYGGEEIGLACSPSAHIPIVGNTQAGPDRAWLDLGYPAGYSDEYV 67

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P        +YA+       K    SM P   +G+ ++++   +   G+ ++++  TG
Sbjct: 68  DFPTKAR---NVYAL-------KVVGNSMSPRILEGEAVLVDPESEPATGEEVVVRLTTG 117

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++ K L + R   I L S N  Y      + ++E++  ++
Sbjct: 118 AVMVKTLAAIRDEKIFLDSYNHGYERMVFPLDEVEFMHPVI 158


>gi|317054052|ref|YP_004118077.1| putative phage repressor [Pantoea sp. At-9b]
 gi|316952047|gb|ADU71521.1| putative phage repressor [Pantoea sp. At-9b]
          Length = 230

 Score = 91.9 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/216 (21%), Positives = 83/216 (38%), Gaps = 32/216 (14%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +D + +  NL+ + LAR AG+ P + N   + G  G+      +S  KI AAT   +  +
Sbjct: 15  LDELLKAANLSKADLARIAGVSPQAVNNWFKRGEIGK------DSAIKISAATGLDLSWV 68

Query: 73  LDLPFSDGRTTEKKEKE------------IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           L        T  +K               IP+      G  G  D   F  G  W  +  
Sbjct: 69  LGESDQMYSTPHQKPASEVEVVGNIMNGVIPVKGDAVLGMDGLIDMMEFHAG--WLRI-- 124

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                     Y+   +    + +  SM P  + G+ +++    +V+ GD + I+   G  
Sbjct: 125 ----------YSDDREAYGVRVRGDSMWPRIQSGEFVVIEPNTKVHPGDEVFIRTSDGHN 174

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
           + K+L   R       S+N  +   T+ ++ ++ I 
Sbjct: 175 MIKILNYNRAGDYQFTSINNDHKPFTLPVNQVDKIH 210


>gi|146308997|ref|YP_001189462.1| putative phage repressor [Pseudomonas mendocina ymp]
 gi|145577198|gb|ABP86730.1| putative phage repressor [Pseudomonas mendocina ymp]
          Length = 240

 Score = 91.5 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 74/227 (32%), Gaps = 38/227 (16%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-EGRNRWPSTESIFKILAATNETICQ 71
           + R+ +   ++   LA + G    S     R G  E   R PS   +  I  A   ++ +
Sbjct: 8   LKRLRKAKGMSQQALAEECGWASQS-----RIGNYEADLRAPSLSDLLLIAPALGVSLAE 62

Query: 72  LLDLPFSDGR----------------------TTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           L       G                           KE  +P++     G+ G+F++  F
Sbjct: 63  LAGSDEWTGAYGVQVQVKNHQVRESVGAETIEAGTAKEGAVPVVGNAKLGTDGYFEAVDF 122

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G+    + +                    K    SM P  + G+ +++        GD
Sbjct: 123 PVGHGDGYLLIHSD----------DPNAYGLKVLGDSMHPRIKNGEYVLIEPNKVFTSGD 172

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
            +++K + G  + K  I  R       S+N  +    +    I+ I 
Sbjct: 173 EVMVKTKDGQAMIKEFIYLRDGMYRFDSVNQSHQPIHLPEDAIDKIH 219


>gi|332160963|ref|YP_004297540.1| putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665193|gb|ADZ41837.1| Putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862119|emb|CBX72283.1| hypothetical protein YEW_AK02200 [Yersinia enterocolitica W22703]
          Length = 225

 Score = 91.2 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 61/147 (41%), Gaps = 13/147 (8%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
            G   E   ++IP++     G+GGF++   +P G+    +  P         YA+     
Sbjct: 85  GGDPHEMHFRDIPVVGNAQLGNGGFWNDMEYPIGSGDGFIRWPSYDPD---AYAL----- 136

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSL 198
             K    SM+P  ++G+ +I+        GD +L+     +++ K  +  R   I L+ +
Sbjct: 137 --KCVGDSMMPRIKEGEFVIIEPGHNYIPGDEVLVVTDKDEVMVKTFLFERDGYIHLLPV 194

Query: 199 NCCYPVDTVEMSDIE---WIARILWAS 222
           N  +       + +    ++A I  +S
Sbjct: 195 NEDHAPIKYPRTAVVKIQYVAGIAKSS 221


>gi|212712325|ref|ZP_03320453.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
 gi|212685071|gb|EEB44599.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
          Length = 224

 Score = 89.6 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 54/137 (39%), Gaps = 13/137 (9%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
            IP++     G GG +    +P G     +  P        +  +            SM+
Sbjct: 91  SIPVVGRAQLGEGGCWSDLQYPIGMGEGYIHWPTSDPDAYALLCV----------GDSMI 140

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV---D 205
           P  ++G+ +I+        GD +L+   T + + K  +  R   I L S+N  +P    +
Sbjct: 141 PRIKEGEFVIIEPNHTYRPGDEVLLVTSTEETMVKTYLYERDGYIHLSSINDAHPPIKVE 200

Query: 206 TVEMSDIEWIARILWAS 222
            +++  I ++A I   S
Sbjct: 201 QIKVDKIHYVAGIAKPS 217


>gi|85058275|ref|YP_453977.1| hypothetical protein SG0297 [Sodalis glossinidius str. 'morsitans']
 gi|84778795|dbj|BAE73572.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 232

 Score = 88.5 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 64/147 (43%), Gaps = 13/147 (8%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
             +       ++P+L     G GG++D   +  G     V  P         +A+     
Sbjct: 91  PDKPIPLAFTKVPMLGTAQLGGGGYWDLQEYAVGQGDGYVLWPTKDKD---AFAL----- 142

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSL 198
             K Q  SM+P  + G+ +++        GD +L++   G+++ K+ + ++   ++L+S+
Sbjct: 143 --KCQGDSMMPRIQHGEFVVVEPNRGYKPGDEVLVQDEQGEVMIKIFLFQKDGIVNLLSV 200

Query: 199 NCCYPVDTVEMSDIE---WIARILWAS 222
           N  +    ++   I+   ++A I+  S
Sbjct: 201 NSKHAPTRLDAHTIKKMFYVAGIVKDS 227


>gi|284006836|emb|CBA72100.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 230

 Score = 88.1 bits (217), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 10/126 (7%)

Query: 88  KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM 147
           K IP+L     GS G+++   +P G     +  P         +A++           SM
Sbjct: 98  KAIPVLGNAQLGSEGYWEELEYPIGYGDGYINWPTKDPD---AFALKCI-------GDSM 147

Query: 148 LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
            P  + G+ +++        GD + I    G+ + K  +  R   I ++S+N  +P    
Sbjct: 148 KPRIKNGEYVVIEPNHTYLPGDEVFITTSEGEAMVKTFLYERDGVIVVISINENHPPLHF 207

Query: 208 EMSDIE 213
           +++ IE
Sbjct: 208 DINRIE 213


>gi|145635989|ref|ZP_01791671.1| hypothetical protein CGSHiAA_00695 [Haemophilus influenzae PittAA]
 gi|145266755|gb|EDK06777.1| hypothetical protein CGSHiAA_00695 [Haemophilus influenzae PittAA]
          Length = 301

 Score = 87.3 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 56/140 (40%), Gaps = 13/140 (9%)

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
               +P+  +   G+ G +    +P G     +  P        +YA+       K Q  
Sbjct: 167 PVNHVPIRGYAQLGTEGHWIDLEYPVGEGDGYIWWPSR---DEDVYAL-------KCQGD 216

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +I+    ++  GD +L+      ++ K+    +G  + L S+N  +   
Sbjct: 217 SMTPRIKHGEYVIIEPNHEIKNGDEVLVVTDEDQVMVKIYAYEQGGRLTLYSVNENHEPI 276

Query: 206 TVEMSDI---EWIARILWAS 222
            +   +I   ++IA I   S
Sbjct: 277 NLYQENIRKMQYIAGIAKES 296


>gi|255606333|ref|XP_002538548.1| conserved hypothetical protein [Ricinus communis]
 gi|223511638|gb|EEF23835.1| conserved hypothetical protein [Ricinus communis]
          Length = 331

 Score = 83.8 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 53/131 (40%), Gaps = 14/131 (10%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+      G  G++    +  G            S     YA++ +         SM P
Sbjct: 204 VPVRGMAQLGDNGYWAEMEYSEG-------YVATASLDKDAYALKCK-------GDSMKP 249

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             + G+ ++L     +  GD +LIK + G ++ K  +      I L+S N  +   +VE 
Sbjct: 250 RIKDGEYVVLEPNQPIAPGDEVLIKAKDGRVMVKEFVYEAQGKIYLLSTNEAHGKISVER 309

Query: 210 SDIEWIARILW 220
           ++IE +  + W
Sbjct: 310 ANIEHMHYVGW 320


>gi|186476666|ref|YP_001858136.1| putative phage repressor [Burkholderia phymatum STM815]
 gi|184193125|gb|ACC71090.1| putative phage repressor [Burkholderia phymatum STM815]
          Length = 331

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 80/221 (36%), Gaps = 25/221 (11%)

Query: 24  PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL--------DL 75
           PS +A    LDPT+    +R       +  + E++  + AA    +  L          L
Sbjct: 101 PSEIATPDNLDPTTLTGPQRIRASLGPQNLTAETLASV-AAVGADVASLWLAGQGPEPTL 159

Query: 76  PFSDGRTTEKKEKEIPLL-YFPPSGSGGFFDSGVFPTG-NKWNTVGVPEIRSPHNGIY-- 131
             +           + +L      G    +D    P     W+ V V  +    +  Y  
Sbjct: 160 IQAVALQNTYGVNSVWILKGKGTPGVAVRYDDEWRPVTFKNWHLVPVKGMAQLGDNGYWA 219

Query: 132 ------------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                       ++       + +  SM P  + G+ ++L     +N GD +L+K + G 
Sbjct: 220 EIEYGEGYVATASLDKDAYAVRCKGDSMRPRIKDGEYVVLEPNQPINPGDEVLVKAKDGR 279

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           ++ K  +      I L+S N  +   +VE ++IE +  + W
Sbjct: 280 VMVKEFVYEAQGKIFLLSTNEAHGKISVERANIEHMHYVGW 320


>gi|26990601|ref|NP_746026.1| Cro/CI family transcriptional regulator [Pseudomonas putida KT2440]
 gi|24985584|gb|AAN69490.1|AE016583_14 transcriptional regulator, Cro/CI family [Pseudomonas putida
           KT2440]
          Length = 215

 Score = 81.5 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 75/214 (35%), Gaps = 30/214 (14%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I       NLT   LA + G+D TS +  +R   +G      T  I +I +    +   L
Sbjct: 7   IKAARAHANLTQGQLATQVGMDQTSISNLERGKSQG------TSYIAQIASVCGVSALWL 60

Query: 73  LDLPFS---------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
            +   S          G       + I ++     G+ G++          W        
Sbjct: 61  AEGTGSMLHSVSNVMPGPPIISPTRRIEIVGTAQLGNDGYW--VGLDVAEGWVET----- 113

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            S     YA+       + +  SM P  R G I +     ++  G+ +++    G  + K
Sbjct: 114 WSRDEDAYAL-------RLKGDSMAPAIRSGWIAVCEPNHRLVPGEYVMVTTVDGQSMVK 166

Query: 184 VLISRRGRSIDLMSLNCCY-PVDTVEMSDIEWIA 216
            L+      ++L S+N  Y     +  +DIE I 
Sbjct: 167 ELLFENEEGVNLASVNAAYGERRVIAWADIEKIH 200


>gi|171911475|ref|ZP_02926945.1| putative phage repressor [Verrucomicrobium spinosum DSM 4136]
          Length = 261

 Score = 78.8 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 19/139 (13%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
           P  +        + IPL+ +  +G G + D         +    V    +  +  +A   
Sbjct: 122 PQVETTKGVGPARYIPLIGYSQAGIGNYED--------LYEHESVIAFGTTDSKAFA--- 170

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK---PRTGDIVAKVLISR-RGR 191
                + +  SM P Y +GDIL ++       GD +L K      GD++ K+  SR  G+
Sbjct: 171 ----TRLRGDSMEPKYSEGDILYVSPNATPKNGDIVLAKVDEAHGGDVMCKLYSSRDGGK 226

Query: 192 SIDLMSLNCCYPVDTVEMS 210
           +I L S N  YP      S
Sbjct: 227 NIVLSSYNAAYPPMEFSRS 245


>gi|300918422|ref|ZP_07135020.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
 gi|300414397|gb|EFJ97707.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
          Length = 229

 Score = 78.8 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 69/209 (33%), Gaps = 35/209 (16%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
             AE   ++P+ L++  G +      S R   +   R        KI  A +     L  
Sbjct: 29  AFAELCGISPAQLSQLLGGN------SHRNIGDKMAR--------KIEQALDRPFGWLDS 74

Query: 75  LPFSDGR-------TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
              + G            +   +P++     G  G  D         W  +         
Sbjct: 75  PHNAPGSIKSELEYVGSVRPGAVPVVGEAILGIDGMIDM--LEIHAGWLQI--------- 123

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
              Y+        K +  SM P  + G+ +++    QV+ GD + ++ + G  + K++  
Sbjct: 124 ---YSADRDAYGLKVKGDSMWPRIQSGEYVVIEPNTQVHTGDEVFVRTKDGHNMIKIMSK 180

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
            R       S+N  +   T+    IE + 
Sbjct: 181 TRDGDYQFSSVNSDHRPITLSPDSIEKMH 209


>gi|324114073|gb|EGC08046.1| peptidase S24 [Escherichia fergusonii B253]
          Length = 189

 Score = 78.4 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 51/144 (35%), Gaps = 14/144 (9%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
                        +   +P++     G  G  D   F +G  W              IY+
Sbjct: 40  AGATDHLEFAGNVRAGFVPVIGEAVLGVDGSVDMIEFRSG--W------------LSIYS 85

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                   K +  SM P  + G+ +++     V+ GD + ++ + G  + K++   R   
Sbjct: 86  GDKDAYGLKVKGDSMWPRIQSGEYVVIEPNTPVHPGDEVFVRTKDGHNMIKIMNKTRDGD 145

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIA 216
               S+N  +   T+ + +++ + 
Sbjct: 146 YQFSSINSDHRPITLPVEEVDKMH 169


>gi|237704871|ref|ZP_04535352.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226901237|gb|EEH87496.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|315288265|gb|EFU47664.1| peptidase S24-like domain protein [Escherichia coli MS 110-3]
          Length = 228

 Score = 77.7 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 51/144 (35%), Gaps = 14/144 (9%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
                        +   +P++     G  G  D   F +G  W              IY+
Sbjct: 79  AGATDHLEFAGNVRAGFVPVIGEAVLGVDGSVDMIEFRSG--W------------LSIYS 124

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                   K +  SM P  + G+ +++     V+ GD + ++ + G  + K++   R   
Sbjct: 125 GDKDAYGLKVKGDSMWPRIQSGEYVVIEPNTPVHPGDEVFVRTKDGHNMIKIMNKTRDGD 184

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIA 216
               S+N  +   T+ + +++ + 
Sbjct: 185 YQFSSINSDHRPITLPVEEVDKMH 208


>gi|113461549|ref|YP_719618.1| repressor protein [Haemophilus somnus 129PT]
 gi|112823592|gb|ABI25681.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 211

 Score = 77.3 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 67/180 (37%), Gaps = 20/180 (11%)

Query: 48  GRNRWPSTESIFKILAATNET--ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
           GR R P+   + K+L AT     I                K+  + ++     G+ G  D
Sbjct: 40  GR-RSPNFMEVAKMLNATGTDQVILNSDGTIEDIEFIGIPKKGLVKVIGEATMGTDGSVD 98

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
                 G         +I +     + +       + + +SM P    G+ +++      
Sbjct: 99  IEEIHVG-------YIDIFTTDPKAFCL-------RVKGSSMEPRIHSGEFVLVEPQSPF 144

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARILWAS 222
           + GD + I+ + G  + K+L  ++       S+N  +    + + ++E   ++A IL  S
Sbjct: 145 SNGDDVFIRTKDGKNMIKILDYQKDGEYRFSSINNDHKPFNLAIDEVELVYYVAGILKKS 204


>gi|110633546|ref|YP_673754.1| putative phage repressor [Mesorhizobium sp. BNC1]
 gi|110284530|gb|ABG62589.1| putative phage repressor [Chelativorans sp. BNC1]
          Length = 230

 Score = 76.9 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 87/216 (40%), Gaps = 24/216 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRN-RWPSTESIFKILAATN 66
            I E ID       LT S  A+ AGL  ++    +R    G+     ST ++ K+     
Sbjct: 4   DILERIDERLAEVGLTESRAAKMAGLSDSAIRDMRRAVKSGKEDAGVSTRTLAKLAPVLQ 63

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   LL      G     + + +P++ +  +G+             ++  V  PE    
Sbjct: 64  TSAEWLL-----TGGPEGIRSRTVPIMGYLGAGAE---------VEPEYEQVP-PEGLDQ 108

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI--QVNC--GDRLLIKPRTGDIVA 182
            +  +++  +    K +  SMLP+Y+ G ++I+ S     ++   G+   ++   G    
Sbjct: 109 VDVPFSVPDEMIAFKVRGDSMLPVYKDGAVIIVYSEQKKPLHSFYGEEAAVRTSDGRRFI 168

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           K ++     +++L+S N       +E   +EWI  I
Sbjct: 169 KTIMRGPDDTVNLLSHNASP----IEGVRLEWIGEI 200


>gi|209552478|ref|YP_002284393.1| putative repressor cI [Pseudomonas phage PAJU2]
 gi|209528751|dbj|BAG75043.1| putative repressor cI [Pseudomonas phage PAJU2]
          Length = 234

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 78/203 (38%), Gaps = 22/203 (10%)

Query: 27  LARKAGLDPTSFNKSKRFGIE-GRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           L++++G+  ++ ++  R   + G +   + ++I ++    +  +     L          
Sbjct: 41  LSKRSGVAQSTISRIVRGDSDTGVD---TLDAIARVFKVDSSDLVD-AGLIDKLQGQNTN 96

Query: 86  KEKE------IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
            +        +PL+ +  +   G F   +           +P         +A+      
Sbjct: 97  IKGTSGLTDPVPLISWVQA---GMFTEAIDNFAPGDAEELLPCPFPHSERSFAL------ 147

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
            +    SMLP YR G+I++++  +    G  ++++   G    K +         LM+LN
Sbjct: 148 -RVHGESMLPDYRDGEIILVDPDLAYKHGSDVVVRTPDGSTTFKRIQ-ITQDGTYLMALN 205

Query: 200 CCYPVDTVEMSDIEWIARILWAS 222
             +P   +E+ +   I  ++ AS
Sbjct: 206 PSFPSRYIEIPEDTRICGVVIAS 228


>gi|160898658|ref|YP_001564240.1| putative phage repressor [Delftia acidovorans SPH-1]
 gi|160364242|gb|ABX35855.1| putative phage repressor [Delftia acidovorans SPH-1]
          Length = 236

 Score = 74.2 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 11/133 (8%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
               + ++ +IP++     G  GF++              +P     +   Y+       
Sbjct: 97  AGYPKHQKSKIPVVGTAKMGDDGFYEEFS----------AIPGAGDGYVEHYSDDKSAYC 146

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
            + +  SM P  R G  +I+      + G+ +LIK   G  + K  + RR  SI+LMS+N
Sbjct: 147 LRVKGMSMFPAIRDGWYVIVEPNSNPSEGEYVLIKKSDGRRMVKEFLFRRSGSIELMSVN 206

Query: 200 CCYPVDTVEMSDI 212
                 T+EM +I
Sbjct: 207 GG-ARLTLEMHEI 218


>gi|218460494|ref|ZP_03500585.1| putative phage-related transcriptional regulator protein
          [Rhizobium etli Kim 5]
          Length = 36

 Score = 73.8 bits (180), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/36 (80%), Positives = 34/36 (94%)

Query: 3  SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSF 38
            SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSF
Sbjct: 1  MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSF 36


>gi|171915361|ref|ZP_02930831.1| phage repressor [Verrucomicrobium spinosum DSM 4136]
          Length = 283

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 57/181 (31%), Gaps = 36/181 (19%)

Query: 58  IFKILAATNETICQLLDLPFS------------------DGRTTEKKEKEIPLLYFPPSG 99
           I K+  A +     L+                       +     K  + +PL+ F  +G
Sbjct: 103 IKKVATALDVPFEDLMQGVEPGFIDESGLTGTLGASPNVELGPGIKTARYVPLISFAQAG 162

Query: 100 SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
             G ++   +               + H        +      +  SM+P+   GD+ IL
Sbjct: 163 KMGSWEDAAY-------------EYTGHIAFDMTDPKAFGVTIRGDSMVPVINDGDVAIL 209

Query: 160 NSAIQVNCGDRLLIKP---RTGDIVAKVLISRRGRS-IDLMSLNCC-YPVDTVEMSDIEW 214
             +     G+ ++ +      G ++ KV   +   + + L S N   +P       D  W
Sbjct: 210 VPSSAPRGGEVVVARLSEEAGGGVMCKVYTPKDAGAKVVLTSYNSAVHPPLEFRREDFVW 269

Query: 215 I 215
           +
Sbjct: 270 L 270


>gi|301381627|ref|ZP_07230045.1| Cro/CI family transcriptional regulator [Pseudomonas syringae pv.
           tomato Max13]
          Length = 232

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 55/143 (38%), Gaps = 18/143 (12%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
           F  G       + I ++     G  G++      T + W         S     YA+   
Sbjct: 91  FEVGPPITSPTRRIAIVGTAQLGPDGYW--AGLDTTDGWVET-----WSRDEDAYAL--- 140

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
               + +  SM P  R G + +   + ++  G+ +++K   G  + K L+      + LM
Sbjct: 141 ----RLKGDSMAPAIRSGWVAVCEPSHRLVPGEYVMVKLCDGQSMVKELLFETEDGVSLM 196

Query: 197 SLNCCYPVD-TVEMSDIEWIARI 218
           S+N  Y    T+  SDIE   RI
Sbjct: 197 SVNSAYGERTTLSWSDIE---RI 216


>gi|323190855|gb|EFZ76122.1| peptidase S24-like family protein [Escherichia coli RN587/1]
          Length = 234

 Score = 73.0 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 73/209 (34%), Gaps = 22/209 (10%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
           A++  ++PS L + +G       KS R   +          + +   A        LDL 
Sbjct: 30  ADKLGVSPSQLTQVSG------EKSTRNIGD---------KLARKFEAALGLPNGWLDLV 74

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
                     +  +  +     G        +         + + E R     IY+    
Sbjct: 75  HDVTPIASCSD-SLTFVGQVRKGLVRVVGEAILGVDGA---IEMTEERDGWLNIYSDDPD 130

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
               + +  SM P  + G+ +++    +V  GD + ++   G  + KVL   R       
Sbjct: 131 AFGLRVKGDSMWPRIKSGEYVLIEPNTKVFPGDEVFVRTVEGHNMIKVLGYDRDGEYQFT 190

Query: 197 SLNCCYPVDTVE---MSDIEWIARILWAS 222
           S+N  +   T+    ++ +E++A IL  S
Sbjct: 191 SINQDHRPITLPYHQVAKVEYVAGILKQS 219


>gi|157166008|ref|YP_001449260.1| putative repressor protein CI [Phage BP-4795]
 gi|260854732|ref|YP_003228623.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|7239814|gb|AAD04644.2| cI protein [Enterobacteria phage H-19B]
 gi|49523607|emb|CAD88825.1| putative repressor protein CI [Enterobacteria phage BP-4795]
 gi|257753381|dbj|BAI24883.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|282935423|gb|ADB03775.1| putative repressor CI [Enterobacteria phage ST2-8624]
 gi|323157451|gb|EFZ43562.1| peptidase S24-like family protein [Escherichia coli EPECa14]
          Length = 234

 Score = 73.0 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 73/209 (34%), Gaps = 22/209 (10%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
           A++  ++PS L + +G       KS R   +          + +   A        LDL 
Sbjct: 30  ADKLGVSPSQLTQVSG------EKSTRNIGD---------KLARKFEAALGLPNGWLDLV 74

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
                     +  +  +     G        +         + + E R     IY+    
Sbjct: 75  HDVTPIASCSD-SLTFVGQVRKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPD 130

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
               + +  SM P  + G+ +++    +V  GD + ++   G  + KVL   R       
Sbjct: 131 AFGLRVKGDSMWPRIKSGEYVLIEPNTKVFPGDEVFVRTVEGHNMIKVLGYDRDGEYQFT 190

Query: 197 SLNCCYPVDTVE---MSDIEWIARILWAS 222
           S+N  +   T+    ++ +E++A IL  S
Sbjct: 191 SINQDHRPITLPYHQVAKVEYVAGILKQS 219


>gi|213970585|ref|ZP_03398712.1| transcriptional regulator, Cro/CI family [Pseudomonas syringae pv.
           tomato T1]
 gi|213924756|gb|EEB58324.1| transcriptional regulator, Cro/CI family [Pseudomonas syringae pv.
           tomato T1]
          Length = 218

 Score = 72.7 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 55/143 (38%), Gaps = 18/143 (12%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
           F  G       + I ++     G  G++      T + W         S     YA+   
Sbjct: 77  FEVGPPITSPTRRIAIVGTAQLGPDGYW--AGLDTTDGWVET-----WSRDEDAYAL--- 126

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
               + +  SM P  R G + +   + ++  G+ +++K   G  + K L+      + LM
Sbjct: 127 ----RLKGDSMAPAIRSGWVAVCEPSHRLVPGEYVMVKLCDGQSMVKELLFETEDGVSLM 182

Query: 197 SLNCCYPVD-TVEMSDIEWIARI 218
           S+N  Y    T+  SDIE   RI
Sbjct: 183 SVNSAYGERTTLSWSDIE---RI 202


>gi|324114308|gb|EGC08278.1| peptidase S24 [Escherichia fergusonii B253]
          Length = 235

 Score = 71.9 bits (175), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 30  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 83

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E  +  +     G        +         + + E R     IY+        + +  
Sbjct: 84  DEDTLSFVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 140

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + K+L   R       S+N  +   
Sbjct: 141 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTVEGHNMIKILGYDRDGEYQFTSINQDHRPI 200

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 201 TLPYHQVAKVEYVAGILKQS 220


>gi|253991045|ref|YP_003042401.1| hypothetical protein PAU_03571 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782495|emb|CAQ85659.1| Hypothetical Protein PAU_03571 [Photorhabdus asymbiotica]
          Length = 228

 Score = 71.9 bits (175), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 72/214 (33%), Gaps = 27/214 (12%)

Query: 14  DRMA---ERHNLTPSG----LARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           DR+A   ++  L   G    +A+  G+ P +   SK         W + ES+ +   AT 
Sbjct: 13  DRLALACKKFGLDEHGRGVAIAKALGVTPKA--ASK---------WFNAESLPR--QATM 59

Query: 67  ETICQLLDLPFS----DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           + I   L +  +           ++ ++        G        +       + V    
Sbjct: 60  KGIADYLRVDLAWLQLGIVKNADEQGKVEYAGKLKDGLVRVVGEAILGIDGAVDMVEFHA 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                             K +  SM P  + G+ +++     V+ GD + ++ R G  + 
Sbjct: 120 GWLRICSS---DRDAYGLKVKGDSMWPRIQSGEFVVIEPNTLVHPGDEVFVRTRNGHNMI 176

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
           K++   R       S+N  +   T+   D+  I 
Sbjct: 177 KIMNITRNGDYQFSSINSDHRPITIPKDDVAMIH 210


>gi|9632491|ref|NP_049485.1| repressor protein CI [Enterobacteria phage 933W]
 gi|15800947|ref|NP_286963.1| putative repressor protein CI of bacteriophage BP-933W [Escherichia
           coli O157:H7 EDL933]
 gi|20065916|ref|NP_612999.1| CI protein [Stx2 converting phage I]
 gi|116222055|ref|YP_794110.1| repressor protein CI [Stx2-converting phage 86]
 gi|168748269|ref|ZP_02773291.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|168758909|ref|ZP_02783916.1| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|168772853|ref|ZP_02797860.1| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|168780276|ref|ZP_02805283.1| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|168788900|ref|ZP_02813907.1| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|170783635|ref|YP_001648917.1| repressor protein CI [Enterobacteria phage Min27]
 gi|195938673|ref|ZP_03084055.1| hypothetical protein EscherichcoliO157_19988 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808906|ref|ZP_03251243.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208811918|ref|ZP_03253247.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208821053|ref|ZP_03261373.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|209398778|ref|YP_002271815.1| repressor protein CI [Escherichia coli O157:H7 str. EC4115]
 gi|254794287|ref|YP_003079124.1| putative repressor protein CI [Escherichia coli O157:H7 str.
           TW14359]
 gi|260847212|ref|YP_003224990.1| phage repressor protein CI [Escherichia coli O103:H2 str. 12009]
 gi|260867233|ref|YP_003233635.1| putative repressor protein [Escherichia coli O111:H- str. 11128]
 gi|261227993|ref|ZP_05942274.1| putative repressor protein CI [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258715|ref|ZP_05951248.1| putative repressor protein [Escherichia coli O157:H7 str. FRIK966]
 gi|300940488|ref|ZP_07155062.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|331645938|ref|ZP_08347041.1| putative repressor protein CI of bacteriophage [Escherichia coli
           M605]
 gi|4585402|gb|AAD25430.1|AF125520_25 repressor protein CI [Enterobacteria phage 933W]
 gi|12514300|gb|AAG55574.1|AE005295_14 putative repressor protein CI of bacteriophage BP-933W [Escherichia
           coli O157:H7 str. EDL933]
 gi|19911708|dbj|BAB87968.1| CI protein [Stx2 converting phage I]
 gi|115500865|dbj|BAF34095.1| repressor protein CI [Stx2-converting phage 86]
 gi|145312373|gb|ABP57827.1| repressor Cl [Enterobacteria phage phi24B]
 gi|163955729|gb|ABY49879.1| repressor protein CI [Enterobacteria phage Min27]
 gi|187771028|gb|EDU34872.1| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|188017192|gb|EDU55314.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|189002185|gb|EDU71171.1| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|189354375|gb|EDU72794.1| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|189371399|gb|EDU89815.1| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|208728707|gb|EDZ78308.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208733195|gb|EDZ81882.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208741176|gb|EDZ88858.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|209160178|gb|ACI37611.1| repressor protein CI [Escherichia coli O157:H7 str. EC4115]
 gi|254593687|gb|ACT73048.1| putative repressor protein CI [Escherichia coli O157:H7 str.
           TW14359]
 gi|257762359|dbj|BAI33856.1| phage repressor protein CI [Escherichia coli O103:H2 str. 12009]
 gi|257763589|dbj|BAI35084.1| putative repressor protein [Escherichia coli O111:H- str. 11128]
 gi|282935426|gb|ADB03777.1| putative repressor CI [Enterobacteria phage 32deltatox]
 gi|282935429|gb|ADB03779.1| putative repressor CI [Enterobacteria phage 27deltatox]
 gi|282935432|gb|ADB03781.1| putative repressor CI [Enterobacteria phage 22deltatox]
 gi|300454719|gb|EFK18212.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|315619731|gb|EFV00251.1| helix-turn-helix family protein [Escherichia coli 3431]
 gi|331044690|gb|EGI16817.1| putative repressor protein CI of bacteriophage [Escherichia coli
           M605]
          Length = 235

 Score = 71.5 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 30  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 83

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E  +  +     G        +         + + E R     IY+        + +  
Sbjct: 84  DEDTLSFVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 140

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + KVL   R       S+N  +   
Sbjct: 141 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTVEGHNMIKVLGYDRDGEYQFTSINQDHRPI 200

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 201 TLPYHQVAKVEYVAGILKQS 220


>gi|170768934|ref|ZP_02903387.1| CI protein [Escherichia albertii TW07627]
 gi|170122006|gb|EDS90937.1| CI protein [Escherichia albertii TW07627]
          Length = 250

 Score = 71.5 bits (174), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 45  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 98

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E  +  +     G        +         + + E R     IY+        + +  
Sbjct: 99  DEDTLSFVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 155

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + K+L   R       S+N  +   
Sbjct: 156 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTIEGHNMIKILGYDRDGEYQFTSINQDHRPI 215

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 216 TLPYHQVAKVEYVAGILKQS 235


>gi|218549402|ref|YP_002383193.1| repressor protein of bacteriophage origin [Escherichia fergusonii
           ATCC 35469]
 gi|218356943|emb|CAQ89575.1| repressor protein of bacteriophage origin [Escherichia fergusonii
           ATCC 35469]
          Length = 235

 Score = 71.5 bits (174), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 30  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 83

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E  +  +     G        +         + + E R     IY+        + +  
Sbjct: 84  DEDTLSFVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 140

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + K+L   R       S+N  +   
Sbjct: 141 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTIEGHNMIKILGYDRDGEYQFTSINQDHRPI 200

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 201 TLPYHQVAKVEYVAGILKQS 220


>gi|301019520|ref|ZP_07183686.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
 gi|299882171|gb|EFI90382.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
          Length = 229

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 24  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 77

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E  +  +     G        +         + + E R     IY+        + +  
Sbjct: 78  DEDTLSFVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 134

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + KVL   R       S+N  +   
Sbjct: 135 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTVEGHNMIKVLGYDRDGEYQFTSINQDHRPI 194

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 195 TLPYHQVAKVEYVAGILKQS 214


>gi|221196208|ref|ZP_03569255.1| phage repressor [Burkholderia multivorans CGD2M]
 gi|221202882|ref|ZP_03575901.1| phage repressor [Burkholderia multivorans CGD2]
 gi|221176816|gb|EEE09244.1| phage repressor [Burkholderia multivorans CGD2]
 gi|221182762|gb|EEE15162.1| phage repressor [Burkholderia multivorans CGD2M]
          Length = 230

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 56/145 (38%), Gaps = 21/145 (14%)

Query: 81  RTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
              +   + +PL+    +G      D   FP G  +  +         +  +A++     
Sbjct: 89  APAQVGSRRVPLISSVQAGRMTEAVDP--FPPGGAFEYLL--TDLDLSDYAFALE----- 139

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG-----RSID 194
              +  SM P +  GD +I++ AIQ   GD ++ K    +   K   +R        + +
Sbjct: 140 --IEGLSMAPDFNPGDRIIIDPAIQPRPGDFVVAKNGREEATFKKYRARGVGADGREAFE 197

Query: 195 LMSLNCCYPVDTVEMSDIEWIARIL 219
           L+ LN  YP  + E   +    RI+
Sbjct: 198 LIPLNPDYPTISSEHEQV----RII 218


>gi|161504556|ref|YP_001571668.1| hypothetical protein SARI_02669 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865903|gb|ABX22526.1| hypothetical protein SARI_02669 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 236

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 73/200 (36%), Gaps = 11/200 (5%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    LD +S   SK F  E   R     ++   L         +     S  ++T  
Sbjct: 30  GIAIARALDVSSKGVSKWFNAESLPRQEKMNALANFLKV-----DVVWLQHGSVRQSTTT 84

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
             + +  +     G        +         + + E R     IY+   +    + +  
Sbjct: 85  DPQSLTFVGQLRKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPEAFGLRVKGD 141

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + KVL   R       S+N  +   
Sbjct: 142 SMWPRIKSGEYVLIEPNTKVCPGDEVFVRTIEGHNMIKVLGYDRDGEYQFTSINQDHRPI 201

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    +S +E++A IL  S
Sbjct: 202 TLPYYEVSKVEYVAGILKQS 221


>gi|215485810|ref|YP_002328241.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218704626|ref|YP_002412145.1| repressor protein of bacteriophage origin [Escherichia coli UMN026]
 gi|293404507|ref|ZP_06648501.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298380285|ref|ZP_06989890.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|300896678|ref|ZP_07115193.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
 gi|215263882|emb|CAS08220.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218431723|emb|CAR12605.1| repressor protein of bacteriophage origin [Escherichia coli UMN026]
 gi|291429093|gb|EFF02118.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298279983|gb|EFI21491.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|300359470|gb|EFJ75340.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
          Length = 235

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 70/200 (35%), Gaps = 12/200 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           G+A    L  +S   SK F  E   R     ++ K L         ++ L          
Sbjct: 30  GMAIARALSLSSKGVSKWFNAESLPRQEKMNALAKFLNV------DVVWLQHGTSLNGAN 83

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
            E    ++     G        +         + + E R     IY+        + +  
Sbjct: 84  DEDTFSIVGKLKKGLVRVVGEAILGVDGA---IEMTEERDGWLKIYSDDPDAFGLRVKGD 140

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  + G+ +++    +V  GD + ++   G  + KVL   R       S+N  +   
Sbjct: 141 SMWPRIKSGEYVLIEPNTKVFPGDEVFVRTIEGHNMIKVLGYDRDGEYQFTSINQDHRPI 200

Query: 206 TVE---MSDIEWIARILWAS 222
           T+    ++ +E++A IL  S
Sbjct: 201 TLPYHQVAKVEYVAGILKQS 220


>gi|299529267|ref|ZP_07042709.1| peptidase S24, S26A and S26B [Comamonas testosteroni S44]
 gi|298722745|gb|EFI63660.1| peptidase S24, S26A and S26B [Comamonas testosteroni S44]
          Length = 120

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
             Q    + +  SM P YR G+ +++  +I+   G  +++K   G  + K L   RG  I
Sbjct: 25  DPQAYALRIKGDSMHPRYRAGEFVVVTPSIEAQPGRDVVVKLHDGKCLLKELNWIRGDEI 84

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARI 218
            L+S+N  Y   T+   D+E + R+
Sbjct: 85  QLLSINNGYAPMTISKEDVECVCRV 109


>gi|85374557|ref|YP_458619.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
 gi|84787640|gb|ABC63822.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
          Length = 220

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 51/136 (37%), Gaps = 11/136 (8%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
            IP L    +   G F     P    ++  G        +G        +    +  SM 
Sbjct: 91  AIPRLSIAVAAGPGQFAGDESP----FDNFGFSGRWLRDHGFD--PKMLSSVTVEGDSME 144

Query: 149 PLYRKGDILIL--NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT 206
           PL R GD +++  +    +  G  ++       ++ K L       I L+S N  YP   
Sbjct: 145 PLLRDGDEILVDRSPG-PLRDGIHVV--RLGETLMVKRLSRSGQGRISLLSQNLAYPPLD 201

Query: 207 VEMSDIEWIARILWAS 222
           + + D+E I R++W S
Sbjct: 202 MALEDVEVIGRVVWKS 217


>gi|190149742|ref|YP_001968267.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|307263053|ref|ZP_07544675.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|189914873|gb|ACE61125.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|306871679|gb|EFN03401.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 225

 Score = 70.4 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 68/177 (38%), Gaps = 11/177 (6%)

Query: 48  GRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
           GR R P+ + + K+L            +  SDG  T     E+ ++  P     G     
Sbjct: 40  GR-RTPNFDDVAKMLNVVGVD----QVILNSDGLITTLDNDELEIIGKPK---DGIIPVV 91

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
              T  +  TV + E+R+ +  +Y+        + + +SM P  + G+ +++        
Sbjct: 92  GEATMGRDETVRLEELRTGYINLYSADPDAYAVRGKGSSMEPRIKSGEYIVIEPNTPPMN 151

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RILWA 221
           GD +LI    G  + K L   R       S+N  +    +  +++  I     I+ A
Sbjct: 152 GDDVLICTIAGQYMIKTLDWHRDGEYRFSSINNAHQPFNLPENEVVNIHTVGAIVKA 208


>gi|307251335|ref|ZP_07533252.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306856641|gb|EFM88780.1| LexA repressor [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 225

 Score = 70.4 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 68/177 (38%), Gaps = 11/177 (6%)

Query: 48  GRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
           GR R P+ + + K+L            +  SDG  T     E+ ++  P     G     
Sbjct: 40  GR-RTPNFDDVAKMLNVVGVD----QVILNSDGLITTLDNDELEIIGKPK---DGIIPVV 91

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
              T  +  TV + E+R+ +  +Y+        + + +SM P  + G+ +++        
Sbjct: 92  GEATMGRDETVRLEELRTGYINLYSADPDAYAVRGKGSSMEPRIKSGEYIVIEPNTPPMN 151

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RILWA 221
           GD +LI    G  + K L   R       S+N  +    +  +++  I     I+ A
Sbjct: 152 GDDVLICTIAGQYMIKTLDWHRDGEYRFSSINNSHQPFNLPENEVVNIHTVGAIVKA 208


>gi|227356913|ref|ZP_03841292.1| repressor protein CI [Proteus mirabilis ATCC 29906]
 gi|227162983|gb|EEI47928.1| repressor protein CI [Proteus mirabilis ATCC 29906]
          Length = 213

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 55/154 (35%), Gaps = 6/154 (3%)

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           + +   +P     T + ++ E+  +   PSG                + +      S   
Sbjct: 46  LERDYGMPIGYLDTQDIQDDEVEFIGKIPSGLVKVRGEAFLGVDGAVDMIE---AHSGWL 102

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            IY+        K +  SM P  + G+ +++     V  GD + ++   G  + K+    
Sbjct: 103 KIYSDDVDAYGLKVKGDSMWPRIQSGEYVVVEPNTSVKTGDEVFVRTIDGHNMIKIFNKT 162

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIE---WIARIL 219
           R       S+N  +   T+    ++   ++A I+
Sbjct: 163 RDGDYQFTSINNSHKPITLSPDQVDTIHYVAAIV 196


>gi|325529755|gb|EGD06606.1| putative phage repressor [Burkholderia sp. TJI49]
          Length = 212

 Score = 69.2 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 56/144 (38%), Gaps = 21/144 (14%)

Query: 82  TTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
             +   + +PL+    +G      D   FP G  +  +         +  +A++      
Sbjct: 72  PAQVGSRRVPLISSVQAGRMTEAVDP--FPPGGAFEYLL--TDLDLSDYAFALE------ 121

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG-----RSIDL 195
             +  SM P +  GD +I++ AIQ   GD ++ K    +   K   +R        + +L
Sbjct: 122 -IEGLSMAPDFNPGDRIIIDPAIQPRPGDFVVAKNGREEATFKKYRARGVGADGREAFEL 180

Query: 196 MSLNCCYPVDTVEMSDIEWIARIL 219
           + LN  YP  + E   +    RI+
Sbjct: 181 IPLNPDYPTISSEHERV----RII 200


>gi|212499706|ref|YP_002308514.1| cI [Bacteriophage APSE-2]
 gi|211731675|gb|ACJ10163.1| cI [Bacteriophage APSE-2]
          Length = 232

 Score = 69.2 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 10/124 (8%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+L     G GG+++S     G+ +  +  P   +     +A+       + Q  SM+P
Sbjct: 102 VPVLGTTQLGGGGYWNSKESSAGHDYGYIIWP---TEDRDAFAL-------RCQGESMMP 151

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N  +P   +  
Sbjct: 152 RIQHGEFVVMEPNHKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAA 211

Query: 210 SDIE 213
           S IE
Sbjct: 212 STIE 215


>gi|238898738|ref|YP_002924420.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466498|gb|ACQ68272.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 260

 Score = 68.8 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 10/124 (8%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+L     G GG+++S     G+ +  +  P   +     +A+       + Q  SM+P
Sbjct: 130 VPVLGTTQLGGGGYWNSKESSAGHDYGYIIWP---TEDRDAFAL-------RCQGESMMP 179

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N  +P   +  
Sbjct: 180 RIQHGEFVVMEPNHKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAA 239

Query: 210 SDIE 213
           S IE
Sbjct: 240 STIE 243


>gi|171910721|ref|ZP_02926191.1| hypothetical protein VspiD_06095 [Verrucomicrobium spinosum DSM
           4136]
          Length = 407

 Score = 68.8 bits (167), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 62/192 (32%), Gaps = 22/192 (11%)

Query: 43  RFGIE--GRNRWPSTESIFKILAATNETICQL-----LDLPFSDGRTTEKKEKEIPLLYF 95
           R   +  G+ R    E + +  A     +  L       L  S G    +  +  P    
Sbjct: 210 RQNADLNGKPR--DVEPVSRGFAIAGAALETLSRAQIASLQNSGGAHAAQPTRLTPRASG 267

Query: 96  PPSGSGGFFDSGVFPTGNKWNTVGVPEI------RSPHNGIYAIQTQDTRHKTQDTSMLP 149
               +   F +   P         +P           H        Q    +    +M P
Sbjct: 268 VQVEAP-VFSARSVPLLAMHEAADLPTPAVAAHHGRQHLAFVVEDEQAFAVRINGEAMAP 326

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS-----RRGRSIDLMSLNCCYPV 204
            Y +G I I+   +    GD +L + R  +     ++      + G S+ L S +  YP 
Sbjct: 327 HYPEGCIAIICPGLPSRNGDLVLARLRD-ERGGGTILRLVHFIQDGESLVLTSTHAAYPP 385

Query: 205 DTVEMSDIEWIA 216
            TV+  D+ W+A
Sbjct: 386 LTVQKEDLLWLA 397


>gi|222875118|gb|EEF12249.1| predicted protein [Populus trichocarpa]
          Length = 220

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 37/84 (44%)

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I+    +    + + +SM P    G+ +++      + GD + I+ + G  + K+L  ++
Sbjct: 19  IFTTDPKAFCLRVKGSSMEPRIHSGEFVLVEPQSPFSNGDDVFIRTKDGKNMIKILDYQK 78

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIE 213
                  S+N  +    + + ++E
Sbjct: 79  DGEYRFSSINNDHKPFNLAIDEVE 102


>gi|296282441|ref|ZP_06860439.1| putative transcriptional regulator, repressor [Citromicrobium
           bathyomarinum JL354]
          Length = 231

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 54/134 (40%), Gaps = 7/134 (5%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
            IP L    +   G F +G  P    ++  G        NG        +    +  SM 
Sbjct: 102 AIPRLSLAAAAGPGQFANGEAP----FDNFGFSGRWLRENGFD--PKMLSALTVEGDSME 155

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
           PL R GD ++++   +    D + +      ++ K L S     I L+S N  YP   V 
Sbjct: 156 PLLRHGDEILIDRGSRFER-DGVHVVRMGDTLMVKRLASAGAGRIALLSQNLAYPPVEVG 214

Query: 209 MSDIEWIARILWAS 222
           + +IE + R++W S
Sbjct: 215 LDEIEVLGRVVWKS 228


>gi|330816008|ref|YP_004359713.1| putative phage repressor [Burkholderia gladioli BSR3]
 gi|327368401|gb|AEA59757.1| putative phage repressor [Burkholderia gladioli BSR3]
          Length = 249

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 51/150 (34%), Gaps = 12/150 (8%)

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRS 125
            ++             + K  + + ++     G     +  G +P G          I  
Sbjct: 95  TSLSDTFSPSLLHYPVSSKNFRNVFVIGRAQGGLPERIWTDGGYPVG----------IAD 144

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
            +  I               SM P +  G+  ++  A + +  D +L++  +G  + K L
Sbjct: 145 EYAEIATADPHAFLVPVVGGSMAPRFNPGEFALIEPATEPDIEDDVLVRLASGVTMLKRL 204

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           +SRRG  I L S        T    +I W+
Sbjct: 205 LSRRGGMIRLGSY-AEAETHTFAPEEISWM 233


>gi|284007338|emb|CBA72703.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 232

 Score = 67.3 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 72/171 (42%), Gaps = 14/171 (8%)

Query: 56  ESIFKILAATNETIC-QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           E ++K L+ TN +           +         ++P+L     G GG+++S      + 
Sbjct: 67  ELLYKDLSTTNISEERDTTSFTRIELNAIPFNFCKVPVLGTTQLGGGGYWNSKESSIEHD 126

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           +  +  P   +     +A+       + Q  SM+P  + G+ +++    +   GD +L++
Sbjct: 127 YGYIVWP---TEDKDAFAL-------RCQGESMMPRIQHGEFVVMEPNYKYKPGDEVLVQ 176

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWAS 222
              G ++ K  + +R   I L+S+N  +P   +  S    I ++A I   S
Sbjct: 177 DDNGQVMVKTFLYQRDDVIHLLSINADHPPIRLAASTIKKIIYVAGIAKDS 227


>gi|319789030|ref|YP_004150663.1| transcriptional regulator, XRE family [Thermovibrio ammonificans
           HB-1]
 gi|317113532|gb|ADU96022.1| transcriptional regulator, XRE family [Thermovibrio ammonificans
           HB-1]
          Length = 222

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 47/215 (21%), Positives = 83/215 (38%), Gaps = 27/215 (12%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + ++ E   L+ S +A++ G+   ++ + ++ G +   R        + + AT     + 
Sbjct: 7   LRKLREHLGLSQSKMAKELGVSLKTYQRYEQVGYDIPER------ALRQIEATFNVNPEW 60

Query: 73  LDLPFSDG----------RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           L     +            T E   K IPL+    +G G F  + V P    W    VP 
Sbjct: 61  LRQGKGEMFRPKTEAQIIATPEFVVKPIPLIAEGEAGFGQFIPNLVEPDKVVW--FPVPT 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             + H   +         K    SM P   +GDI++++    V  GD +    + G +V 
Sbjct: 119 SLANHRLFF--------IKVVGNSMEPRIFEGDIVLVDKDATVGKGDLVAALLKDGTLVV 170

Query: 183 KVLISRRG-RSIDLMSLNCCYPVDTVEMSDIEWIA 216
           K      G  ++ L S+N  YP   V   ++  IA
Sbjct: 171 KRYWKNNGDGTVVLESINPSYPPIVVRPKELRDIA 205


>gi|37526812|ref|NP_930156.1| hypothetical protein plu2922 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786244|emb|CAE15296.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 212

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 47/135 (34%), Gaps = 14/135 (10%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
             + K   + ++     G  G  D   F  G  W  +             +        K
Sbjct: 74  AGKPKNGLVRVIGEAVLGIDGAVDMVEFHAG--WLRIC------------STDHDAYGLK 119

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC 201
            +  SM P  + G+ +++     V+ GD + ++   G  + K++   R       S+N  
Sbjct: 120 VKGDSMWPRIQSGEFVVIEPNTPVHPGDEVFVRTNNGHNMIKIMNITRNGDYQFSSINSD 179

Query: 202 YPVDTVEMSDIEWIA 216
           +   T+  +++  I 
Sbjct: 180 HRPITIPKNNVIMIH 194


>gi|9633604|ref|NP_050962.1| P1 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118052|gb|AAF04000.1|AF157835_57 P1 [Endosymbiont phage APSE-1]
          Length = 260

 Score = 66.5 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 61/136 (44%), Gaps = 13/136 (9%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+L     G GG+++      G+ +  +  P   +     +A+       + Q  SM+P
Sbjct: 130 VPVLGTTQLGGGGYWNPKESSAGHDYGYIIWP---TEDRDAFAL-------RCQGESMMP 179

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             + G+ +++    +   GD +L++   G ++ K  + +R   + L+S+N  +P   + +
Sbjct: 180 RIQHGEFVVMEPNYKYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAV 239

Query: 210 ---SDIEWIARILWAS 222
                I ++A I   S
Sbjct: 240 PTIEKIIYVAGIAKDS 255


>gi|304393973|ref|ZP_07375897.1| XRE family transcriptional regulator [Ahrensia sp. R2A130]
 gi|303293948|gb|EFL88324.1| XRE family transcriptional regulator [Ahrensia sp. R2A130]
          Length = 271

 Score = 66.5 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 65/169 (38%), Gaps = 26/169 (15%)

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-FDSGVFPTGNKWNTV 118
           K+     +            G T    + E+PL     +GS  + FD       +  + V
Sbjct: 119 KMAEVYGQAFGVSAAWIL-YGDTKNSLQGEVPLRGKVGAGSEVYVFDDD-----HPMDYV 172

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDIL-----ILNSAIQVNCGDRLLI 173
             P   + +    A++           SM P+Y    I+     + + ++ +N   R ++
Sbjct: 173 EAPPHATANTS--ALE-------VDGDSMFPVYEDRAIIYYSDNVTDPSVMLNK--RCVV 221

Query: 174 KPRTGDIVAKVLISRRGRSI-DLMSLNCCYPVDTVEMSDIEWIARILWA 221
           K   G I+ K L       + +L S N  +P  T+E   +EW+A+I W 
Sbjct: 222 KLANGRILVKKLRRGTTDELWNLDSFNPAFP--TMEDQIVEWVAKIDWV 268


>gi|319406695|emb|CBI80331.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 200

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 75/217 (34%), Gaps = 36/217 (16%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K I   +  +     L+   LA +  LD T    S         RW  +ES         
Sbjct: 3   KNIIATLQILQSEFGLSQKDLANR--LDVTQATVS---------RWLGSES-----DPRG 46

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                +L+L  S     +     +P++ +  +G     D    P  +    V +P     
Sbjct: 47  SHRDAILELYKSLKGYNQITT-LVPVMGYVGAGLEIDTDVEQIPE-DGLEKVEIP----- 99

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS--AIQVNC--GDRLLIKPRTGDIVA 182
               + +  +      + TSM P+Y+ GD++++       V+   GD +++         
Sbjct: 100 ----FDLPFEAIGFMVRGTSMYPVYKDGDLIVVKHLQTKPVSDYYGDEVVVLTEDNRRFI 155

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K +       I L S N       ++   I+WI  I+
Sbjct: 156 KQITR-SSEGIVLKSWNADP----IKNVKIKWIGEIV 187


>gi|253999361|ref|YP_003051424.1| putative phage repressor [Methylovorus sp. SIP3-4]
 gi|253986040|gb|ACT50897.1| putative phage repressor [Methylovorus sp. SIP3-4]
          Length = 226

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 45/215 (20%), Positives = 70/215 (32%), Gaps = 34/215 (15%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN----------- 66
           E    T + LA   G+   +   SK     G+    S E+I K+  A             
Sbjct: 13  EHQGKTQAWLAEFCGVSNNAV--SKWINGSGQI---SRENIRKVANALGLRASELLNTDT 67

Query: 67  -----ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGV 120
                    Q    P +      +K+   P+      G     F        N  +    
Sbjct: 68  DDSITVGFAQEFHFPENSYPVKPEKKGYPPVFGKGMGGLPDRIFTDEGR-VSNGHDEYAE 126

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                 +  +          + +  SM P Y  G+  ++         D +LIK  TG++
Sbjct: 127 VLSGDDNAFV---------IRVEGNSMFPKYAHGEYALVEPNTVPEIEDDVLIKLSTGEV 177

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           + K LISRRG  I L S N        + S+I W+
Sbjct: 178 MLKRLISRRGG-IHLSSYN-ESGTYDFQDSEIVWM 210


>gi|196233812|ref|ZP_03132651.1| putative phage repressor [Chthoniobacter flavus Ellin428]
 gi|196222174|gb|EDY16705.1| putative phage repressor [Chthoniobacter flavus Ellin428]
          Length = 311

 Score = 66.1 bits (160), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 48/135 (35%), Gaps = 14/135 (10%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
            +    +++PL+ +  +             G+  N     E          +  +    K
Sbjct: 179 PSTPGMRKVPLISWAAA-------------GSLHNASAFDEDYDGEAIETNVPGRVFSVK 225

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL-ISRRGRSIDLMSLNC 200
            +  SM P    GDI ++ S I+   G  +L++   GD+  K        R + L S+N 
Sbjct: 226 IEGDSMYPEINPGDIAVVRSDIEPRPGQVVLVRTLDGDVWCKRYSTRDGNRFVVLSSIND 285

Query: 201 CYPVDTVEMSDIEWI 215
            Y    +    I WI
Sbjct: 286 TYRPFEISAESIAWI 300


>gi|170023456|ref|YP_001719961.1| XRE family transcriptional regulator [Yersinia pseudotuberculosis
           YPIII]
 gi|169749990|gb|ACA67508.1| transcriptional regulator, XRE family [Yersinia pseudotuberculosis
           YPIII]
          Length = 209

 Score = 65.0 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 80/203 (39%), Gaps = 26/203 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG---IEGRNRWPSTES---IFK 60
           + I + I R  E  +++ + LA++ G    S     R G    + R    S E    + K
Sbjct: 2   ETIGQRIKRFREELSISQAELAQRCGWLSQS-----RIGNYETDSRK--VSVEDAVVLAK 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L   N    +L+     +   T   E+ +PL+ +  +G+  F +     +        V
Sbjct: 55  AL---NVNPGELILGTPDNASFTSAGERYLPLVSYVQAGT--FTEPDNLLSAEG-AKGHV 108

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                     +A+       K +  SM P +++GD +I++  +  + G+ ++ K    + 
Sbjct: 109 MYDGPISEVAFAL-------KIKGDSMEPEFKEGDTIIIDPMVAPHPGEFVIAKNGDHEA 161

Query: 181 VAKVLISRRGRSIDLMSLNCCYP 203
             K    +   S +L+ LN  YP
Sbjct: 162 TFKKYRLKANGSFELVPLNPDYP 184


>gi|160876037|ref|YP_001555353.1| XRE family transcriptional regulator [Shewanella baltica OS195]
 gi|160861559|gb|ABX50093.1| transcriptional regulator, XRE family [Shewanella baltica OS195]
          Length = 204

 Score = 65.0 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 71/205 (34%), Gaps = 24/205 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGR-NRWPSTESIFKILAATN 66
            I E + ++ +   +T   LA       TS  K +R   + +  R  + E++ K L  T 
Sbjct: 2   DIAERVRKLRKALGMTQYQLADLVSTAQTSIQKLER--GDTKNPR--NIEALAKALQTTP 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-GVPEIRS 125
           E   +       +          +PL+    +G               W  +  +P +  
Sbjct: 58  E-FLRFGVGDMDNATVVASAGNYLPLISMVQAGV--------------WTEIQELPPLDV 102

Query: 126 PHNGI-YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG-DIVAK 183
                           + +  SMLP +R GD++ ++   QV  G  ++ +         K
Sbjct: 103 ELYPCPIKCSQHSFIVRVEGESMLPDFRPGDLIYVDPDAQVENGSYVVARLDDENQATFK 162

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVE 208
            LI    +   L +LN  +P   VE
Sbjct: 163 QLIIDGNKKY-LKALNPDWPNKFVE 186


>gi|315268235|gb|ADT95088.1| transcriptional regulator, XRE family [Shewanella baltica OS678]
          Length = 204

 Score = 64.6 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 71/205 (34%), Gaps = 24/205 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGR-NRWPSTESIFKILAATN 66
            I E + R+ +   +T   LA       TS  K +R   + +  R  + E++ K L  T 
Sbjct: 2   DIAERVKRLRKALGMTQYELADLVSTAQTSIQKLER--GDTKNPR--NIEALAKALQTTP 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-GVPEIRS 125
           E   +       +          +PL+    +G               W  +  +P +  
Sbjct: 58  E-FLRFGVGELDNATVVASAGNYLPLISMVQAGV--------------WTEIQELPPLDV 102

Query: 126 PHNGI-YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG-DIVAK 183
                           + +  SMLP + +GD++ ++   QV  G  ++ +         K
Sbjct: 103 ELYPCPIKCSQHSFIVRVEGESMLPRFEEGDLIYVDPDAQVENGSYVVARLDDENQATFK 162

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVE 208
            LI    +   L +LN  +P   VE
Sbjct: 163 QLIIDGNKKY-LKALNPDWPNKFVE 186


>gi|254244958|ref|ZP_04938280.1| hypothetical protein PA2G_05837 [Pseudomonas aeruginosa 2192]
 gi|126198336|gb|EAZ62399.1| hypothetical protein PA2G_05837 [Pseudomonas aeruginosa 2192]
          Length = 221

 Score = 64.6 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 69/182 (37%), Gaps = 28/182 (15%)

Query: 39  NKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTT-----EKKEKEIPLL 93
           N SK  G +          I + +         +LDL F  G            +++P++
Sbjct: 49  NPSKGIGNQ----------IAREIELALSLPKGMLDLSFGPGEQGNAVVLSSTGRKLPVI 98

Query: 94  YFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
               +G          P G+    +  P    P+  I  I+           SMLP +  
Sbjct: 99  GSVAAGKWCEAVDTFLP-GDAEEWIEAPGPVGPNAFILKIE---------GLSMLPKFSD 148

Query: 154 GDILILNSAIQVNCGDRLLI-KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           G+ ++++ +++   G  ++  K ++ ++  K L         L +LN  +P   +++++ 
Sbjct: 149 GEKVVIDPSLEALPGHYVVAKKTKSQEVTFKQLRREGTEYF-LYALNPDWPDRIIKLTE- 206

Query: 213 EW 214
           EW
Sbjct: 207 EW 208


>gi|163867684|ref|YP_001608885.1| hypothetical protein Btr_0435 [Bartonella tribocorum CIP 105476]
 gi|161017332|emb|CAK00890.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 200

 Score = 63.8 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 76/217 (35%), Gaps = 36/217 (16%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K I   +  +     L+   LA +  L+ T    S         RW  +ES         
Sbjct: 3   KNIIATLQVLQSEFGLSQKDLADR--LNVTQATVS---------RWLGSES-----DPRG 46

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                +L+L  S     +     +PL+ +  +G     +    P  +   T+ +P     
Sbjct: 47  SHRDAILELYKSLKGYNQITT-LVPLMGYVGAGLEIDTNVEQIPE-DGLETIEIP----- 99

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS--AIQVNC--GDRLLIKPRTGDIVA 182
               + +  +      +  SM P+Y+ GD++++       V+   GD +++         
Sbjct: 100 ----FDLPFEAIGFMVRGDSMYPVYKDGDLIVVKHLQTKPVSGYYGDEVVVLTEDNRRFI 155

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K +       I L S N       ++ + I+W+  I+
Sbjct: 156 KQITR-SLEGIVLKSWNADP----IKNAKIKWVGEIV 187


>gi|41179362|ref|NP_958701.1| repressor protein cI [Bordetella phage BPP-1]
 gi|45569525|ref|NP_996594.1| repressor protein cI [Bordetella phage BMP-1]
 gi|45580776|ref|NP_996642.1| repressor protein cI [Bordetella phage BIP-1]
 gi|14278854|gb|AAK40284.1| repressor protein cI [Bordetella phage BPP-1]
          Length = 223

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 79/226 (34%), Gaps = 39/226 (17%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT+ +       I+ +        + +A K G+   + ++ ++    G N+ PS E++ K
Sbjct: 1   MTTLAQN-----INYLFRVRGENATSIAEKVGISQPTLHRIQK----GINQRPSGETLRK 51

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKE-----------IPLLYFPPSGS----GGFF- 104
           +      T+  LL    S G   E   +            +PLL    +G      G F 
Sbjct: 52  LADYFGVTVDDLLTRDLSTGLPAEAIARANVREGPNIRGLVPLLTSVQAGEWCEIAGTFQ 111

Query: 105 -DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
            D            V +P         + +  +    K       P Y  GD++ ++  +
Sbjct: 112 RDDA---------KVWLPCPVKHGPRTFCLTVEGESMKNPG--ARPSYEPGDVIFVDPDV 160

Query: 164 QVNCGDRLLIKPRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
               GDR++ +  +      K  +   GR + L +LN  +    + 
Sbjct: 161 AAKPGDRVVARLESQVAATFKQYLEEDGRKL-LKALNPDWQPRYIP 205


>gi|195970156|ref|NP_386132.2| putative phage repressor protein [Sinorhizobium meliloti 1021]
 gi|307311314|ref|ZP_07590957.1| putative phage repressor [Sinorhizobium meliloti BL225C]
 gi|307318847|ref|ZP_07598279.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|187904193|emb|CAC46605.2| Phage-related repressor protein C [Sinorhizobium meliloti 1021]
 gi|306895568|gb|EFN26322.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306899615|gb|EFN30243.1| putative phage repressor [Sinorhizobium meliloti BL225C]
          Length = 229

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 58/161 (36%), Gaps = 17/161 (10%)

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           +A   T+ ++       G     + ++IP+      G  G F       GN    V  P 
Sbjct: 75  SALGSTMTEIDVPNARIGAKVIGQGEKIPVFGQAVGGVDGEF----IMNGNVLYEVMAPP 130

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL--IKPRTGDI 180
           I S  +G YA+            SM P Y  G++  ++ + +V  GD ++  I+   G  
Sbjct: 131 ILSDISGAYAV-------SVSGDSMYPRYEDGEVCFVDPSRRVRKGDYVIAQIRLEEGGA 183

Query: 181 V---AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +    K  +      + L   N  +     E + +  +  I
Sbjct: 184 LLAYVKKFVRHNSSELVLEQFNP-HKELRFEANTVHSVHYI 223


>gi|315650040|ref|ZP_07903120.1| LexA repressor [Eubacterium saburreum DSM 3986]
 gi|315487810|gb|EFU78113.1| LexA repressor [Eubacterium saburreum DSM 3986]
          Length = 213

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 56/161 (34%), Gaps = 18/161 (11%)

Query: 56  ESIFKILAATNETICQLLD---LPFSDGRT-TEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           E I KIL  T   +        LP  +     + +  +IP+L    +           P 
Sbjct: 49  EPIAKILETTPAKLMGWNSNDNLPNGNPEPHEKPRGVKIPVLGDVAA---------GIPI 99

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
               + +   EI        A + +    + +  SM P  + GD++I+      + GD +
Sbjct: 100 EAIEDIIDYEEIDED----LARRGEFFGLRIKGNSMSPRIQNGDVVIVRVQPDADSGDIV 155

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           + K    D   K L       I L+SLN  Y        DI
Sbjct: 156 ITKVNGYDACCKRLQKHD-DGISLISLNPDYEPMFFSKKDI 195


>gi|332970254|gb|EGK09246.1| LexA family repressor/S24 family protease [Kingella kingae ATCC
           23330]
          Length = 206

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 75/212 (35%), Gaps = 43/212 (20%)

Query: 21  NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA---ATNETICQLLDLPF 77
            L+ + L + AG+  ++          GRN+     S  KIL    A   T+  L+D   
Sbjct: 15  GLSQAALGKLAGVPQSTIG----QIENGRNK-----SSTKILELAHALQTTVEYLVDGVE 65

Query: 78  SDGRTT--------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              +                +P++ +  +GS              W  V + +       
Sbjct: 66  PAQKQPSLPNVSEMPTPLYSVPVISWVQAGS--------------WQPVELFDDDDLEYI 111

Query: 130 I--YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
           +    +       + +  SM P + +GDI++++   +   G   +I     +   K L+ 
Sbjct: 112 VCRTKLGKDGYALRVRGDSMQPEFTEGDIIVIDPHGEPRAGS-FVIALHDNETTFKQLVF 170

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              R + L  LN  YP   ++ +D     RIL
Sbjct: 171 DGSRPM-LRPLNSNYPYLQIKEND-----RIL 196


>gi|92118814|ref|YP_578543.1| putative phage repressor [Nitrobacter hamburgensis X14]
 gi|91801708|gb|ABE64083.1| putative phage repressor [Nitrobacter hamburgensis X14]
          Length = 240

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 79/233 (33%), Gaps = 24/233 (10%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIFKILAAT 65
           K I   I+   E     P+  +R AGL P +    +R    E + +  S +++  +    
Sbjct: 5   KTIVARIEARLEEMGTNPAAASRAAGLSPGAIRNLQRGAKGEIKLKGASGKTLSALAEYL 64

Query: 66  NETICQLLDLPFSDGRT------TEKKEKEIPLLYFPPSGSGGFFDSG--VFPTGNKWNT 117
              +  L+      G+         ++   +     P     G FD        G   + 
Sbjct: 65  QVPLDWLMSGSGEPGKPQVIRPAGPERSTVVDAPNAPRLSEFGDFDVEVRGISVGGGDDE 124

Query: 118 VGVPE-----IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
                     +R P   + A             SM+P Y  G+ + +  A  V  GD ++
Sbjct: 125 FYFNGDVIDHLRRPPGILRA--KNVFALNVAGDSMMPRYEPGEPIYVQRANPV-IGDYVV 181

Query: 173 IKP------RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++       + G    K L+ R GR +    LN        +  +++ I R+L
Sbjct: 182 VELYPEIEGQAGKSFLKKLVRRTGRRVTCSQLNPPKE-LEFDTGEVKEIYRVL 233


>gi|171914342|ref|ZP_02929812.1| putative phage repressor [Verrucomicrobium spinosum DSM 4136]
          Length = 286

 Score = 63.0 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 54/164 (32%), Gaps = 18/164 (10%)

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           KI+  T  T    +    +         + IP L F  +G               +   G
Sbjct: 129 KIIDETGRT--GTMGAIPNLQVPPGTTARIIPHLSFAQAGKMEACWEDG-----GYEYEG 181

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-- 177
              +       + ++        +  SM      GD +++  + +   G  +L +     
Sbjct: 182 RVALNVKDPKAFTVE-------IRGDSMEDKISPGDTIMVYPSKEPRNGSVVLARLTDDA 234

Query: 178 -GDIVAKVLISRR-GRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD+  K+  ++  G+ + L S N  YP       D  +I  ++
Sbjct: 235 GGDVFCKLYTAKNQGKEVLLTSFNPAYPPMEYRREDFRFIYPVV 278


>gi|220935647|ref|YP_002514546.1| putative phage repressor [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996957|gb|ACL73559.1| putative phage repressor [Thioalkalivibrio sp. HL-EbGR7]
          Length = 230

 Score = 62.6 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 41/102 (40%), Gaps = 9/102 (8%)

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL---NSAIQVNCGDRLLIKPRTGDIVAK 183
           H  ++A             SM P  R GD++++   ++       D + +    G ++ K
Sbjct: 127 HQELHANPADLYLIYVDGESMEPTLRPGDVILVDRRSAQAVPR--DGIYVLRMDGSLLVK 184

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEM----SDIEWIARILWA 221
            L    GR + + S N  Y    + +     D+  I R++W+
Sbjct: 185 RLQRLPGRKVKVTSDNPAYEPFELALDTPGEDLAIIGRVVWS 226


>gi|238762739|ref|ZP_04623708.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
 gi|238699044|gb|EEP91792.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
          Length = 240

 Score = 62.3 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 84/218 (38%), Gaps = 27/218 (12%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIFKILA 63
            +      ++ +  +H ++ S LA+ +G+   S+  ++R+     + R    E + KI  
Sbjct: 19  KYDDFAARLNSLMSKHEISVSSLAKLSGV---SYEMARRYTLGTAKPR---DEKMLKIAD 72

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
             N +    LD     GR TE   K + L       S           G+ +     P +
Sbjct: 73  HLNVS-PAFLDYGTMTGRDTEADSKVVKLRQLEVFAS----------AGHGYINNEFPAV 121

Query: 124 RS----PHNGIYAIQTQDTR-----HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
            S    P + IY +  + +            SM+P     D+L +++ I    GD + + 
Sbjct: 122 ISSIEIPEDKIYELFGRKSLDGIHLMNVDGDSMMPTLHPRDLLFIDTKIDHFNGDGVYVF 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
                   K L   +GR + ++S N  YP   +E +++
Sbjct: 182 NFEDSTFVKRLQKVKGRRLSVLSDNDKYPPFFIEANEM 219


>gi|227822462|ref|YP_002826434.1| putative phage repressor [Sinorhizobium fredii NGR234]
 gi|227341463|gb|ACP25681.1| putative phage repressor [Sinorhizobium fredii NGR234]
          Length = 241

 Score = 61.9 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 47/146 (32%), Gaps = 17/146 (11%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
                     K+IP+      G  G F       G   + V  P I S  +  YA+    
Sbjct: 102 GPPTKLVGPGKKIPVFGQAVGGVDGEF----LMNGTVLHEVLAPPILSDISDAYAV---- 153

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL--IKPRTGDIV---AKVLISRRGRS 192
                   SM P Y  G++  ++   +V  GD ++  I+   G  +    K  +      
Sbjct: 154 ---SVSGDSMYPRYEDGEVCFVDPGRRVRKGDYVIAQIRLEEGGALLAYVKKFVRHNSSE 210

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARI 218
           + L   N    +   E   +  +  I
Sbjct: 211 LVLEQFNPQKELR-FEARTVHSVHYI 235


>gi|254419963|ref|ZP_05033687.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
 gi|196186140|gb|EDX81116.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
          Length = 153

 Score = 61.9 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 53/161 (32%), Gaps = 18/161 (11%)

Query: 62  LAATN-ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           L AT  E I                    + +  +  +G     D      G   + + V
Sbjct: 7   LQATELELIKDFFAGEQPPAGPAYD---TLDVYGYAQAGGD---DLVSLADGQVIDRIEV 60

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGD 179
           P           ++      +    SM P    G+ +I+   +     DR  +++ R G 
Sbjct: 61  PAGL--------VRGATIGIRVVGDSMEPRLFSGETVIVGLNMPPQR-DRDCVVEFRDGS 111

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
            + K    +R  ++ L   N    V  VE S ++ I  +L+
Sbjct: 112 AIVKQYKGQRDGTVFLHQYNPDKEVR-VEASKVKAIHAVLY 151


>gi|150397057|ref|YP_001327524.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150028572|gb|ABR60689.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 241

 Score = 61.5 bits (148), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 55/144 (38%), Gaps = 18/144 (12%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
           G     + ++IP+      G  G F       GN    V  P I S  +G YA+      
Sbjct: 104 GAKVIGQGEKIPVFGQAVGGVDGEF----IMNGNVLYEVMAPPILSDVSGAYAV------ 153

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR---TGDIVA--KVLISRRGRSID 194
                 SM P Y  G++  ++ + +V  GD ++ + R   +G ++A  K  +      + 
Sbjct: 154 -SVSGDSMYPRYEDGEVCFVDPSRRVRKGDYVIAQIRLEESGALLAYVKKFVRHNSSELV 212

Query: 195 LMSLNCCYPVDTVEMS--DIEWIA 216
           L   N    +     +   + +IA
Sbjct: 213 LEQFNPPKELRFEAHTVHSVHYIA 236


>gi|254492240|ref|ZP_05105414.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|224462565|gb|EEF78840.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
          Length = 209

 Score = 61.1 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 57/171 (33%), Gaps = 28/171 (16%)

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF-------DSGVFPTGNKW 115
                +I        +   +  +    IPL     S   G+        D+ +F    +W
Sbjct: 51  EEVGSSIKDY----SAGTGSIMETFAHIPLFDVKASAGNGYVIHEEEETDALIF--KKEW 104

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
               +    +    IY           +  SM P  R GD+++++    V   D + +  
Sbjct: 105 IYNELHSSPANLYLIY----------VEGESMEPALRPGDVILVDHTDNVAKRDGIYVIR 154

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-----DIEWIARILWA 221
               ++ K L     + + + S N  Y    + +      ++  I R++W+
Sbjct: 155 MGESLLVKRLQRLPSQRLKVTSDNPAYEPFEISLDFDLQNELSIIGRVVWS 205


>gi|254490244|ref|ZP_05103434.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490560|ref|ZP_05103746.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490688|ref|ZP_05103873.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490854|ref|ZP_05104037.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490891|ref|ZP_05104074.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490935|ref|ZP_05104117.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254491345|ref|ZP_05104525.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254491994|ref|ZP_05105172.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254492163|ref|ZP_05105338.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254492671|ref|ZP_05105842.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|224462192|gb|EEF78470.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224462715|gb|EEF78989.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224462809|gb|EEF79080.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224463474|gb|EEF79743.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224463844|gb|EEF80111.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464026|gb|EEF80292.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464063|gb|EEF80329.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464144|gb|EEF80408.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464304|gb|EEF80567.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464591|gb|EEF80850.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
          Length = 272

 Score = 61.1 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 57/171 (33%), Gaps = 28/171 (16%)

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF-------DSGVFPTGNKW 115
                +I        +   +  +    IPL     S   G+        D+ +F    +W
Sbjct: 114 EEVGSSIKDY----SAGTGSIMETFAHIPLFDVKASAGNGYVIHEEEETDALIF--KKEW 167

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
               +    +    IY           +  SM P  R GD+++++    V   D + +  
Sbjct: 168 IYNELHSSPANLYLIY----------VEGESMEPALRPGDVILVDHTDNVAKRDGIYVIR 217

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-----DIEWIARILWA 221
               ++ K L     + + + S N  Y    + +      ++  I R++W+
Sbjct: 218 MGESLLVKRLQRLPSQRLKVTSDNPAYEPFEISLDFDLQNELSIIGRVVWS 268


>gi|222149508|ref|YP_002550465.1| bacteriophage repressor protein C1 [Agrobacterium vitis S4]
 gi|221736490|gb|ACM37453.1| bacteriophage repressor protein C1 [Agrobacterium vitis S4]
          Length = 191

 Score = 60.7 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 50/145 (34%), Gaps = 21/145 (14%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGF-FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
           G    K  K + L+    +G   +  D G            V      H    A++    
Sbjct: 60  GTPDSKPFKRVKLMGKVGAGQEIYAIDDGG--------QSDVDAPADAHQNTVAVE---- 107

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVN--CGDRLLIKPRTGDIVAKVLIS-RRGRSIDL 195
                  SM P Y +G IL  +  +  +     R +++   G I  K +       +  L
Sbjct: 108 ---VSGESMYPAYEEGTILFYSKTLPPSEMVNRRAVVQLADGRIFVKTVRPGTTPNTWTL 164

Query: 196 MSLNCCYPVDTVEMSDIEWIARILW 220
            S+N  YP    ++  +EW A I W
Sbjct: 165 TSINALYPDMIDQI--VEWAAPIDW 187


>gi|56475434|ref|YP_157023.1| putative bacteriophage-related transcriptional repressor
           [Aromatoleum aromaticum EbN1]
 gi|56311477|emb|CAI06122.1| putative bacteriophage-related transcriptional repressor
           [Aromatoleum aromaticum EbN1]
          Length = 229

 Score = 60.7 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 53/141 (37%), Gaps = 11/141 (7%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
             +      ++ ++PL+ +  +G          P G  +  V       PH   +A+   
Sbjct: 93  SPNICAGPDRKGKVPLISWVRAGEFAHAADL-LPVGEAYEWVETGVNVQPHT--FAL--- 146

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
               + Q  SM P +  G I+++   +    GD ++ +    +   K L+      + L 
Sbjct: 147 ----RVQGDSMEPEFVAGTIIVIEPHMVAEPGDYVIARNGDNEATFKQLVRDGA-DLYLK 201

Query: 197 SLNCCYPVDTVEMSDIEWIAR 217
            LN  YP+  +  + I  + R
Sbjct: 202 PLNPRYPIKPLGATAIIGVVR 222


>gi|52842770|ref|YP_096569.1| phage repressor [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52629881|gb|AAU28622.1| phage repressor [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 225

 Score = 60.7 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 49/196 (25%), Positives = 71/196 (36%), Gaps = 12/196 (6%)

Query: 24  PSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFKILAATNETICQLLDLPF---S 78
             GL R+A  D T   K  R      G  R P  E I ++  A   +   L+ L      
Sbjct: 17  AKGLTRQALADLTDDIKPSRINNWEHG-TRMPGPEEITQLAQALEVSPSFLMGLSDERDG 75

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
           D     +    IPLL    +G   +    V           +P  +   N    +     
Sbjct: 76  DFGINSRVGSLIPLLDHKQAGDPKYHIQRVKEEPYAEKITFLPVNQDIANQ---LDEYAF 132

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD---IVAKVLISRRGRSIDL 195
             K  D SM P  R  DI I++ +I  N GD +++K    D   I     IS      +L
Sbjct: 133 ALKMLDDSMSPELRINDIQIVDPSISPNPGDFVVVKISGKDDVIICQYKKISYTSSEFEL 192

Query: 196 MSLNCCYPVDTVEMSD 211
           ++LN  +P  T   S+
Sbjct: 193 LTLNDNWPNITFNESE 208


>gi|222149048|ref|YP_002550005.1| transcriptional regulator [Agrobacterium vitis S4]
 gi|221736033|gb|ACM36996.1| transcriptional regulator [Agrobacterium vitis S4]
          Length = 191

 Score = 60.7 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 72/199 (36%), Gaps = 39/199 (19%)

Query: 27  LARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
           LA   G+  ++ N+ K     EG +R               + I +L ++ F  G    K
Sbjct: 23  LAAHFGVSQSTVNRWKSGSEPEGHHR---------------DAIRELYNMEF--GTPDSK 65

Query: 86  KEKEIPLLYFPPSGSGGF-FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
             K + L+    +G   +  D G        N V  P     H    A++          
Sbjct: 66  PFKRVKLMGKVGAGQEIYAIDDGGQ------NYVDAPA--DAHQNTVAVE-------VSG 110

Query: 145 TSMLPLYRKGDILILNSAIQVN--CGDRLLIKPRTGDIVAKVLIS-RRGRSIDLMSLNCC 201
            SM P Y +G IL  +  +  +     R +++   G I  K +       +  L S+N  
Sbjct: 111 ESMYPAYEEGTILFYSKTLPPSEMVNRRAVVQLADGRIFVKTVRPGTTPNTWTLTSINAL 170

Query: 202 YPVDTVEMSDIEWIARILW 220
           YP    ++  +EW A I W
Sbjct: 171 YPDMIDQI--VEWAAPIDW 187


>gi|297622579|ref|YP_003704013.1| transcriptional repressor, LexA family [Truepera radiovictrix DSM
           17093]
 gi|297163759|gb|ADI13470.1| transcriptional repressor, LexA family [Truepera radiovictrix DSM
           17093]
          Length = 204

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 43/129 (33%), Gaps = 17/129 (13%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
             +   +P+L                P G     +  PE   P  G      Q    +  
Sbjct: 71  PARATGVPVLGS-------------IPAGPLSEALAEPEGFLPLTGA----RQQFALRVS 113

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM  L + GDI++    +    G+   ++    ++  K +     +++ L   N  YP
Sbjct: 114 GDSMADLIQDGDIVLFRKGMPTRSGEICAVRVGNSEVTLKYVDHHEPQTVTLRPHNPQYP 173

Query: 204 VDTVEMSDI 212
              V  +++
Sbjct: 174 TVAVPATEV 182


>gi|184157332|ref|YP_001845671.1| Cro/CI family transcriptional regulator [Acinetobacter baumannii
           ACICU]
 gi|260555987|ref|ZP_05828207.1| cro/CI family transcriptional regulator [Acinetobacter baumannii
           ATCC 19606]
 gi|183208926|gb|ACC56324.1| putative transcriptional regulator, Cro/CI family [Acinetobacter
           baumannii ACICU]
 gi|260410898|gb|EEX04196.1| cro/CI family transcriptional regulator [Acinetobacter baumannii
           ATCC 19606]
 gi|322507218|gb|ADX02672.1| Cro/CI family transcriptional regulator [Acinetobacter baumannii
           1656-2]
 gi|323517194|gb|ADX91575.1| Cro/CI family transcriptional regulator [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 250

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              +    +  +    +++ +P+  +   G  G+F    +        V          G
Sbjct: 96  EDAVKFVQAPAKPFPIQKRYVPVKAYSKMGMDGYFTDMGYDGNAGDGYVPTHTAGPRAYG 155

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +    +   + + +  + G    K  +   
Sbjct: 156 I----------KGTGDSMFPAIRNGWYVVCDPDADLVPNEFVQVCLKDGRCTIKEFVGIN 205

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           G  + L+S+N        EM ++E I  I
Sbjct: 206 GGVLSLLSVNGG-ERFFFEMDEVESITAI 233


>gi|295103878|emb|CBL01422.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Faecalibacterium prausnitzii SL3/3]
          Length = 210

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 74/218 (33%), Gaps = 41/218 (18%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           ++  ++ + LA + G+   +  K  S +   +     PST  + +I    N T   LL L
Sbjct: 12  KKQGVSQAELASRLGVTQQAVGKWESGKSSPD-----PST--VARIAELLNTTADYLLGL 64

Query: 76  PFSDGRTTEKKEK--------EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                  +  +E+         IP++    +G G                +   E     
Sbjct: 65  YRPVSNVSAPEERFFGSYTESLIPVIGTVKAGYG---------------ALAFEEDYGQE 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLI 186
                  +       +  SM P  + GD+ +++    +  GD  +LI    G+     L 
Sbjct: 110 YARVKDPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGE---GTLK 166

Query: 187 S--RRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RIL 219
              +RG  + L   N  Y    +   D+  +    R++
Sbjct: 167 RYIQRGNCVVLQPFNPAYHEMVIRGEDLNHLHIAGRVV 204


>gi|87198657|ref|YP_495914.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134338|gb|ABD25080.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
          Length = 208

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 81/237 (34%), Gaps = 55/237 (23%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTS----FNKSK---RFGIEGRNRWP 53
           M+ F        +  + + H +    LA+ AGL  TS    F+ S+   R G        
Sbjct: 7   MSKFDIDAFRTRLQSLMDEHKIKRKPLAKAAGLGETSIRDIFDSSRNDVRIGT------- 59

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
               + ++      ++ +L++ P               L     +G    F++    +G 
Sbjct: 60  ----LVRLADYFQMSVDELIEEPEMR------------LAGRVGAGGQVLFEAEDSHSGP 103

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN------SAIQVNC 167
                 VP+       + A++          TSMLP Y  GDI+ +           +  
Sbjct: 104 T-----VPKPPGASAAVMALE-------VVGTSMLPKYEDGDIVYVRRDVDGIPRSAI-- 149

Query: 168 GDRLLIKPRTGDIVAKVLISRR-GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   ++   G    K+L          L SLN       +E  ++ W A +LW  Q
Sbjct: 150 GEYCAVRTAEGGTYLKILAKGSEPGRFTLRSLNA----PDMENEEVVWAAPVLWVRQ 202


>gi|213157772|ref|YP_002320570.1| putative transcriptional regulator, Cro/CI family [Acinetobacter
           baumannii AB0057]
 gi|301347660|ref|ZP_07228401.1| putative transcriptional regulator, Cro/CI family protein
           [Acinetobacter baumannii AB056]
 gi|301596874|ref|ZP_07241882.1| putative transcriptional regulator, Cro/CI family protein
           [Acinetobacter baumannii AB059]
 gi|213056932|gb|ACJ41834.1| putative transcriptional regulator, Cro/CI family [Acinetobacter
           baumannii AB0057]
          Length = 260

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 50/149 (33%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              +    +  +    +++ +P+  +   G  G+F    +        V          G
Sbjct: 106 EDAVKFVQTSDKPFPIQKRYVPVKAYSKMGMDGYFTDMGYDGNAGDGYVPTHSAGPRAYG 165

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +   ++   + + +  + G    K  +   
Sbjct: 166 I----------KGTGDSMFPAIRNGWYVVCDPDAELVPNEFVQVCLKDGRCTIKEFVGIN 215

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           G  + L+S+N        EM ++E I  I
Sbjct: 216 GGVLSLLSVNGG-ERFFFEMDEVESITAI 243


>gi|160942797|ref|ZP_02090038.1| hypothetical protein FAEPRAM212_00274 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445962|gb|EDP22965.1| hypothetical protein FAEPRAM212_00274 [Faecalibacterium prausnitzii
           M21/2]
          Length = 210

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 73/218 (33%), Gaps = 41/218 (18%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           ++  ++ + LA + G+   +  K  S +   +     PST  + +I    N T   LL L
Sbjct: 12  KKQGVSQAELASRLGVTQQAVGKWESGKSSPD-----PST--VARIAELLNTTADYLLGL 64

Query: 76  PFSDGRTTEKKEK--------EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                  +  +E+         IP++    +G G                +   E     
Sbjct: 65  YRPVSNVSAPEERFFGSYTESLIPVIGTVKAGYG---------------ALAFEEDYGQE 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLI 186
                          +  SM P  + GD+ +++    +  GD  +LI    G+     L 
Sbjct: 110 YARVKDPANYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGE---GTLK 166

Query: 187 S--RRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RIL 219
              +RG  + L   N  Y    +   D+  +    R++
Sbjct: 167 RYIQRGNCVVLQPFNPAYHEMVIRGEDLNHLHIAGRVV 204


>gi|169832055|ref|YP_001718037.1| putative prophage repressor [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638899|gb|ACA60405.1| putative prophage repressor [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 196

 Score = 59.6 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 36/207 (17%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE---GRNRWPSTESIFKILAATNETI 69
           I R+ E   L+   LARKAGL       S ++  +   GR   PS +S+ K+  A     
Sbjct: 8   IRRLREESGLSQRALARKAGL-------SSQYLSDIEVGRTS-PSLKSLEKLAGALQVAP 59

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
            QLL            +  E+P+L   P+G     +  +       + + +P  +     
Sbjct: 60  GQLLQ----GQDRFSSQVVEVPVLGRVPAGGPVVSEEVIL------DYLPLP-RKLASED 108

Query: 130 IYAIQTQDTRHKTQDTSMLPL-YRKGDILIL--NSAIQVNCGDRLLIKPRTGDIVAKVLI 186
            + ++        +  SM  L    GD +++      +     +++I    G++  K   
Sbjct: 109 TFCLE-------VRGESMQDLGIDSGDYVLVRLQPTAE---NGQVVIARVEGEVTCKR-Y 157

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE 213
            R  R + L   N  +    +E  +IE
Sbjct: 158 YRTDRVVSLEPANRRFRPLRLEAGEIE 184


>gi|148358304|ref|YP_001249511.1| phage repressor [Legionella pneumophila str. Corby]
 gi|296105654|ref|YP_003617354.1| hypothetical protein lpa_00219 [Legionella pneumophila 2300/99
           Alcoy]
 gi|148280077|gb|ABQ54165.1| phage repressor [Legionella pneumophila str. Corby]
 gi|295647555|gb|ADG23402.1| hypothetical protein lpa_00219 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 219

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 62/160 (38%), Gaps = 13/160 (8%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDG-RTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           R P  E I  +  A + +   L+ L      + T+     IPLL    +     F   + 
Sbjct: 45  RAPGPEEIKLLAQALDVSPAFLMCLSDDQQVKRTKSYSHLIPLLDHHQACDAKSFIEAIS 104

Query: 110 PTGNK----WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
             G+     W +V    I+   +  +A++         D SM+P  R  D+L++  ++  
Sbjct: 105 DQGSAGDVVWISVSATLIQELSSEAFALKMP-------DESMMPELRLNDVLVVEPSVTP 157

Query: 166 NCGDRLLIKPRTG-DIVAKVLISRRGRSIDLMSLNCCYPV 204
             GD +++K     + +            +L++LN  +P 
Sbjct: 158 CPGDFVVVKLANKLEAIVCQYRETTYTEFELVTLNDNWPN 197


>gi|169633042|ref|YP_001706778.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii SDF]
 gi|169151834|emb|CAP00666.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii]
          Length = 254

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 47/135 (34%), Gaps = 11/135 (8%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
              ++ +P+  +   G  G+F    +        V      S     YA++         
Sbjct: 114 PSSKRWVPVKAYSKMGMDGYFTDIGYEGNAGDGYVPTHTAGSR---AYAVKGT------- 163

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM P  R G  ++ +    +   + + +  + G    K  +   G  + L+S+N    
Sbjct: 164 GDSMFPAIRNGWYVVCDPDADLVPNEFVQVCLKDGRCTIKEFVGINGGVLSLLSVNGG-E 222

Query: 204 VDTVEMSDIEWIARI 218
               EM ++E I  I
Sbjct: 223 RFFFEMDEVESITAI 237


>gi|311107226|ref|YP_003980079.1| repressor protein C2 domain-containing protein [Achromobacter
           xylosoxidans A8]
 gi|310761915|gb|ADP17364.1| repressor protein C2 domain protein [Achromobacter xylosoxidans A8]
          Length = 234

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 45/127 (35%), Gaps = 16/127 (12%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
                 + +PL+ +  +G              +     + ++R      +A++       
Sbjct: 95  PAPIGSRRVPLINYVQAGE---LTEIGVSFSGEAMEYLLTDLRLSDYS-FALE------- 143

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG-----RSIDLM 196
            Q  SM P +R GD +I++  +    GD ++ +    +   K    R          +L+
Sbjct: 144 IQGDSMSPEFRPGDRIIVDREVCPRPGDFVVARNGGYEATFKKYRPRGISETGHEVFELV 203

Query: 197 SLNCCYP 203
            LN  YP
Sbjct: 204 PLNEDYP 210


>gi|157834973|ref|YP_001469130.1| c repressor [Phage MP22]
 gi|117373087|gb|ABH09825.1| c repressor [Pseudomonas phage MP22]
          Length = 209

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 76/206 (36%), Gaps = 20/206 (9%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL-----PF 77
           + S LAR AG+        +R+   G        S+ K   A   ++  L+       P 
Sbjct: 10  SASALARNAGISQGGL---QRYLKGGEPTRRVLISLAK---AAGVSLGWLMTGEGSKKPE 63

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
               T   +   +PL     S   G +  G     +    +          G+    T+ 
Sbjct: 64  EQEATGSDQYVYVPLYDARVSAGHGSWSEG----AHVLTQLAFTRYSLSKKGL--EPTRM 117

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
           +  +    SM PL   GD ++++  ++    + + +      + AK L  +   SI ++S
Sbjct: 118 SAVRVGGDSMEPLLSDGDAVVIDHDLRTVRDEAIYVIRVGDQLYAKRLQRQFDGSIAIIS 177

Query: 198 LNCCYPVDTVE---MSDIEWIARILW 220
            N  Y    V    +SD++ I R++W
Sbjct: 178 ENKAYKDMVVPKDQLSDLDIIGRVVW 203


>gi|313114612|ref|ZP_07800120.1| helix-turn-helix protein [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623076|gb|EFQ06523.1| helix-turn-helix protein [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 210

 Score = 58.8 bits (141), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 75/218 (34%), Gaps = 41/218 (18%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           ++  ++ + LA K G+   +  K  S +   +     PST  + +I    N T   LL L
Sbjct: 12  KKQGISQAELASKLGVTQQAVGKWESGKSSPD-----PST--VARIAELLNTTADYLLGL 64

Query: 76  PFSDGRTTEKKEK--------EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                  +  +E+         IP++    +G G                +   E     
Sbjct: 65  YRPVSNVSAPEERFFGSYSESLIPVIGTVKAGYG---------------ALAFEEDYGQE 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLI 186
                  +       +  SM P  + GD+ +++    +  GD  +LI    G+     L 
Sbjct: 110 YARVKDPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGE---GTLK 166

Query: 187 S--RRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RIL 219
              +RG  + L   N  Y    ++  D+  +    R++
Sbjct: 167 RYIQRGNCVVLQPFNPAYSEMVIKGEDLNHLHIAGRVV 204


>gi|156523050|ref|YP_950425.2| putative c repressor [Pseudomonas phage DMS3]
 gi|156513709|gb|ABG66655.2| putative c repressor [Pseudomonas phage DMS3]
          Length = 236

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 76/206 (36%), Gaps = 20/206 (9%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL-----DLPF 77
           + S LAR AG+        +R+   G        S+ K   A   ++  L+       P 
Sbjct: 37  SASALARNAGISQGGL---QRYLKGGEPTRRVLISLAK---AAGVSLGWLMTGEGSQKPE 90

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
               T   +   +PL     S   G +  G     +    +          G+    T+ 
Sbjct: 91  EQEATGSDQYVYVPLYDARVSAGHGSWSEG----AHVLTQLAFTRYSLSKKGL--EPTRM 144

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
           +  +    SM PL   GD ++++  ++    + + +      + AK L  +   SI ++S
Sbjct: 145 SAVRVGGDSMEPLLSDGDAVVIDHDLRTVRDEAIYVIRVGDQLYAKRLQRQFDGSIAIIS 204

Query: 198 LNCCYPVDTVE---MSDIEWIARILW 220
            N  Y    V    +SD++ I R++W
Sbjct: 205 ENKAYKDMVVPKDQLSDLDIIGRVVW 230


>gi|114328257|ref|YP_745414.1| transcriptional repressor [Granulibacter bethesdensis CGDNIH1]
 gi|114316431|gb|ABI62491.1| transcriptional repressor [Granulibacter bethesdensis CGDNIH1]
          Length = 255

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/143 (14%), Positives = 51/143 (35%), Gaps = 17/143 (11%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFP-TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
           T    + +P+        GG   +   P +    +   +P   +   G++A+        
Sbjct: 116 TGLSVRSVPVFGTAQ---GGALGATGLPDSAQALDWARLPGPLTGIPGLFAL-------Y 165

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-----IVAKVLISRRGRSIDLM 196
            +  SM P    G ++ ++        D +++  + G+      + K L+ R    + L 
Sbjct: 166 VEGDSMEPWVEHGHLIYIHPTRPAAPRDHVVVVVQDGEYDEPRALVKRLVRRTAGRLVLH 225

Query: 197 SLNCCYPVDTVEMSDIEWIARIL 219
             N    +  ++   +  I R++
Sbjct: 226 QYNPAGEI-EIDARTVMRIYRVI 247


>gi|255282221|ref|ZP_05346776.1| LexA repressor [Bryantella formatexigens DSM 14469]
 gi|255267169|gb|EET60374.1| LexA repressor [Bryantella formatexigens DSM 14469]
          Length = 206

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 38/108 (35%), Gaps = 5/108 (4%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
           +   P     + +   EI        A   +    +    SM P + +GD++I+      
Sbjct: 87  AAGIPIEAITDIIDTEEIPEE----MAATGEFFGLQIHGDSMEPKFSEGDVVIVRQQDDA 142

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
             GD ++      D   K L  +    I+L+S N  Y        DIE
Sbjct: 143 ESGDIVIAMINGDDATCKRL-RKYRDGIELVSTNPSYEPMFFSNEDIE 189


>gi|239504169|ref|ZP_04663479.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii AB900]
          Length = 254

 Score = 58.4 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 50/149 (33%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              +    +  ++   +++ +P+  +   G  G+F    +        V          G
Sbjct: 100 EDAVKFLETPVKSFPTQKRYVPVKAYSKMGMDGYFTDMGYEGNAGDGYVPTHSAGPRAYG 159

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +    +   + + +  + G    K  +   
Sbjct: 160 I----------KGTGDSMFPAIRNGWYVVCDPDADLVPNEFVQVCLKDGRCTIKEFVGIN 209

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           G  + L+S+N        EM ++E I  I
Sbjct: 210 GGVLSLLSVNGG-ERFFFEMDEVESITAI 237


>gi|226940427|ref|YP_002795501.1| prophage repressor protein [Laribacter hongkongensis HLHK9]
 gi|226715354|gb|ACO74492.1| Putative prophage repressor protein [Laribacter hongkongensis
           HLHK9]
          Length = 233

 Score = 58.4 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 50/128 (39%), Gaps = 11/128 (8%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
                   E+P++ +  +G+         P G    TV        H   YA+       
Sbjct: 100 APGPFVGGEVPIISWVQAGNFESVVDNFQP-GFAEETVTATVQVRRHT--YAL------- 149

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           +    SM P +++GDILI+   ++   G  ++ K    +   K L+   G    L  LN 
Sbjct: 150 RVHGDSMEPDFKEGDILIVEPEMEAVHGSYVIAKNGDNEATFKKLVQDGGDWY-LKPLNP 208

Query: 201 CYPVDTVE 208
            YP+ +++
Sbjct: 209 AYPMKSLD 216


>gi|254240372|ref|ZP_04933694.1| hypothetical protein PA2G_01019 [Pseudomonas aeruginosa 2192]
 gi|126193750|gb|EAZ57813.1| hypothetical protein PA2G_01019 [Pseudomonas aeruginosa 2192]
          Length = 243

 Score = 58.4 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 81/249 (32%), Gaps = 43/249 (17%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
                I   +  +   H ++P+ L+R+ G+  ++ ++     + G+   P  E ++ I  
Sbjct: 1   MQKSTIQHILAALLAEHGISPTELSRRTGVGQSTISR----ILNGKIATPKDEQVYPIAE 56

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-------------------FF 104
               +  QL               +E      P +   G                   F 
Sbjct: 57  YFGLSTDQLRGRVSIGTAPIPAVVRE------PEATMDGPIEVWDDSTPLPSDEVLVPFL 110

Query: 105 DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH------KTQDTSMLPLYRKGDILI 158
                  G+   +V +   RS   G Y+++ Q               SM P+ R G  + 
Sbjct: 111 KEVELAAGSGKMSVEMNSRRSLRFGKYSLKKQGVDPANARCVTITGNSMEPVLRNGATVG 170

Query: 159 LN-SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPV-----DTVEMSD 211
           ++    ++  GD L      G +  K      G  I L S N   +P      D +   +
Sbjct: 171 VDVGNTRIVDGD-LYAINHGGLLRVKQTYRLPGGGIRLRSFNRDEHPDEEYSKDEIVAQE 229

Query: 212 IEWIARILW 220
           IE I R+ W
Sbjct: 230 IEIIGRVFW 238


>gi|240850547|ref|YP_002971947.1| putative phage repressor [Bartonella grahamii as4aup]
 gi|240267670|gb|ACS51258.1| putative phage repressor [Bartonella grahamii as4aup]
          Length = 205

 Score = 58.4 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 60/187 (32%), Gaps = 45/187 (24%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKE-------------IPLLYFPPSGSGG 102
           E + K L  T  ++ + L      G   +   +              +PL+ +  +G+  
Sbjct: 23  EDVAKRLNVTQASVSKWLKDSDPRGSNRDAILELYKELKGDNHFTTFVPLMGYIGAGTQ- 81

Query: 103 FFDSG--VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
             D      P  +    V +P         +A+       + +  SM+P Y+ GD++I+ 
Sbjct: 82  -IDPSFEQIPE-DGLEQVEIP---------FALPDDMVAFEVKGDSMIPAYKDGDMVIVR 130

Query: 161 SAIQVNC---------GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
                           G   +I         K +       IDL+S N       ++   
Sbjct: 131 -----RRQIKTIESFFGKEAVILTHDNKRYIKQISRGMNGEIDLLSWNALP----IKNVK 181

Query: 212 IEWIARI 218
           I W+  I
Sbjct: 182 IVWVGEI 188


>gi|225155121|ref|ZP_03723616.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidase)-like protein [Opitutaceae bacterium TAV2]
 gi|224804068|gb|EEG22296.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidase)-like protein [Opitutaceae bacterium TAV2]
          Length = 215

 Score = 58.4 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 64/163 (39%), Gaps = 16/163 (9%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEK-KEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           E++ + L  TN    +    P+  G        +EIP++ +  +G    ++         
Sbjct: 54  ETLKRELEFTNRGELRENPAPYGVGHPLRDLAPREIPVISWAHAGEAVSYEE----IPRD 109

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           W         +PH     ++           SMLP +R GD++++   ++      ++ K
Sbjct: 110 WQNTIYTSCATPHAFAITVE---------GDSMLPDFRPGDVVVVMPEVEPRNHCPVVAK 160

Query: 175 PRTGDIVAKVLISRRG--RSIDLMSLNCCYPVDTVEMSDIEWI 215
            +   +V K+L +     R+I L S+N  Y   T    D  WI
Sbjct: 161 LKNDGVVLKILNASGPEKRTIVLTSINPVYQPLTYTPEDFHWI 203


>gi|330830140|ref|YP_004393092.1| phage repressor [Aeromonas veronii B565]
 gi|328805276|gb|AEB50475.1| Phage repressor [Aeromonas veronii B565]
          Length = 144

 Score = 58.4 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 50/148 (33%), Gaps = 29/148 (19%)

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-----GVPEIRSPHNGIYAIQTQDTRH 140
             K IP+L +  +G+              W  +              +    I       
Sbjct: 3   PGKRIPILSYVQAGN--------------WREMCEQATTFDGNVEFVSASGEIGPFGFGL 48

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR-----RGRSIDL 195
             +  SMLP +++GD++I++       GD ++ K  + +   K    R          +L
Sbjct: 49  WLRGDSMLPQFKEGDLIIVDPDEAPQPGDYVVAKNGSNEATFKKYRPRGIDENGQEVFEL 108

Query: 196 MSLNCCYPVDTVEMSDIEWI-----ARI 218
           + LN  YP    +   I+ I      RI
Sbjct: 109 VPLNEDYPTMHSDRQHIQIIGVMVEHRI 136


>gi|322507694|gb|ADX03148.1| Putative repressor protein from bacteriophage [Acinetobacter
           baumannii 1656-2]
          Length = 243

 Score = 58.4 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 46/136 (33%), Gaps = 11/136 (8%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
           T   ++ +P+  +   G  G+F    +        V          GI          K 
Sbjct: 102 TPSSKRWVPVKAYSKMGMDGYFTDMGYEGNAGDGYVPTHSAGPRAYGI----------KG 151

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P  R G  ++ +    +   + + +  + G    K  +   G  + L+S+N   
Sbjct: 152 TGDSMFPAIRNGWYVVCDPDADLVPNEFVQVCLKDGRCTIKEFVGINGGVLSLLSVNGG- 210

Query: 203 PVDTVEMSDIEWIARI 218
                EM ++E I  I
Sbjct: 211 ERFFFEMDEVESITAI 226


>gi|169796760|ref|YP_001714553.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii AYE]
 gi|169149687|emb|CAM87578.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii AYE]
          Length = 249

 Score = 58.4 bits (140), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 50/149 (33%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              +    +  +    +++ +P+  +   G  G+F    +        V          G
Sbjct: 95  EDAVKFVQTSDKPFPIQKRYVPVKAYSKMGMDGYFTDMGYEGNAGDGYVPTHTAGPRAYG 154

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +    +   + + +  + G    K  +   
Sbjct: 155 I----------KGTGDSMFPAIRNGWYVVCDPDADLVPTEFVQVCLKDGRCTIKEFVGIN 204

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           G  + L+++N      + +M ++E I  I
Sbjct: 205 GGVLSLLAVNGG-ERLSFDMDEVESITAI 232


>gi|262043414|ref|ZP_06016539.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039240|gb|EEW40386.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 207

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 51/144 (35%), Gaps = 19/144 (13%)

Query: 83  TEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
            E   + IP+L +  +G      D              + +        +A+       +
Sbjct: 70  AEVSTRHIPILSYVQAGQCTEARDYTNM---EGEFEYVLAD-ADVPETCFAL-------R 118

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR--RGRSIDLMSLN 199
               SM P +++GDI+I++  +    G+ ++ K    +   K            +L+ LN
Sbjct: 119 IDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNNGHEATFKKYRPLGIGIEDFELVPLN 178

Query: 200 CCYPVDT---VEMSDIEWI--ARI 218
             YPV     + +  I  +   RI
Sbjct: 179 PDYPVLRSAELPLRVIGVMIEHRI 202


>gi|331019765|gb|EGH99821.1| putative phage repressor [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 238

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM   +R GD L+++  I     D + +    GD+  K L    G S+ ++S N  Y
Sbjct: 151 DGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTLDGDLYIKRLQRMTGGSLRMISDNPLY 210

Query: 203 PVDTVEMSDIEWI---ARI--LW 220
           P   +E +D+  +   AR+  +W
Sbjct: 211 PAIIIEGADLTKVHIQARVLLVW 233


>gi|195546597|ref|YP_002117625.1| C repressor protein [Rhizobium phage 16-3]
 gi|218512144|sp|P15238|RPC_BP163 RecName: Full=Repressor protein C
 gi|102642540|gb|ABF71321.1| C repressor protein [Rhizobium phage 16-3]
          Length = 263

 Score = 58.0 bits (139), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 49/147 (33%), Gaps = 20/147 (13%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
             +K+K +P+L     G  G     +F  G+  + V  P         YA+         
Sbjct: 125 EPRKKKLLPVLGEAVGGEDG---EYIF-NGSVLDYVDCPPSLENVPNAYAV-------YI 173

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR-----TGDI---VAKVLISRRGRSID 194
              SM+P +R G+ + ++       GD ++I+        G       K  +      + 
Sbjct: 174 DGESMVPRFRPGETVWVHPTKPPRRGDDVVIQIHPDNEDDGAPPRGFVKEFVGWTANKLV 233

Query: 195 LMSLNCCYPVDTVEMSDIEWIARILWA 221
           L   N    +       +  +  I+ A
Sbjct: 234 LQQYNPTKKI-EFTREQVVSVHPIILA 259


>gi|213971961|ref|ZP_03400059.1| transcriptional regulator, Cro/CI family [Pseudomonas syringae pv.
           tomato T1]
 gi|213923276|gb|EEB56873.1| transcriptional regulator, Cro/CI family [Pseudomonas syringae pv.
           tomato T1]
          Length = 148

 Score = 58.0 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM   +R GD L+++  I     D + +    GD+  K L    G ++ ++S N  Y
Sbjct: 61  DGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTLDGDLYIKRLQRMTGGALRMISDNPLY 120

Query: 203 PVDTVEMSDIEWI---ARI--LW 220
           P   +E +D+  +   AR+  +W
Sbjct: 121 PAIIIEGADLTKVHIQARVLLVW 143


>gi|319776198|ref|YP_004138686.1| putative phage repressor [Haemophilus influenzae F3047]
 gi|301168972|emb|CBW28569.1| unnamed protein product [Haemophilus influenzae 10810]
 gi|317450789|emb|CBY87011.1| Putative phage repressor [Haemophilus influenzae F3047]
          Length = 219

 Score = 58.0 bits (139), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 62/173 (35%), Gaps = 31/173 (17%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEI-----PLLYFPPSGSGGFFDSGVFPTG 112
           +  +L       C LL L   +G ++      I     PL+ +  +G+    D     TG
Sbjct: 54  LSTVLE------CDLLWLLRGEGSSSNVMPASIGTNKVPLISYVQAGTWTGIDDLKESTG 107

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           +        +        +A++        +  SM P ++ GD++I++  I+   G+ + 
Sbjct: 108 DFNYIYTFIDTSDD---AFALE-------IKGDSMEPDFKAGDVIIIDPRIEPRAGEFVA 157

Query: 173 IKPRTGDIVAK------VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K       +        +L+ LN  YP  +    +I    RI+
Sbjct: 158 AINGDYEATFKKYRPIGDIDELGRHHFELVPLNSDYPTLSSLKQEI----RII 206


>gi|295096873|emb|CBK85963.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 192

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 45/127 (35%), Gaps = 18/127 (14%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA---IQTQDTR 139
            E   + IP+L +  +             G       V ++      + A   +      
Sbjct: 55  AEISTRRIPVLSYVQA-------------GELTEAKDVTDLTGDFEYVLADSDVPATCFA 101

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS--IDLMS 197
            +    SM P +++GDI+I++  +    G+ ++ K    +   K            +L+ 
Sbjct: 102 LRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNGGHEATFKKYRPLGVGINDFELVP 161

Query: 198 LNCCYPV 204
           LN  YPV
Sbjct: 162 LNPDYPV 168


>gi|161345277|gb|ABX64473.1| putative phage repressor [Pseudomonas syringae]
          Length = 238

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM   +R GD L+++  I     D + +    GD+  K L    G ++ ++S N  Y
Sbjct: 151 DGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTLDGDLYIKRLQRMTGGALRMISDNPLY 210

Query: 203 PVDTVEMSDIEWI---ARI--LW 220
           P   +E +D+  +   AR+  +W
Sbjct: 211 PAIIIEGADLTKVHIQARVLLVW 233


>gi|301386007|ref|ZP_07234425.1| putative phage repressor [Pseudomonas syringae pv. tomato Max13]
 gi|302058863|ref|ZP_07250404.1| putative phage repressor [Pseudomonas syringae pv. tomato K40]
          Length = 238

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM   +R GD L+++  I     D + +    GD+  K L    G ++ ++S N  Y
Sbjct: 151 DGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTLDGDLYIKRLQRMTGGALRMISDNPLY 210

Query: 203 PVDTVEMSDIEWI---ARI--LW 220
           P   +E +D+  +   AR+  +W
Sbjct: 211 PAIIIEGADLTKVHIQARVLLVW 233


>gi|167565035|ref|ZP_02357951.1| putative transcriptional regulator [Burkholderia oklahomensis
           EO147]
          Length = 230

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 66/187 (35%), Gaps = 26/187 (13%)

Query: 53  PSTESIFKILAATNETICQLLDLPF-----------SDGRTTEKKEKEIPLLYFPPSGSG 101
           P  E +  I  AT  +I  LL               ++      +   +P      S   
Sbjct: 46  PKAEGLLAISEATGRSIDWLLGRVELANGSLVTADQAEANAASSEFVYVPRYDVKASAGT 105

Query: 102 GFF--DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
           GF+  D           T+        H  ++A     +  +    SM P+  +GD +++
Sbjct: 106 GFWLGDEA-----KAKFTMAFRRHWVEHY-LHANPKDLSVLRVHGDSMYPVLHEGDNILI 159

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE------ 213
           N   Q +  D + +    G ++ K L      ++ ++S N  YP   V +S  E      
Sbjct: 160 NH-AQTSPQDGIYVLRLDGQMLVKRLQWVGAATVRVISANPDYPPYEVALSSPEDQREFC 218

Query: 214 WIARILW 220
            + R++W
Sbjct: 219 IVGRVVW 225


>gi|149186070|ref|ZP_01864384.1| putative transcriptional regulator, repressor [Erythrobacter sp.
           SD-21]
 gi|148830101|gb|EDL48538.1| putative transcriptional regulator, repressor [Erythrobacter sp.
           SD-21]
          Length = 212

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 61/195 (31%), Gaps = 32/195 (16%)

Query: 39  NKS--KRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEK-------- 88
           N S  ++F  +G  R        K+  A    + +   +   +      +          
Sbjct: 32  NPSYLQQFVRKGSPR--------KLEEADRRRLAEFFGVDEVELGADPARPTPRESEDFV 83

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR---HKTQDT 145
            +P L    S   G F +           +     R     +  +          + +  
Sbjct: 84  AVPRLALDASAGPGSFSA---------EEISFDSFRFSRRWLREMGLDGADLSAIRVEGD 134

Query: 146 SMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           SM P  R GD + ++       G+ + +      +  K + +     I L+S N  Y   
Sbjct: 135 SMEPTLRSGDEIFVDRNK--RVGEGVHVVRIGDTLHVKQVQASAPGRIALISANEAYAPI 192

Query: 206 TVEMSDIEWIARILW 220
            +   ++E I R++W
Sbjct: 193 ELARDEVEIIGRVVW 207


>gi|218665577|ref|YP_002425471.1| transcriptional regulator, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|218517790|gb|ACK78376.1| transcriptional regulator, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 243

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 80/238 (33%), Gaps = 43/238 (18%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKILAA 64
           H++I  AI    ++   T + LA K G+   S   S+        R  PS E++F++   
Sbjct: 4   HERIKFAI----KQSGFTQNALAEKLGISRGSI--SQWVSGNIATRTVPSRENLFRLAEL 57

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
           +   I  L     S     +K E  + +          + D      G     V +P + 
Sbjct: 58  SGVPIEWLWSGRESAAHKPQKPEGSLSV--------SEYQDEEGLGDG----EVEIPALN 105

Query: 125 ---------------SPHNGIYA---IQTQD------TRHKTQDTSMLPLYRKGDILILN 160
                                YA   +Q          R +    SM P  + G  + ++
Sbjct: 106 LQVGAGSRIVCETIQEERKFRYARSWLQKYGLDSKYLFRVRVYGDSMEPYIKNGAWITVD 165

Query: 161 SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            +       ++ +     +I  K L  R    I + S N  YP   V  +D+E IA I
Sbjct: 166 KSRTNIQNGKIYVLRSGEEIQVKALFKRPDSGIIIRSNNPAYPDVQVSATDMEHIAII 223


>gi|330963891|gb|EGH64151.1| putative phage repressor [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 238

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM   +R GD L+++  I     D + +    GD+  K L    G ++ ++S N  Y
Sbjct: 151 DGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTLDGDLYIKRLQRMTGGALRMISDNPLY 210

Query: 203 PVDTVEMSDIEWI---ARI--LW 220
           P   +E +D+  +   AR+  +W
Sbjct: 211 PAIIIEGADLTKVHIQARVLLVW 233


>gi|307245346|ref|ZP_07527434.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254300|ref|ZP_07536139.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258759|ref|ZP_07540491.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306853687|gb|EFM85904.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862728|gb|EFM94683.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867110|gb|EFM98966.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 224

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 68/192 (35%), Gaps = 33/192 (17%)

Query: 43  RFGIEGRNRW------PSTES---IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLL 93
           +   +  ++W      PST +   + K LA T     + L     +         ++PL+
Sbjct: 38  KVTPKAVSKWLNAETMPSTANIYLLAKFLAVT----PEWLTYGIGNVIPAAIGTTKVPLI 93

Query: 94  YFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
            +  +G+    D      G   +   +          +A+       K +  SM P +  
Sbjct: 94  SYVQAGAWTGIDDFRETCG---DYEYILTDLDVSGDAFAL-------KIEGDSMEPEFIA 143

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAK------VLISRRGRSIDLMSLNCCYPVDTV 207
           GDI+I++  ++ + G+ +       +   K       L     +  +L+ LN  +   + 
Sbjct: 144 GDIVIIDPKVEPHAGEFVAAINGDYEATFKKYRPLEDLDEYGRQHFELVPLNPDWHSMSS 203

Query: 208 EMSDIEWIARIL 219
              +I    RI+
Sbjct: 204 LKQEI----RII 211


>gi|38229113|ref|NP_938208.1| c repressor [Pseudomonas phage D3112]
 gi|579180|emb|CAA36500.1| putative repressor [Pseudomonas phage D3112]
 gi|37595164|gb|AAQ94439.1| c repressor [Pseudomonas phage D3112]
          Length = 240

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 66/177 (37%), Gaps = 17/177 (9%)

Query: 56  ESIFKILAATNETIC------QLLDLPFSDGRTTEKKEKEIPLL-YFPPSGSGGFFDSGV 108
           E +  I  A   ++       ++   P    ++ E +   IPL      +G G + D   
Sbjct: 67  ELLSAIAKAGRVSLDWLINGEEVAAKPVEGAKSIEGEYVYIPLYDGQVSAGHGSWTDGAT 126

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                 +    + +     + I AI       +    SM PL   GD ++++        
Sbjct: 127 VLVNLAFTRYSLRKKGLDPSSISAI-------RIGGDSMEPLLCDGDTVLVDHTKSTVQD 179

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE---MSDIEWIARILWAS 222
             + +      + AK L  R   S+ ++S N  Y    V    +SD+E I R++WAS
Sbjct: 180 AAVYVVRLDDHLYAKRLQRRFDGSVSIISENKAYTEMIVPKAKLSDLEIIGRVVWAS 236


>gi|223935627|ref|ZP_03627543.1| transcriptional regulator, XRE family [bacterium Ellin514]
 gi|223895635|gb|EEF62080.1| transcriptional regulator, XRE family [bacterium Ellin514]
          Length = 222

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/108 (15%), Positives = 34/108 (31%), Gaps = 3/108 (2%)

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G   +   +           +          +  SM P    GD++  +   +   G+ 
Sbjct: 104 AGTAHDYADLANQIEEVVYTDSRDPNAFALIVEGDSMYPEIAAGDVITFSPNSEPRNGNI 163

Query: 171 LLIKPRT-GDIVAKVLISRRG--RSIDLMSLNCCYPVDTVEMSDIEWI 215
           ++ +      ++ K         R+I L S N  YP  T+      +I
Sbjct: 164 VVARLAENHGVLVKRFRRTGPEGRTIILESTNQDYPPITLPAEAFRFI 211


>gi|215479977|ref|YP_002332426.1| c repressor [Pseudomonas phage MP29]
 gi|169409241|gb|ACA57646.1| c repressor [Pseudomonas phage MP29]
          Length = 240

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 66/177 (37%), Gaps = 17/177 (9%)

Query: 56  ESIFKILAATNETIC------QLLDLPFSDGRTTEKKEKEIPLL-YFPPSGSGGFFDSGV 108
           E +  I  A   ++       ++   P    ++ E +   IPL      +G G + D   
Sbjct: 67  ELLSAIAKAGRVSLDWLINGEEVAATPAEGAKSIEGEYVYIPLYDGQVSAGHGSWTDGAT 126

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                 +    + +     + I AI       +    SM PL   GD ++++        
Sbjct: 127 VLVNLAFTRYSLRKKGLDPSSISAI-------RIGGDSMEPLLCDGDTVLVDHTKSTVQD 179

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE---MSDIEWIARILWAS 222
             + +      + AK L  R   S+ ++S N  Y    V    +SD+E I R++WAS
Sbjct: 180 AAVYVVRLDDHLYAKRLQRRFDGSVSIISENKAYTEMIVPKAKLSDLEIIGRVVWAS 236


>gi|99080630|ref|YP_612784.1| putative phage repressor [Ruegeria sp. TM1040]
 gi|99036910|gb|ABF63522.1| HTH-type transcriptional regulator prtR [Ruegeria sp. TM1040]
          Length = 238

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 49/218 (22%), Positives = 82/218 (37%), Gaps = 37/218 (16%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           EA+DR  +   L+   LA KAG+   S+ + K+   +G+++  + E   KI  A   +  
Sbjct: 36  EALDRAQDATGLSMRKLADKAGV---SYEQLKKV-RQGKSQTTNAEDALKIATAVGVSFE 91

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
           Q +   F    T       I +     +G+    FD+     G     V  P    PH G
Sbjct: 92  QFMSGEFDASPT-------ISIAGKVGAGAQVPVFDAYEKGDGP---QVECPPGIGPH-G 140

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL-----LIKPRTGDIVAKV 184
           + A++        +  SM P+Y  GD+L  +     +  D +     + +   G    K 
Sbjct: 141 VVAVE-------VEGDSMEPVYSAGDLLFYSRNGHDSVPDDVIGYKCVCEDADGMGWVKQ 193

Query: 185 LIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
           + +        L+SLN              W  R+ WA
Sbjct: 194 VKAGDEPGLFHLISLNPTGAN--------MWNVRLKWA 223


>gi|169633405|ref|YP_001707141.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii SDF]
 gi|169152197|emb|CAP01101.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii]
          Length = 254

 Score = 57.3 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 51/149 (34%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
            + +    +  +    +++ +P+  +   G  G+F    +        V          G
Sbjct: 100 EEAVKFVQTPTKPFPIQKRYVPVKAYSKMGMDGYFTDMGYDGNAGDGYVPTHTAGPRAYG 159

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +   ++   + + +  + G    K  I   
Sbjct: 160 I----------KGTGDSMFPAIRNGWYVVCDPDAELVPTEFVQVCLKDGRCTIKEFIGIH 209

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              + L+++N        EM ++E IA I
Sbjct: 210 NGVLSLIAVNGG-ERFFFEMDEVESIAAI 237


>gi|254498006|ref|ZP_05110769.1| phage repressor [Legionella drancourtii LLAP12]
 gi|254352783|gb|EET11555.1| phage repressor [Legionella drancourtii LLAP12]
          Length = 227

 Score = 57.3 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 75/202 (37%), Gaps = 20/202 (9%)

Query: 19  RHNLTPSGLARKAGLDPTSFNKSKRFGIEGR-NRWPSTE---SIFKILAATNETICQLLD 74
           +H  T  GL RKA  + T   K  R     R  R P  E    + K+L  +   +  L D
Sbjct: 12  KHERTIKGLTRKALAELTDSLKISRINNYERGERTPGPEEIKQLAKVLEVSPAFLMCLSD 71

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH----NGI 130
                 +        IPLL +  +         +           +P   S         
Sbjct: 72  DKQGKLKKPLGLGALIPLLNYKQACDPAVCIQEIKNEQYSEIFTLIPISPSLTARIGENA 131

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVA---KVL- 185
           +A++        +D SM+P +RK D+LI++     N GD ++ K     +++    K L 
Sbjct: 132 FALE-------VKDDSMIPEFRKTDVLIIDPETMPNPGDFVIAKLDGDNEVILRKYKQLS 184

Query: 186 ISRRGRSIDLMSLNCCYPVDTV 207
            SR     +L++LN  +    V
Sbjct: 185 ASRTTPEFELIALNENWASLQV 206


>gi|77164141|ref|YP_342666.1| peptidase S24, S26A and S26B [Nitrosococcus oceani ATCC 19707]
 gi|254435083|ref|ZP_05048590.1| Peptidase S24-like domain protein [Nitrosococcus oceani AFC27]
 gi|76882455|gb|ABA57136.1| phage repressor protein, Serine peptidase, MEROPS family S24
           [Nitrosococcus oceani ATCC 19707]
 gi|207088194|gb|EDZ65466.1| Peptidase S24-like domain protein [Nitrosococcus oceani AFC27]
          Length = 225

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 80/221 (36%), Gaps = 24/221 (10%)

Query: 3   SFSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTE--- 56
           +  H +I    ++ +      + + LAR AG + +  ++ +      +G  R    E   
Sbjct: 2   TLKHNQIRLHNLEVLITEAG-SAAKLARMAGTNSSYLSQVRNQLPTKKGTPRSIGDELAG 60

Query: 57  SIFKILAATNETICQLLD-----LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            + K +      +  L          ++           PL+ +  +G+         P 
Sbjct: 61  KLEKAMKKPQGWMDTLPADGTTPQEENNAHDGPDLRSLHPLISWVQAGNWYEVSESFVPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
                 +  P   SP + +          + + +SM P + + D++ ++  +  + G  +
Sbjct: 121 -YGSELLPCPVRCSPESFV---------LRVRGSSMEPKFHEDDLIFVDPNVSADHGKYV 170

Query: 172 LIKPRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           +++     +   K LI   G+   L +LN  +P   +E+ +
Sbjct: 171 VVRLDESNEATFKQLIIEDGKQY-LKALNPDWPNRIIEVDE 210


>gi|85709159|ref|ZP_01040225.1| transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85690693|gb|EAQ30696.1| transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 227

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 3/86 (3%)

Query: 138 TRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
           +    +  SM PL   GD ILI  +      G  ++       ++ K +         L+
Sbjct: 141 SAITVEGDSMEPLLNDGDEILIDRTERAFRDGVHVV--RLGETLMVKRVARAGAGRFALL 198

Query: 197 SLNCCYPVDTVEMSDIEWIARILWAS 222
           S N  YP   V   ++E I R++W S
Sbjct: 199 SQNLAYPPVEVAADELEIIGRVVWKS 224


>gi|319408671|emb|CBI82326.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 206

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 57/185 (30%), Gaps = 40/185 (21%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKE-------------IPLLYFPPSGSGG 102
           E + K L  T  ++ + L      G   +                  +PL+ +  +G+  
Sbjct: 23  EDVAKRLNVTQASVSKWLKDSDPRGSNRDAILALYRELTGESHLTTFVPLMGYIGAGTE- 81

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
             D         +  +    + +     +A        + +  SM P Y+ GD++I+   
Sbjct: 82  -IDPS-------FEQIPEEGL-AQVEIPFAFPDDMIAFEVRGDSMYPAYKDGDMVIVR-- 130

Query: 163 IQVNC---------GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
                         G   +I         K +       IDL+S N   P+  V    + 
Sbjct: 131 ---RRQIKTIESFIGKEAVILTHDNKRYIKQISRGMNGEIDLISWNNVSPIKNV---KVT 184

Query: 214 WIARI 218
           W+  I
Sbjct: 185 WVGEI 189


>gi|13471985|ref|NP_103552.1| phage repressor protein C [Mesorhizobium loti MAFF303099]
 gi|14022730|dbj|BAB49338.1| probable phage repressor protein C [Mesorhizobium loti MAFF303099]
          Length = 234

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 58/188 (30%), Gaps = 34/188 (18%)

Query: 53  PSTESIFKILA-------ATNETICQLL--------DLPFSDGRTTEKKEKEIPLLYFPP 97
           P TE++ K  A       A  +     L            +D         +I +L    
Sbjct: 52  PKTENLLKTAAFLRVDPVALGKGEVVFLDDADALSDAEIVTDAGPMPAGSMDIEVLGAAV 111

Query: 98  SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDIL 157
            G  G F     P G     V  P        ++A+            SM+P Y  GD L
Sbjct: 112 GGDDGDFTFNGEPAG----YVQRPPGVRNLPKVFAL-------HVLSDSMVPRYEPGD-L 159

Query: 158 ILNSAIQVNCGDRLLIKP------RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           I         GD ++I+       + G    K L+ R    + +   N      T     
Sbjct: 160 IYCGGRDAIPGDHVVIETFPEENEKNGKAFVKKLVKRTASELVVEQYNPPK-TLTFNRYA 218

Query: 212 IEWIARIL 219
           I+ + R++
Sbjct: 219 IKHVWRVI 226


>gi|311105237|ref|YP_003978090.1| hypothetical protein AXYL_02046 [Achromobacter xylosoxidans A8]
 gi|310759926|gb|ADP15375.1| helix-turn-helix family protein 5 [Achromobacter xylosoxidans A8]
          Length = 245

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 75/200 (37%), Gaps = 24/200 (12%)

Query: 29  RKAGLDPTSFNKSKRFGIE---------GRNRWPSTESIFKILAATNETICQ-LLDLP-F 77
           R+  L  T  + + R G +         G+  + S E + KI AA    + +  L +   
Sbjct: 38  RRKALGWTILDLANRIGSDVGNVSRLERGKQGY-SDEILAKIAAALGCPVGELFLGVEKE 96

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           S+   T    + IP+L +  +G+       V P  N  + +      S       I+   
Sbjct: 97  SNVELTALGSRRIPVLSYVQAGA---LTESVVPYTNPDDWLLTDLDLSRSAFALRIKGLS 153

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS----- 192
                 + S    + +GD+++++ +++   GD ++ K    +   K    R         
Sbjct: 154 MYSPQSEES----FNEGDLVVIDPSVEPLPGDFVVAKNGDHEATFKKYRPRGVNEKGVVV 209

Query: 193 IDLMSLNCCYPVDTVEMSDI 212
            +L+ LN  YP    + + +
Sbjct: 210 FELVPLNPDYPSVRSDYTQV 229


>gi|160932990|ref|ZP_02080379.1| hypothetical protein CLOLEP_01832 [Clostridium leptum DSM 753]
 gi|156868064|gb|EDO61436.1| hypothetical protein CLOLEP_01832 [Clostridium leptum DSM 753]
          Length = 222

 Score = 56.9 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 72/208 (34%), Gaps = 30/208 (14%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRN----RWPSTESIFKILAATNET 68
           +  + E   L+  G A K G+  ++          G      R P+ +++ +I      +
Sbjct: 21  LKELRENAGLSQYGFAEKIGISQSTV---------GNWEAGSREPNFKTMERIADFFGVS 71

Query: 69  ICQLLDLPFSDGRTTEKK---EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
           +  LL      G   E      K IP++   P+G+         P     + +   EI  
Sbjct: 72  VDYLLGRETVAGGPPEPSVPGSKWIPVIGTIPAGT---------PVEAIEDILDYEEITP 122

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
                 A Q +    K +  SM P    GD++I+        G+  ++     +   K +
Sbjct: 123 Q----MASQGEHFALKIKGQSMEPKISDGDVVIVRKQDDCENGEIAVVLVNGDEATVKRI 178

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
             +    + L+  N  Y       ++IE
Sbjct: 179 -KKGPEGLMLIPNNPAYEPMFYSNAEIE 205


>gi|319782474|ref|YP_004141950.1| peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168362|gb|ADV11900.1| Peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 234

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 58/188 (30%), Gaps = 34/188 (18%)

Query: 53  PSTESIFKILA-------ATNETICQLL--------DLPFSDGRTTEKKEKEIPLLYFPP 97
           P TE++ K  A       A  +     L            +D         +I +L    
Sbjct: 52  PKTENLLKTAAFLRVDPVALGQGQVVFLDDAGPVADAEIVTDAGPLPASSMDIEVLGAAV 111

Query: 98  SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDIL 157
            G  G F     P G     V  P        ++A+            SM+P Y  GD L
Sbjct: 112 GGDDGDFTFNGEPAG----YVQRPPGVRNLPKVFAL-------HVLSDSMVPRYEPGD-L 159

Query: 158 ILNSAIQVNCGDRLLIKP------RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           I         GD ++I+       R G    K L+ R    + +   N      T     
Sbjct: 160 IYCGGRDAVPGDHVVIETFPEENERNGKAFIKKLVKRTAGELVVEQYNPPK-TLTFNRYA 218

Query: 212 IEWIARIL 219
           I+ + R++
Sbjct: 219 IKHVWRVI 226


>gi|170723210|ref|YP_001750898.1| putative phage repressor [Pseudomonas putida W619]
 gi|169761213|gb|ACA74529.1| putative phage repressor [Pseudomonas putida W619]
          Length = 248

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 83/257 (32%), Gaps = 52/257 (20%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESI 58
           M +   + +   +  +  RH L+P+ L R+ G+  ++ ++  S++         PS   +
Sbjct: 1   MQAMQKRNVATVLRELLARHGLSPTELHRRTGVPQSTLSRILSEKIAD------PSDRHV 54

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            KI      +  QL             +E  +P            +D    P  +  + V
Sbjct: 55  SKIADYFGVSTEQL----RGRAELGASREAALPAHGHADLSDISLWDDE-TPVED--DEV 107

Query: 119 GVPEIRS----PHNGIYAIQTQDTR---------------------HKTQDTSMLPLYRK 153
            VP +R       +G + I+  +                          +  SMLP+ R 
Sbjct: 108 SVPFLREVELAAGSGRFVIEESERARLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRD 167

Query: 154 GDILILNSA----IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT--- 206
           G  + +N+       +  GD L      G +  K +       I L S N     D    
Sbjct: 168 GATVGVNTGKCSIGDIIDGD-LYAINHNGQLRVKQVYRLPTG-IRLRSFNRDEHPDEDYS 225

Query: 207 ---VEMSDIEWIARILW 220
              ++   I  +  + W
Sbjct: 226 FQLLQEEQISLLGHVFW 242


>gi|145298596|ref|YP_001141437.1| phage repressor [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851368|gb|ABO89689.1| phage repressor [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 227

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 75/223 (33%), Gaps = 43/223 (19%)

Query: 14  DRMAERH---NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           DR+  R    NL+ + LA+  G+   S  K +    + + R+     +  + AA   T+ 
Sbjct: 5   DRIFSRRTALNLSKTALAKAIGVSDVSVGKWESGLNQPKGRY-----LNDLAAALGVTVD 59

Query: 71  QLLDLPFSDGRTTEK-----------KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            LL                       + + IP++ +  +G+              W  + 
Sbjct: 60  WLLAGSGDGPEQPIPGYHNVEPAVIPQGRRIPVISYVHAGN--------------WREMC 105

Query: 120 VPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                   N  Y      I         +  SMLP +++GD++I++       GD ++ +
Sbjct: 106 EQATTFDGNVEYVTASVDIGPCGFGLWMRGDSMLPQFKEGDLIIVDPDEVPQPGDYVVAR 165

Query: 175 PRTGDIVAKVLISRRG-----RSIDLMSLNCCYPVDTVEMSDI 212
               +   K    R          +L+ LN  YP    +   I
Sbjct: 166 NGNNEATFKKYRPRGVDENGQEVFELVPLNDDYPSMHSDRQHI 208


>gi|88706898|ref|ZP_01104597.1| Peptidase S24-like protein [Congregibacter litoralis KT71]
 gi|88698820|gb|EAQ95940.1| Peptidase S24-like protein [Congregibacter litoralis KT71]
          Length = 222

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG-DIVAKVLISRRGRSID 194
           +    + +  SM P +R+G+++ ++    V  G  ++++     ++  K LI   G+   
Sbjct: 132 ETFVLRVRGASMEPKFREGELIFVDPQAPVEHGKFVVVRLEESNEVTFKQLILEEGKKY- 190

Query: 195 LMSLNCCYPVDTVEM 209
           L +LN  +P   +E+
Sbjct: 191 LKTLNPDWPNRIIEV 205


>gi|299531647|ref|ZP_07045052.1| putative phage repressor [Comamonas testosteroni S44]
 gi|298720363|gb|EFI61315.1| putative phage repressor [Comamonas testosteroni S44]
          Length = 208

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 52/147 (35%), Gaps = 16/147 (10%)

Query: 64  ATNETICQLLDLPFSDG-RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AT     + +   F +  + T    +  P++    +G          P G+ +  V   E
Sbjct: 48  ATGTGPEKGVHADFDENVKPTPPGMRAYPVISKIQAGLVKEIVCPYEP-GDGF-AVEFGE 105

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             +     +         + +  SMLP +R GD ++++  +    GD +  +    +   
Sbjct: 106 DDASDWAFF--------FEIEGDSMLPEFRPGDRVLIDPEVSPRPGDFVAARNTRQEATF 157

Query: 183 KV-----LISRRGRSIDLMSLNCCYPV 204
           K      +        +L+ LN  YPV
Sbjct: 158 KKYRVRGIDEAGQEIFELVPLNDDYPV 184


>gi|295101168|emb|CBK98713.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Faecalibacterium prausnitzii L2-6]
          Length = 210

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 75/218 (34%), Gaps = 41/218 (18%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           ++  ++ + LA K G+   +  K  S +   +     P+T  + +I    + T   LL L
Sbjct: 12  KQKGISQAELASKLGVTQQAVGKWESGKSSPD-----PAT--VARIAEILSTTADFLLGL 64

Query: 76  PFSDGRTTEKKEK--------EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                  T  +E+         IP++    +G G                +   E     
Sbjct: 65  YRPVSNVTTPEERFFGNYAESLIPVIGTVKAGYG---------------ALAFEEDYGQE 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLI 186
                  +       +  SM P  + GD+ +++    +  GD  +L+    G+     L 
Sbjct: 110 YARVKDPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLVYGDEGE---GTLK 166

Query: 187 S--RRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RIL 219
              +RG  + L   N  Y    ++  D+  +    R++
Sbjct: 167 RYIQRGNCVVLQPFNPAYNELVIKGEDLNRLHIAGRVV 204


>gi|254360461|ref|ZP_04976610.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
 gi|153091001|gb|EDN73006.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
          Length = 218

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 51/144 (35%), Gaps = 20/144 (13%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
                  ++PL+ +  +G     D      G   +   +          +A++       
Sbjct: 76  PASLGMTKVPLISYIQAGQWTGIDDFRETCG---DYEYILTDLEVSEDAFALE------- 125

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK------VLISRRGRSIDL 195
            +  SM P + +GD +I++  +Q + G+ +       +   K       L     +  +L
Sbjct: 126 IKGDSMEPDFIEGDRVIIDPDVQPHAGEFVAAINGDYEATFKKYRPLEDLDEYGRQHFEL 185

Query: 196 MSLNCCYPVDTVEMSDIEWIARIL 219
           ++LN  Y   +    +I    RI+
Sbjct: 186 IALNPDYHKLSTLKQEI----RII 205


>gi|262279851|ref|ZP_06057636.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260202|gb|EEY78935.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 263

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 47/135 (34%), Gaps = 11/135 (8%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
              ++ +P+  +   G  G+F    F        +      S     YA++         
Sbjct: 123 PSSKRWVPVKAYSKMGMDGYFVDMGFEGNGGDGYIPTHTAGSK---AYAVKGT------- 172

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM P  R G  ++ +   +    + + +  + G    K  I  +   + L+++N    
Sbjct: 173 GDSMFPAIRNGWYVVCDPDAEPVPMEFVQVCLKDGRCTIKEFIGIQNDVLSLIAVNGG-E 231

Query: 204 VDTVEMSDIEWIARI 218
             T  M ++E I  I
Sbjct: 232 RLTFNMDEVESITAI 246


>gi|299771254|ref|YP_003733280.1| putative repressor protein from bacteriophage [Acinetobacter sp.
           DR1]
 gi|298701342|gb|ADI91907.1| putative repressor protein from bacteriophage [Acinetobacter sp.
           DR1]
          Length = 262

 Score = 56.1 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

Query: 88  KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM 147
           + +P+  +   G  G+F    +        V            YAI+           SM
Sbjct: 126 RWVPVKAYSKMGMDGYFTDMGYDGNAGDGYVPTHTAGDRS---YAIKGT-------GDSM 175

Query: 148 LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
            P  R G  ++ +   ++   + + +  + G    K  I      ++L+++N      T 
Sbjct: 176 YPAIRNGWYVVCDPDAELTPTEFVQVCLKDGRCTIKEFIGIHNNVLNLLAVNGG-ERLTF 234

Query: 208 EMSDIEWIARI 218
           +M ++E I  I
Sbjct: 235 DMDEVESITAI 245


>gi|240948773|ref|ZP_04753145.1| phage repressor [Actinobacillus minor NM305]
 gi|240296989|gb|EER47567.1| phage repressor [Actinobacillus minor NM305]
          Length = 218

 Score = 56.1 bits (134), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 50/144 (34%), Gaps = 20/144 (13%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
                  +IPL+ +  +G     D      G   +   +       +  +A++       
Sbjct: 76  PASIGMTKIPLISYIQAGQWTGIDDFRETCG---DYEYILTDLDVSDDAFALE------- 125

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG------RSIDL 195
            +  SM P + +GD++I++     + G+ +       +   K                +L
Sbjct: 126 IKGDSMTPDFLEGDVVIIDPNEPPHAGEFVAAINGNYEATFKKYRPLGEVDNFGREHFEL 185

Query: 196 MSLNCCYPVDTVEMSDIEWIARIL 219
           ++LN  YP  +    +I    RI+
Sbjct: 186 IALNPDYPKLSTLKQEI----RII 205


>gi|194430884|ref|ZP_03063221.1| repressor protein C2 [Escherichia coli B171]
 gi|194411072|gb|EDX27557.1| repressor protein C2 [Escherichia coli B171]
 gi|324014358|gb|EGB83577.1| helix-turn-helix protein [Escherichia coli MS 60-1]
          Length = 207

 Score = 56.1 bits (134), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 44/126 (34%), Gaps = 18/126 (14%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA---IQTQDTR 139
            E   + IP+L +  +             G       + ++      I A   I      
Sbjct: 70  AEISTRRIPILSYVQA-------------GELTEARDITDLTGEFEYILADSDIPETCFA 116

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS--IDLMS 197
            +    SM P +++GDI+I++  +    G+ ++ K    +   K            +L+ 
Sbjct: 117 LRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNDGHEATFKKYRPLGIGIDDFELIP 176

Query: 198 LNCCYP 203
           LN  YP
Sbjct: 177 LNPDYP 182


>gi|150397120|ref|YP_001327587.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150028635|gb|ABR60752.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 238

 Score = 56.1 bits (134), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 74/237 (31%), Gaps = 41/237 (17%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG--RNRWPST---ESIFKILAA 64
           W A +++A R     S LA   G+      +SK    +   + R  S    E++ +    
Sbjct: 11  WLA-EKLAARG--VASKLAEATGMSNDKITRSKELHSDDPKKRRQISLQEIEAMARFFRE 67

Query: 65  TNETICQLLDLPFSDGRTTEKKE----------------KEIPLLYFPPSGSGGFFDSGV 108
                 Q+             K                   IPL     +G+ G F    
Sbjct: 68  LPPGFEQMTRWLEDLSPAPTAKPIPNASFPPRWQQFPGDASIPLRGHIAAGANGRF---- 123

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
              G    TV  P       G YA+Q           S  P +  G+   +N   +V  G
Sbjct: 124 IMNGQDIATVFCPPGLEGVEGAYAVQ-------VDGRSGEPRFLHGETAWVNPHQKVRQG 176

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSL---NC---CYPVDTVEMSDIEWIARIL 219
           D ++++    D ++  L     RS D++ L   N               +  + +++
Sbjct: 177 DDVVVQILEDDELSSYLKRFVSRSADVLRLYQYNPGKGESHDLEFPTDKVFSVHKVV 233


>gi|153007564|ref|YP_001368779.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
 gi|151559452|gb|ABS12950.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
          Length = 235

 Score = 55.7 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 43/144 (29%), Gaps = 17/144 (11%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
           G         +P+      G  G F       G     V  P   +   G Y +Q     
Sbjct: 98  GEKVTGAGVMVPVYGQAVGGIDGQF----LMNGTILYEVMAPPQIAEIAGAYGVQ----- 148

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-----IVAKVLISRRGRSID 194
                 SM P Y  G++  ++   +V  GD ++ + +  +        K  +      + 
Sbjct: 149 --ISGDSMFPRYEDGEVAFVDPRRRVKKGDYVVAQIQFDEHEPPHAYVKRFVRHNAEELV 206

Query: 195 LMSLNCCYPVDTVEMSDIEWIARI 218
           L   N      T +   +  +  I
Sbjct: 207 LSQFNPPKE-LTFDHDQVVSVHFI 229


>gi|291283823|ref|YP_003500641.1| hypothetical protein G2583_3129 [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763696|gb|ADD57657.1| hypothetical protein G2583_3129 [Escherichia coli O55:H7 str.
           CB9615]
          Length = 224

 Score = 55.7 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 44/126 (34%), Gaps = 18/126 (14%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA---IQTQDTR 139
            E   + IP+L +  +             G       + ++      I A   I      
Sbjct: 87  AEISTRRIPILSYVQA-------------GELTEARDITDLTGEFEYILADSDIPETCFA 133

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS--IDLMS 197
            +    SM P +++GDI+I++  +    G+ ++ K    +   K            +L+ 
Sbjct: 134 LRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNDGHEATFKKYRPLGIGIDDFELIP 193

Query: 198 LNCCYP 203
           LN  YP
Sbjct: 194 LNPDYP 199


>gi|218463233|ref|ZP_03503324.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli Kim 5]
          Length = 30

 Score = 55.7 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/28 (60%), Positives = 23/28 (82%)

Query: 196 MSLNCCYPVDTVEMSDIEWIARILWASQ 223
           MSLN  +   T+++SD+EWIARI+WASQ
Sbjct: 3   MSLNPEHANRTLDLSDVEWIARIIWASQ 30


>gi|87200384|ref|YP_497641.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136065|gb|ABD26807.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
          Length = 233

 Score = 55.7 bits (133), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 53/148 (35%), Gaps = 9/148 (6%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            +     R    +  +IP L    S   G   +   P+G     +          G+   
Sbjct: 89  GIVVPTTRAALAEWADIPRLPLGASAGPGALPAEEIPSGR----LRFSHRWLKGQGL--E 142

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
               +  + +  SM P  R GD ++++     +  G  ++       ++ K L    G  
Sbjct: 143 PAMLSVIEVEGDSMEPTLRDGDEILVDRTARPMRAGIHVI--RLDDMLLVKRLEPGPGGI 200

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARILW 220
           + ++S N  YP       ++E + R++W
Sbjct: 201 LRVISDNGAYPRIERPAHEVEIVGRVVW 228


>gi|158338892|ref|YP_001520069.1| S24 family peptidase [Acaryochloris marina MBIC11017]
 gi|158309133|gb|ABW30750.1| peptidase, S24 family [Acaryochloris marina MBIC11017]
          Length = 227

 Score = 55.3 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 52/148 (35%), Gaps = 8/148 (5%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
            +DG   +    +IPL         G           +   +         + +      
Sbjct: 79  RADGGIGDGTYVQIPLYDVRAGAGEGMIAED----KEQIEELMAFSRSWIRSELRTSPAH 134

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
            +       SM P  R GD+++++        D + +  R G +  K L    G+ + ++
Sbjct: 135 LSLIHVSGDSMEPTLRPGDVVLVDQHQAEGGTDGVYVLRRDGHLQIKRLHWLSGKVLKII 194

Query: 197 SLNCCYPVDTVEMSDI----EWIARILW 220
           S N  Y    V++S +    + I R++W
Sbjct: 195 SDNPIYQPIEVDLSQLTEEFQIIGRVIW 222


>gi|220923732|ref|YP_002499034.1| putative phage repressor [Methylobacterium nodulans ORS 2060]
 gi|219948339|gb|ACL58731.1| putative phage repressor [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score = 55.3 bits (132), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 43/130 (33%), Gaps = 17/130 (13%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           S      +    +P+L     GS G     +F  G    +V  P       G YA+    
Sbjct: 106 SAPVAAPRYGGLMPVLGVAKGGSDGRL---IF-NGQVIESVPRPAALENVEGAYAV---- 157

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP---RTGDI---VAKVLISRRGR 191
                   SM P ++ G+ + ++       GD ++++      GD      K  ++    
Sbjct: 158 ---YVSGDSMHPRFKAGEQVWVHPHRPPKRGDDVVVQLYAEDEGDPPEGYIKEFVAWTPS 214

Query: 192 SIDLMSLNCC 201
            + L   N  
Sbjct: 215 MLILYQHNPA 224


>gi|319405045|emb|CBI78654.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 205

 Score = 54.9 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 60/187 (32%), Gaps = 45/187 (24%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKE-------------IPLLYFPPSGSGG 102
           E + + L  T  ++ + L      G   +   +              +PL+ +  +G+  
Sbjct: 23  EDVARRLNVTQASVSKWLKDSDPRGSNRDAILELYKELKGDNHLTTFVPLMGYIGAGTQ- 81

Query: 103 FFDSG--VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
             D      P  +    + +P         + +       + +  SMLP+Y+ GD++I  
Sbjct: 82  -IDPSFEQIPE-DGLEQIEIP---------FVLPDDMIAFEVKGDSMLPVYKNGDMVI-- 128

Query: 161 SAIQVNC---------GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
                           G   +I         K +       IDL+S N       ++ + 
Sbjct: 129 ---ARRRQIKTIEYFFGKEAVILTHDNKRYIKQISRGMNGEIDLLSWNA----PPIKNAK 181

Query: 212 IEWIARI 218
           I WI  I
Sbjct: 182 ITWIGEI 188


>gi|158334468|ref|YP_001515640.1| S24 family peptidase [Acaryochloris marina MBIC11017]
 gi|158304709|gb|ABW26326.1| peptidase, S24 family [Acaryochloris marina MBIC11017]
          Length = 227

 Score = 54.9 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC 201
               SM P  R GD+++++        D + +  R G +  K L    G+ + ++S N  
Sbjct: 140 VSGDSMEPTLRPGDVVLVDQHQAEGGTDGVYVLRRDGHLQIKRLHWLSGKVLKIISDNPI 199

Query: 202 YPVDTVEMSDI----EWIARILW 220
           Y    V++S +    + I R++W
Sbjct: 200 YQPIEVDLSQLTEEFQIIGRVIW 222


>gi|120610369|ref|YP_970047.1| putative phage repressor [Acidovorax citrulli AAC00-1]
 gi|120588833|gb|ABM32273.1| putative phage repressor [Acidovorax citrulli AAC00-1]
          Length = 220

 Score = 54.9 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 58/153 (37%), Gaps = 11/153 (7%)

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT E   Q+L  P +    T  +  ++  +Y    G+GG       P    W     P  
Sbjct: 62  ATGEG--QMLSQPATPTNATPYETTKVRPVYVVGRGNGGA-----MPE-RLWTDGDFPVG 113

Query: 124 RSPHNGIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
            +      A    +    + +  SM+P Y  G+  ++    +    D +L++   G  + 
Sbjct: 114 GTDECADVATNDPRAFLIRVEGPSMVPRYNPGEYALVEPDTEPEIEDDVLVRLVDGQTIL 173

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           K L+SRRG    L S N    V      ++ W+
Sbjct: 174 KRLLSRRGGW-RLGSYN-SMDVLFYSFEEVTWV 204


>gi|237748145|ref|ZP_04578625.1| repressor protein cI [Oxalobacter formigenes OXCC13]
 gi|229379507|gb|EEO29598.1| repressor protein cI [Oxalobacter formigenes OXCC13]
          Length = 217

 Score = 54.9 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 49/138 (35%), Gaps = 10/138 (7%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV--FPTGNKWNTVGVPEIRSPHNGI 130
           +            K  ++PL+ +  +G+   +   +  F  G+    +  P   S H  +
Sbjct: 67  MGTTRGYFGPPPDKIGQLPLISWVQAGN---WTEAIDNFAPGDAEEWIPCPFKHSQHAFV 123

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRR 189
             +  +   +   D S    +  GD + ++   +   G  ++++         K L+   
Sbjct: 124 LKVVGKSMYNPGNDKS----FNDGDYIAVDPCREARNGSMVVVRLDDDHTATFKQLLVEP 179

Query: 190 GRSIDLMSLNCCYPVDTV 207
                LM+LN  +P   +
Sbjct: 180 NGERMLMALNPSWPNRII 197


>gi|315143625|gb|EFT87641.1| peptidase S24-like domain protein [Enterococcus faecalis TX2141]
          Length = 228

 Score = 54.9 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 54/147 (36%), Gaps = 15/147 (10%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
           +L   +  T  +  K +PL+    +           P   ++  + V      H+  +  
Sbjct: 95  ELDKQNFETESRNRKVVPLVGKTAAN----------PAVLEYGDIDV----EQHSFAHVP 140

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRRGRS 192
           +  D     Q  SM PL + G I+       V  G+  +++    G    KV+     + 
Sbjct: 141 EGADCAINIQGDSMEPLIKDGSIVFYKKQCDVENGEIAIVEIDNDGVTCKKVIKDYSNKQ 200

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARIL 219
           I L S+N  Y    +E   I  I +++
Sbjct: 201 IILRSINTKYEDRILENEKIRIIGKVI 227


>gi|261493124|ref|ZP_05989660.1| putative repressor protein CI [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496453|ref|ZP_05992836.1| putative repressor protein CI [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307886|gb|EEY09206.1| putative repressor protein CI [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311212|gb|EEY12379.1| putative repressor protein CI [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 279

 Score = 54.6 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 38/92 (41%), Gaps = 3/92 (3%)

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           ++   +    +     + P    G+ +++    ++   D +LIK + G  + +VL++ R 
Sbjct: 184 FSQDVRAYAVRIDGEKLEPRIVSGEYIVVEPGAKLQSYDEVLIKLKDGRYMIRVLLTGRN 243

Query: 191 RSIDLMSLNCCYPVDTVEMSDI---EWIARIL 219
           +       N        + S I   E+IA I+
Sbjct: 244 KEWRYADPNTMQQDTDFDPSQIETMEYIAAII 275


>gi|239502427|ref|ZP_04661737.1| Repressor protein C2 [Acinetobacter baumannii AB900]
          Length = 232

 Score = 54.6 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 57/149 (38%), Gaps = 28/149 (18%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF----PTGNKWNTVGVPEIRSPHNGIYA 132
            S+   T+   + IPLL +  +   G F    +    P G  + T            +++
Sbjct: 84  ESNVGPTKNNLRTIPLLDYVQA---GLFHDVGYDGINPIGESYTTY----QGYKPECVFS 136

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR--- 189
           +       K +  SM P ++ GD ++++++++   G  ++ +     I        R   
Sbjct: 137 L-------KVEGNSMSPEFKAGDEIVVDASLEPKPGSLVIAQEVQHGIARTTFKKYRVIG 189

Query: 190 -----GRSIDLMSLNCCYPVDTVEMSDIE 213
                   ++L+ LN  YP  T   + IE
Sbjct: 190 INEFGVDVVELVPLNPDYP--TYNSTQIE 216


>gi|264678802|ref|YP_003278709.1| prophage repressor [Comamonas testosteroni CNB-2]
 gi|262209315|gb|ACY33413.1| putative prophage repressor [Comamonas testosteroni CNB-2]
          Length = 179

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 58/171 (33%), Gaps = 32/171 (18%)

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           W    ++ + L+ T  +  +   L            + +P++ +  +G            
Sbjct: 19  WMDQPALREELSTTGGSNAEFTKLE---------GVRRVPVISYVQAGL----------- 58

Query: 112 GNKWNTV-GVPEIRSPHNGIYAIQT---QDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
              W  +  V +    H+ +        +      +  SM P +++GD +I++ +++   
Sbjct: 59  ---WTEIVSVFQPSDAHDWLITSDKHSKETFVLTIRGNSMEPDFKEGDAVIIDPSVKPRP 115

Query: 168 GDRLLIKPRTGDIVAKVLISRR-----GRSIDLMSLNCCYPVDTVEMSDIE 213
           G  +  K    +   K    R          +L+ LN  YP    +   IE
Sbjct: 116 GSFVAAKNGREEATFKKYRPRSIDVLGNEVFELVPLNEDYPTMRSDEQPIE 166


>gi|326386994|ref|ZP_08208604.1| putative phage repressor [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208175|gb|EGD58982.1| putative phage repressor [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 250

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 72/230 (31%), Gaps = 37/230 (16%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
            +A    ++ S L+   G +       ++F  +G  R        K+      T+     
Sbjct: 29  ALARERGVSLSALSGMIGRNAAYL---QQFVRKGSPR--------KLEENDRRTLAMFFG 77

Query: 75  LPFSD-GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR-SPHNGIYA 132
           +  S+ G     +   +           G   S   P   +W  +    +  S   G  A
Sbjct: 78  VDESELGAPAANEVAVVQSGGRLAFARNGSARSASRPVEAEWVDIPRLALGASAGPGTLA 137

Query: 133 IQTQDTR---------------------HKTQDTSMLPLYRKGDILILNSAI-QVNCGDR 170
           +   ++                       +    SM P    GD ++++ +      G  
Sbjct: 138 LDEAESGRLRFSQRWLRTLGLDPGQLSVIEVAGDSMEPTLHDGDEILVDRSPRPWRDGIH 197

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           ++       ++ K L +    +I +MS N  YP       D+  I R++W
Sbjct: 198 VV--RIDEVLLVKRLETGPAGTIRVMSDNPAYPRIERAYEDVAIIGRVVW 245


>gi|167032201|ref|YP_001667432.1| putative phage repressor [Pseudomonas putida GB-1]
 gi|166858689|gb|ABY97096.1| putative phage repressor [Pseudomonas putida GB-1]
          Length = 234

 Score = 54.2 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM   +  GD L+++  I     D + +    GD+  K L    G  + ++S N  YP
Sbjct: 148 GDSMTGTFADGDALLVDRGITEVKTDAIYVFTLDGDLYIKRLQRLTGGQLRMISDNPIYP 207

Query: 204 VDTVEMSDIEWI---ARILWA 221
             T+++S I+ +   AR+L A
Sbjct: 208 PITIDLSMIDRMHIQARVLLA 228


>gi|148912804|ref|YP_001293383.1| Repressor protein [Pseudomonas phage F10]
          Length = 224

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 82/230 (35%), Gaps = 39/230 (16%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           +I    +   LT + LA++ GLD TS +  ++   +G      T  I ++ AA   +   
Sbjct: 6   SIKAARKHAKLTQAQLAQRVGLDQTSISNLEQGKSQG------TAYIAQLAAACGVSALW 59

Query: 72  LLDLP--------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTV 118
           L                  +EK    IP          G+F+              W   
Sbjct: 60  LAAGHGSMNNNEEVPPRAPSEKDYALIPQYTARGECGDGYFNDHVETTEGLVFKRDW--- 116

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR--LLIKPR 176
            +  + S    ++ I  +         SM P   +GD+++ +   ++   D+   +I+  
Sbjct: 117 -LKRVNSKPENLFVIYAE-------GDSMEPYIFEGDVVLFD-VAKIEPQDKQVYVIRRP 167

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCC---YPVDTVEMS---DIEWIARILW 220
            G I  K L  +   +  + S N     YP +    +   D+  I R++W
Sbjct: 168 DGGISIKRLNQQLSGAWLIRSDNPDKTAYPDEIASETSVHDLPIIGRVIW 217


>gi|237731126|ref|ZP_04561607.1| P22 repressor protein c2 [Citrobacter sp. 30_2]
 gi|226906665|gb|EEH92583.1| P22 repressor protein c2 [Citrobacter sp. 30_2]
          Length = 208

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 59/162 (36%), Gaps = 20/162 (12%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV-FPT 111
           P  ES+ K+    N +I   +            K + IP++ +  +G      +   F  
Sbjct: 43  PGGESLSKLAKYFNTSID-YILYGTEFEGNLITKMRRIPVISWVQAGQFTECKAAEVFSE 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVN 166
            +KW    +       +  +A++        +  SM     LP   +G  +I++   +  
Sbjct: 102 VDKWVETSL----RIGDSAFALE-------VKGDSMTNPNGLPTIPEGATVIVDPDAEPL 150

Query: 167 CGDRLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
            G  ++ +     +   K L+    +   L+ LN  YP  ++
Sbjct: 151 HGKIVVARLDGTNEATVKKLVIDGPQKF-LVPLNPRYPNISI 191


>gi|146342189|ref|YP_001207237.1| putative LexA repressor [Bradyrhizobium sp. ORS278]
 gi|146194995|emb|CAL79020.1| putative LexA repressor [Bradyrhizobium sp. ORS278]
          Length = 208

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 80/211 (37%), Gaps = 44/211 (20%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I+R  E+   T  GLAR  G+ P +                    + +IL    + + + 
Sbjct: 7   IERALEKPGKTKGGLARAMGVRPGA--------------------VSEILG--GQRLIKA 44

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
            ++P     T   +   +P++     G+G   +         +  V +  I       + 
Sbjct: 45  AEIPL---ITEYLELNSVPIMG--RVGAGSVIEPD-------YEQVPLEGIG-EVALPFP 91

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNC--GDRLLIKPRTGDIVAKVLIS- 187
           I  +    +    SMLP Y  GD++++       ++   G+  +++ ++G+   K +   
Sbjct: 92  IFEETIAFEVTGDSMLPKYENGDVIVVYKEQRHPLSSYYGEEAVVRLKSGERYLKTIERG 151

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +    ++L S N   P+  V    ++WI  I
Sbjct: 152 KSPSVVNLKSFN-AKPIVGV---KLDWIGEI 178


>gi|296107978|ref|YP_003619679.1| hypothetical protein lpa_03412 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295649880|gb|ADG25727.1| hypothetical protein lpa_03412 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 231

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 71/175 (40%), Gaps = 19/175 (10%)

Query: 16  MAERHNLTPSGLARKAGLDPTSFNK-SKRFGIEGRNRWPSTESIFKILAAT-NETICQLL 73
           + + +N++ S LAR  GL   + ++ +     + R       S  K +AA  N ++  LL
Sbjct: 29  LMKENNVSESDLARALGLPYNTIHRLASGHTTDPRI------STLKSIAAYFNVSLDTLL 82

Query: 74  DLPFSDGRT--TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           +   S      T    K +P++ +    +  F  S        W  + +  I +     Y
Sbjct: 83  NPIESVTNPLKTNSNPKAVPIISWEQISNNEFLSSIDHQNWVNWLPIPLVSIDNLSLNAY 142

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVL 185
           A++++         SM P +  G   +++   +   GD +LIK  + G +  + L
Sbjct: 143 ALESRP--------SMYPRFPTGTFFVIDPECKPIDGDLILIKIKKDGAVSLREL 189


>gi|54293108|ref|YP_125523.1| hypothetical protein lpl0147 [Legionella pneumophila str. Lens]
 gi|53752940|emb|CAH14376.1| hypothetical protein lpl0147 [Legionella pneumophila str. Lens]
          Length = 234

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 82/213 (38%), Gaps = 34/213 (15%)

Query: 21  NLTPSGLARKAG-LDPTSFNKSKRFGI--EGRNRWPSTESIFKILAATNETICQLLDLPF 77
            LT   L   AG L  T      R     +G  R P  E I  +  A + +   L+ L  
Sbjct: 32  GLTLKALGELAGGLKQT------RLTNWEQGV-RTPGPEEIKSLAEALDVSPAYLMCLSD 84

Query: 78  SDGRTTEKKEKE-IPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-------VPEIRSPHNG 129
                  KK    IPLL    +       + +   G   +          +PE+      
Sbjct: 85  EAQVKVVKKTSHLIPLLDHHQACQARLHVNTIRVQGTCGDAALISVSAALLPELSDE--- 141

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT---GDIVAKVLI 186
            +A+       K  D SM+P  R GD+LI++ +I+   GD +++K  +     +     +
Sbjct: 142 AFAL-------KMTDESMMPEIRVGDVLIVDPSIEPAPGDFVVVKVPSISNAIVCKYRKL 194

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           S      +L++ N  +P  TV  +DI+  A I+
Sbjct: 195 SYTSPEFELLTANDNWPNITV-TADID--AEII 224


>gi|289679295|ref|ZP_06500185.1| transcriptional repressor pyocin R2_PP [Pseudomonas syringae pv.
           syringae FF5]
          Length = 244

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 8/121 (6%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
             +  ++PL+ +  +G+  + ++  F   +  + +  P   S +     ++     ++  
Sbjct: 110 PLRFGKVPLISWVQAGA--WCEAANFDPYDNEDWISCPVPISKNGFALKVRGDSMTNQGS 167

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSIDLMSLNCCY 202
             S    Y  G I+ ++  I+ N GDR++ + PRT ++  KVL+   GR   L  +N  Y
Sbjct: 168 GRS----YPAGCIIFVDPDIEANPGDRVIARVPRTDEMTFKVLVEDAGRQF-LRPINPQY 222

Query: 203 P 203
           P
Sbjct: 223 P 223


>gi|307310240|ref|ZP_07589889.1| putative phage repressor [Sinorhizobium meliloti BL225C]
 gi|306899792|gb|EFN30417.1| putative phage repressor [Sinorhizobium meliloti BL225C]
          Length = 209

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 49/130 (37%), Gaps = 20/130 (15%)

Query: 81  RTTEKKEKEIPLLYFPP-SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
            T     K++P+L     S   G F      T +  + V  P        IY++      
Sbjct: 66  PTNSAMPKDVPVLGTAAGSHHRGAFQL----TSDAIDYVRRPPALMGTKDIYSL------ 115

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG--------DIVAKVLISRRGR 191
              + +SM P Y +GD++ ++       GD ++++ R G        +    + + R G 
Sbjct: 116 -YVEGSSMEPQYWQGDLVYVHPHKPARSGDAVVVQCRIGDEEPDGTVEATIGLYVRRTGE 174

Query: 192 SIDLMSLNCC 201
           ++ +   N  
Sbjct: 175 ALIIRKHNPP 184


>gi|150396878|ref|YP_001327345.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150028393|gb|ABR60510.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 233

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 82/231 (35%), Gaps = 53/231 (22%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT   H +I E +  M    +L+P   + KAGL   +     R  +  R++ P+     K
Sbjct: 1   MTETIHDRIKERLRIM----DLSPQAASMKAGLSKDTL----RKLLANRDQLPT----GK 48

Query: 61  ILAATNETICQ-----LLDLPFSDGRTTEKK----------------EKEIPLLYFPP-S 98
            L+A    +       L        +  + +                 K++P+L     S
Sbjct: 49  TLSALAPALEVSEQWLLTGQDSGPSQPVQPQQEVRVANIELPTNSAMPKDVPVLGTAAGS 108

Query: 99  GSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILI 158
              G F      T +  + V  P        IY++         + +SM P Y +GD++ 
Sbjct: 109 HHRGAFQL----TSDAIDYVRRPPALMGTKDIYSL-------YVEGSSMEPQYWQGDLVY 157

Query: 159 LNSAIQVNCGDRLLIKPRTG--------DIVAKVLISRRGRSIDLMSLNCC 201
           ++       GD ++++ R G        +    + + R G ++ +   N  
Sbjct: 158 VHPHKPARSGDAVVVQCRIGDEEPDGTVEATIGLYVRRTGEALIIRKHNPP 208


>gi|308751810|gb|ADO45293.1| transcriptional regulator, XRE family [Hydrogenobacter thermophilus
           TK-6]
          Length = 311

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/134 (16%), Positives = 51/134 (38%), Gaps = 17/134 (12%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P++    +          FP       + V  +       Y  + +    +    SM P
Sbjct: 179 VPVVGKAGA---------GFPHSPS--DIEVIGVVFVSKSPYLKEGKIFAVQVSGDSMHP 227

Query: 150 LYRKGDILILN----SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
              +GD ++          +  G  ++++  +G+++ K L+   G ++ L   N  YP  
Sbjct: 228 ALTEGDYVVFQTYEGDGSDIPNGKIVVVRNHSGELLVKRLLKMNG-TVLLAGDNPKYPPI 286

Query: 206 TVEMSDIEWIARIL 219
             + ++ E + RI+
Sbjct: 287 FPQQAEAEGL-RIV 299


>gi|288818209|ref|YP_003432557.1| putative prophage repressor [Hydrogenobacter thermophilus TK-6]
 gi|288787609|dbj|BAI69356.1| putative prophage repressor [Hydrogenobacter thermophilus TK-6]
          Length = 235

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/134 (16%), Positives = 51/134 (38%), Gaps = 17/134 (12%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P++    +          FP       + V  +       Y  + +    +    SM P
Sbjct: 103 VPVVGKAGA---------GFPHSPS--DIEVIGVVFVSKSPYLKEGKIFAVQVSGDSMHP 151

Query: 150 LYRKGDILILN----SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
              +GD ++          +  G  ++++  +G+++ K L+   G ++ L   N  YP  
Sbjct: 152 ALTEGDYVVFQTYEGDGSDIPNGKIVVVRNHSGELLVKRLLKMNG-TVLLAGDNPKYPPI 210

Query: 206 TVEMSDIEWIARIL 219
             + ++ E + RI+
Sbjct: 211 FPQQAEAEGL-RIV 223


>gi|238923636|ref|YP_002937152.1| SOS-response transcriptional repressor, LexA [Eubacterium rectale
           ATCC 33656]
 gi|238875311|gb|ACR75018.1| SOS-response transcriptional repressor, LexA [Eubacterium rectale
           ATCC 33656]
          Length = 213

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 33/103 (32%), Gaps = 1/103 (0%)

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G     V     +   +   A +        +  SM+P    GD +I+        GD 
Sbjct: 95  AGYGKEAVEEVIGQIEISPSMAAKGDYFGLLIKGDSMIPTLYDGDTVIVERTDDAESGDL 154

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           ++      D   K L  +    I L+  N  Y       S+I+
Sbjct: 155 VIALVNGSDATCKRLQ-KYAEGIALIPQNPVYEPMRFTESEID 196


>gi|329849056|ref|ZP_08264084.1| XRE family transcriptional regulator [Asticcacaulis biprosthecum
           C19]
 gi|328844119|gb|EGF93688.1| XRE family transcriptional regulator [Asticcacaulis biprosthecum
           C19]
          Length = 197

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 56/145 (38%), Gaps = 26/145 (17%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGG-FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
                 +E ++P++    +G  G + D         +++             + I+    
Sbjct: 64  AGIGPMREAKVPVIGRALAGPDGSYIDD--------YDSGDF-----EPLEPFNIE-DSV 109

Query: 139 RHKTQDTSMLPLYRKGDILIL-----NSAIQVNCGDRLLIKPRTGDIVAKVLI-SRRGRS 192
                 TSM P +  G+I +      + +  +N   ++L++   G  + K+L  S+    
Sbjct: 110 AVIVDGTSMTPRFMPGEIAVFGHKYDDPSPLLNK--QVLVRTIDGQRMIKILRSSKTPGL 167

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIAR 217
            DL SLN  +    +E   ++W AR
Sbjct: 168 WDLHSLNPAFAP--IEAIAVDW-AR 189


>gi|169634082|ref|YP_001707818.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii SDF]
 gi|169152874|emb|CAP01907.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii]
          Length = 260

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 50/149 (33%), Gaps = 11/149 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
            + +    +  +    +++ +P+  +   G  G+F    +        V          G
Sbjct: 106 EEAVKFVQTPTKPFPIQKRYVPVKAYSKIGMDGYFTDMGYDGNAGDGYVPTHTAGPRAYG 165

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           I          K    SM P  R G  ++ +   ++   + + +  + G    K  I   
Sbjct: 166 I----------KGTGDSMFPAIRSGWYVVCDPDAELVPTEFVQVCLKDGRCTIKEFIGIH 215

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              + L+++N        EM ++E I  I
Sbjct: 216 NGVLSLIAVNGG-ERFFFEMDEVESITAI 243


>gi|163867627|ref|YP_001608826.1| hypothetical protein Btr_0370 [Bartonella tribocorum CIP 105476]
 gi|161017273|emb|CAK00831.1| hypothetical protein BT_0370 [Bartonella tribocorum CIP 105476]
          Length = 216

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 60/168 (35%), Gaps = 23/168 (13%)

Query: 58  IFKILAATN-ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           + K+L  T   +  +LL++    G +       +PL+    +G                 
Sbjct: 61  VNKMLKGTRDISARELLEISKLTGASIPTNH-LVPLIGSVGAGGEIIAIDSG-----CLE 114

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC--GDRLLIK 174
            V  P          +        +    SM P   +G +L  +  +       +R +IK
Sbjct: 115 EVEAPP---------SAPKGTVAVRVVGDSMFPAIEEGSLLFYSYHLPPENLINNRAIIK 165

Query: 175 PRTGDIVAKVLI--SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
            + G +  KVL     +G+ + L S+N  Y    +   ++EW A I W
Sbjct: 166 TKCGKVYIKVLRLGKEKGKWV-LSSINGKYAD--IVDVELEWCAPIDW 210


>gi|237748353|ref|ZP_04578833.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229379715|gb|EEO29806.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 228

 Score = 53.4 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 46/112 (41%), Gaps = 14/112 (12%)

Query: 121 PEIRSPHNGIYA---IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           P +  P   ++    + ++    +    SM P++++GD +IL+       GD ++ K   
Sbjct: 108 PALGDPLGWLFTHSNLSSRAYALEVSGNSMQPVFQEGDWIILDPMAVPEPGDFVVAKCGE 167

Query: 178 GDIVA------KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI-----ARI 218
              +       K L +    + +L+ LN  +P    ++  IE I      RI
Sbjct: 168 KKELIFRKYRPKGLDNSGKMTFELVPLNEDFPSLRSDILPIEIIGTLIEHRI 219


>gi|331666049|ref|ZP_08366943.1| repressor protein phage e14 [Escherichia coli TA143]
 gi|331057100|gb|EGI29094.1| repressor protein phage e14 [Escherichia coli TA143]
          Length = 185

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 41  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 86

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 87  GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 146

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 147 Y-LKALNPNWPEPYI 160


>gi|323957141|gb|EGB52866.1| peptidase S24 [Escherichia coli H263]
 gi|324112045|gb|EGC06023.1| peptidase S24 [Escherichia fergusonii B253]
 gi|332341602|gb|AEE54936.1| e14 phage repressor protein [Escherichia coli UMNK88]
          Length = 185

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 41  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 86

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 87  GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 146

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 147 Y-LKALNPNWPEPYI 160


>gi|323161382|gb|EFZ47289.1| peptidase S24-like family protein [Escherichia coli E128010]
 gi|323945404|gb|EGB41458.1| peptidase S24 [Escherichia coli H120]
          Length = 197

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 53  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 98

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 99  GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 158

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 159 Y-LKALNPNWPEPYI 172


>gi|309704840|emb|CBJ04191.1| e14 prophage; repressor protein phage e14 [Escherichia coli ETEC
           H10407]
          Length = 224

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 186 Y-LKALNPNWPEPYI 199


>gi|218703074|ref|YP_002410703.1| repressor protein phage e14; e14 prophage [Escherichia coli IAI39]
 gi|218373060|emb|CAR20950.1| repressor protein phage e14; e14 prophage [Escherichia coli IAI39]
 gi|294490166|gb|ADE88922.1| peptidase, S-24 domain protein [Escherichia coli IHE3034]
          Length = 224

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDSGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 186 Y-LKALNPNWPEPYI 199


>gi|148609423|ref|YP_001272554.1| Repressor [Phage cdtI]
 gi|194426862|ref|ZP_03059415.1| repressor protein C2 [Escherichia coli B171]
 gi|148524752|dbj|BAF63374.1| Repressor [Phage cdtI]
 gi|194415198|gb|EDX31467.1| repressor protein C2 [Escherichia coli B171]
          Length = 224

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 186 Y-LKALNPNWPEPYI 199


>gi|19549021|ref|NP_599066.1| repressor [Enterobacteria phage SfV]
 gi|260856753|ref|YP_003230644.1| putative phage repressor protein [Escherichia coli O26:H11 str.
           11368]
 gi|19483765|gb|AAL89436.1| repressor [Enterobacteria phage SfV]
 gi|257755402|dbj|BAI26904.1| putative phage repressor protein [Escherichia coli O26:H11 str.
           11368]
 gi|323155025|gb|EFZ41215.1| peptidase S24-like family protein [Escherichia coli EPECa14]
          Length = 224

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 186 Y-LKALNPNWPEPYI 199


>gi|16129108|ref|NP_415663.1| e14 prophage; repressor protein phage e14 [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89107991|ref|AP_001771.1| repressor protein phage e14 [Escherichia coli str. K-12 substr.
           W3110]
 gi|91212005|ref|YP_541991.1| putative phage repressor [Escherichia coli UTI89]
 gi|117624884|ref|YP_853797.1| putative phage repressor [Escherichia coli APEC O1]
 gi|218559636|ref|YP_002392549.1| repressor protein phage e14; e14 prophage [Escherichia coli S88]
 gi|237706738|ref|ZP_04537219.1| repressor protein phage [Escherichia sp. 3_2_53FAA]
 gi|256018600|ref|ZP_05432465.1| repressor protein phage e14; e14 prophage [Shigella sp. D9]
 gi|300823465|ref|ZP_07103595.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
 gi|301020180|ref|ZP_07184306.1| peptidase S24-like domain protein [Escherichia coli MS 69-1]
 gi|331650000|ref|ZP_08351073.1| repressor protein phage e14 [Escherichia coli M605]
 gi|332279667|ref|ZP_08392080.1| repressor protein phage e14 [Shigella sp. D9]
 gi|14195551|sp|P75974|YMFK_ECOLI RecName: Full=Putative lambdoid prophage e14 repressor protein C2
 gi|1787391|gb|AAC74229.1| e14 prophage; repressor protein phage e14 [Escherichia coli str.
           K-12 substr. MG1655]
 gi|4062720|dbj|BAA35971.1| repressor protein phage e14 [Escherichia coli str. K12 substr.
           W3110]
 gi|91073579|gb|ABE08460.1| putative phage repressor [Escherichia coli UTI89]
 gi|115514008|gb|ABJ02083.1| putative phage repressor [Escherichia coli APEC O1]
 gi|218366405|emb|CAR04157.1| repressor protein phage e14; e14 prophage [Escherichia coli S88]
 gi|226899778|gb|EEH86037.1| repressor protein phage [Escherichia sp. 3_2_53FAA]
 gi|260449716|gb|ACX40138.1| peptidase S24 and S26 domain protein [Escherichia coli DH1]
 gi|294490545|gb|ADE89301.1| peptidase, S-24 domain protein [Escherichia coli IHE3034]
 gi|300398887|gb|EFJ82425.1| peptidase S24-like domain protein [Escherichia coli MS 69-1]
 gi|300524083|gb|EFK45152.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
 gi|307625781|gb|ADN70085.1| repressor protein phage e14; e14 prophage [Escherichia coli UM146]
 gi|315135778|dbj|BAJ42937.1| e14 prophage; repressor protein phage e14 [Escherichia coli DH1]
 gi|315284913|gb|EFU44358.1| peptidase S24-like domain protein [Escherichia coli MS 110-3]
 gi|323951131|gb|EGB47007.1| peptidase S24 [Escherichia coli H252]
 gi|331040945|gb|EGI13102.1| repressor protein phage e14 [Escherichia coli M605]
 gi|332102019|gb|EGJ05365.1| repressor protein phage e14 [Shigella sp. D9]
          Length = 224

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 186 Y-LKALNPNWPEPYI 199


>gi|302340525|ref|YP_003805731.1| transcriptional repressor, LexA family [Spirochaeta smaragdinae DSM
           11293]
 gi|301637710|gb|ADK83137.1| transcriptional repressor, LexA family [Spirochaeta smaragdinae DSM
           11293]
          Length = 204

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 45/139 (32%), Gaps = 15/139 (10%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
           L        + +  ++PLL    +G     +       N    + +P         +A+ 
Sbjct: 68  LNREASPEVQPELIDVPLLGNVAAGQPLIAEE------NCEQVLKIPASALRPGRYFAL- 120

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                 + +  SML      GD  I+    Q   GD ++ +     +  K       R I
Sbjct: 121 ------RVKGDSMLNAGILDGDTAIIQQTEQARNGDIVVARVNDEAVTLKRFYRETNR-I 173

Query: 194 DLMSLNCCYPVDTVEMSDI 212
            L + N  YP    + + I
Sbjct: 174 RLKAENPVYPPIFTQHARI 192


>gi|160897372|ref|YP_001562954.1| peptidase S24/S26 domain-containing protein [Delftia acidovorans
           SPH-1]
 gi|160362956|gb|ABX34569.1| peptidase S24 and S26 domain protein [Delftia acidovorans SPH-1]
          Length = 215

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 52/146 (35%), Gaps = 12/146 (8%)

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT     ++      D         ++PL+    +G+         P G+    +  P  
Sbjct: 63  ATGVGPREMDGTDEDD-----DTLGKVPLISSVQAGNWSEIVDNFQP-GDASEWIPCPAK 116

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVA 182
             PH     ++ +       +  + P Y  G+I+ ++       GDR++++    D    
Sbjct: 117 HGPHTFALTVEGES----MSNPGVHPSYEPGNIIFVDPGRSAQPGDRVVVRLEAQDQATF 172

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVE 208
           K  +   GR   L ++N  +    +E
Sbjct: 173 KQYLEEDGRKF-LRAINPDWRPKFIE 197


>gi|281356220|ref|ZP_06242713.1| transcriptional repressor, LexA family [Victivallis vadensis ATCC
           BAA-548]
 gi|281317589|gb|EFB01610.1| transcriptional repressor, LexA family [Victivallis vadensis ATCC
           BAA-548]
          Length = 209

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 47/140 (33%), Gaps = 21/140 (15%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR---SPHNGIYAIQT 135
             RT       IPLL    +           P+     ++   E     S          
Sbjct: 72  GSRTMPNCALAIPLLGRVNA---------GLPS----ESIEFKEGEVCISNTMLGEHTPE 118

Query: 136 QDTRHKTQDTSM--LPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           Q    + Q  SM  L +Y  GDI+I          GD +++    G++  K    + G  
Sbjct: 119 QMFALRVQGESMRDLGIY-DGDIVICGQGASKPRPGD-IVVALVQGEVTVKSYFPKTGGR 176

Query: 193 IDLMSLNCCYPVDTVEMSDI 212
           I+L   N  + V    ++D+
Sbjct: 177 IELRPANPDFSVQVYPIADV 196


>gi|167586258|ref|ZP_02378646.1| putative prophage repressor [Burkholderia ubonensis Bu]
          Length = 201

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 71/196 (36%), Gaps = 35/196 (17%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I  + +R  L+ + LARK G+ P + ++      E     P   ++  I  A   T+  L
Sbjct: 14  IRALMQRQGLSDADLARKTGVSPATLSRVLSMATED----PRISTVMAIADALGTTVGYL 69

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPP--SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
           L           ++   IP+L +      + G +D        +W TV  P       G 
Sbjct: 70  LQ---------SERAYPIPILGWDEMLGYARGVYDVA---RNTRWLTVDTPRRP----GT 113

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR- 189
           +A +T+         SM P +R+G I+I+   I       ++     G+     L     
Sbjct: 114 FAARTKP--------SMAPRFREGSIVIVEPGIAFRDAQVVVAAIDGGEP---TLRRVTQ 162

Query: 190 -GRSIDLMSLNCCYPV 204
            G ++ L  L      
Sbjct: 163 DGEAVWLKGLAPSPAD 178


>gi|323965383|gb|EGB60839.1| peptidase S24 [Escherichia coli M863]
          Length = 185

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            D   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 41  PDVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTTETYPCPVPC 86

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 87  GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 146

Query: 193 IDLMSLNCCYPVDTV 207
             L +LN  +P   +
Sbjct: 147 Y-LKALNPNWPEPYI 160


>gi|312795579|ref|YP_004028501.1| hypothetical protein RBRH_01118 [Burkholderia rhizoxinica HKI 454]
 gi|312167354|emb|CBW74357.1| unnamed protein product [Burkholderia rhizoxinica HKI 454]
          Length = 135

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
            N ++A     +  +    SM P+   GD +++N     +  D + +    G ++ K L 
Sbjct: 38  ENYLHARPEDLSVLRVHGDSMYPVLHDGDNILINH-AFTSPQDGIYVIRVDGQVLVKRLQ 96

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSD 211
              G  + ++S N  YP   V + D
Sbjct: 97  RLHGPFLRVISANPDYPPYEVPIED 121


>gi|307320170|ref|ZP_07599590.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306894216|gb|EFN24982.1| putative phage repressor [Sinorhizobium meliloti AK83]
          Length = 231

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           +I  AI    +R  L    +A   G+D  +         EG    PSTE++ +       
Sbjct: 9   QIGTAIRTARKRRGLVQRNIAEHLGIDVAAV-----GMWEGGRNLPSTENLMRAALFLGI 63

Query: 68  TICQLL---------------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
               L                    SD         ++ LL     G  G F       G
Sbjct: 64  NPVALARGELVYINGTDDLADAEIISDPSPPPTGPMDVKLLGVSYGGDDGDFTFNGEVAG 123

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
                V  P   +  + ++A+            SM+P Y  GDI I         GD ++
Sbjct: 124 ----YVRRPPGIASLHNVFAL-------HVLSDSMVPRYDPGDI-IYCGGRDAVPGDHVV 171

Query: 173 IKPRT------GDIVAKVLISRRGRSIDLMSLNCCYP 203
           ++         G    K L  R  + I +   N    
Sbjct: 172 VEMFGESEDQPGKSFIKRLKQRTTKQIIVDQYNPAKE 208


>gi|225023311|ref|ZP_03712503.1| hypothetical protein EIKCOROL_00164 [Eikenella corrodens ATCC
           23834]
 gi|224943956|gb|EEG25165.1| hypothetical protein EIKCOROL_00164 [Eikenella corrodens ATCC
           23834]
          Length = 211

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 50/154 (32%), Gaps = 15/154 (9%)

Query: 56  ESIFKILAATNETICQLL-----DLPFSDGRTTEKKEKEIPLLYFP-PSGSGGFFDSGVF 109
           E   KI   T  ++  L+         +           +PL   P  +G G FFD+   
Sbjct: 40  EQCIKIAEQTGVSLDWLILGKGESDKNTAAGKATPSVVLVPLYDVPVSAGHGSFFDAE-- 97

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
              N    +           + A   Q      +  SM P  +  DI++++   Q   GD
Sbjct: 98  ---NVIQQIPFDAEWLEREDLIA--GQLACLPIEGDSMSPGLKTSDIVLVDLTHQ--RGD 150

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
            + +    G +  K L       + + S N  Y 
Sbjct: 151 GVFVLRLNGALRIKRLQWLADGRLRISSDNPIYE 184


>gi|254362846|ref|ZP_04978921.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
 gi|153094483|gb|EDN75317.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
          Length = 219

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 27/171 (15%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNK 114
           E + K+L  + ET+        +       K    PL+    +G     FD   F     
Sbjct: 59  EILSKVLGVSPETL----AFDTNVQLARPTKSNSYPLISNIQAGLWTEAFD---FKDSEG 111

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           ++ +       P              +    SM P + +GD+++++   + + GD +   
Sbjct: 112 YDYIDTEIDAGPDAFF---------LRISGMSMEPKFSEGDLVLIDIRKRPHPGDYVAAV 162

Query: 175 PRTGDIVAK------VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             TG+   K                +L+ LN  +P  +    DI    RI+
Sbjct: 163 NGTGEATLKRYRELGEWSESGNPHFELIPLNPDFPTLSSMKQDI----RII 209


>gi|53802873|ref|YP_115350.1| prophage MuMc02, S24 family peptidase [Methylococcus capsulatus
           str. Bath]
 gi|53756634|gb|AAU90925.1| prophage MuMc02, peptidase, family S24 [Methylococcus capsulatus
           str. Bath]
          Length = 193

 Score = 52.6 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 50/160 (31%), Gaps = 23/160 (14%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG-----NKWNTVGVPEIRSPHN 128
            L       +      +PL     +  GG                 W    +        
Sbjct: 41  HLQRQPAVYSPDDYVALPLYDVRAAAGGGVVPDTENVVDFLHFKKAWLRTELRSSPDDLY 100

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI--QVNCGDRLLIKPRTGDIVAKVLI 186
            IY              SM P   KGD++++N     Q   G   +++   G ++ K L 
Sbjct: 101 LIY----------VDGESMEPTLCKGDVILVNHRDKFQGRDGGIYVLRL-DGALLVKRLQ 149

Query: 187 SRRGRSIDLMSLNCCYPV-----DTVEMSDIEWIARILWA 221
            + G  I + S N  Y         ++ +D   I R++WA
Sbjct: 150 RKMGGIIKVTSDNPVYEPFEVGAQDLDRADFSIIGRVVWA 189


>gi|303251516|ref|ZP_07337691.1| hypothetical protein APP6_0720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253708|ref|ZP_07535574.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidase) [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|302649636|gb|EFL79817.1| hypothetical protein APP6_0720 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306858820|gb|EFM90867.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidase) [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 217

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/198 (17%), Positives = 63/198 (31%), Gaps = 39/198 (19%)

Query: 42  KRFGIEGRN----RWPSTESIFKILAATNE---------TICQLLDLPFSDGRTTEKKEK 88
           K  G  G      R P+ + +  ++  T           TI        +      KK +
Sbjct: 29  KTQGAIGHWLTGKRTPNFDDVATMINITGIDKVILNGDGTIEDF---DPNVSVINIKKSR 85

Query: 89  EIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM 147
             PL+    +G+    FD   +   N +  +                      +    SM
Sbjct: 86  SYPLISSIQAGTWTEVFD---YRDSNGYEYIDTEIDAGEDAFF---------LRISGLSM 133

Query: 148 LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK------VLISRRGRSIDLMSLNCC 201
            P + +GD+++++   Q   GD +      G+   K       L        +L+ LN  
Sbjct: 134 EPKFSEGDLVLIDVRKQPRPGDFVAAVNGNGEATLKRYRELGDLSPSGNPHFELVPLNPD 193

Query: 202 YPVDTVEMSDIEWIARIL 219
           +P  +    DI    RI+
Sbjct: 194 FPTLSSMKQDI----RII 207


>gi|297565617|ref|YP_003684589.1| peptidase S24/S26A/S26B, conserved region [Meiothermus silvanus DSM
           9946]
 gi|296850066|gb|ADH63081.1| Peptidase S24/S26A/S26B, conserved region [Meiothermus silvanus DSM
           9946]
          Length = 217

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 54/159 (33%), Gaps = 24/159 (15%)

Query: 53  PST-ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           P+T E I  +L  T E   Q   +       T         +    +G+G        P 
Sbjct: 56  PTTLERILDVLQWTPEEFSQETGIQLPGSEITATIPVTRYRIPVVDAGAG--------P- 106

Query: 112 GNKWNT------VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
              WN       + +P+++         +++    +    SM P  + GD+++  +   V
Sbjct: 107 -PMWNENAEYITLHIPDLKGKP------ESELFAVRVGGDSMQPTLKDGDVVVFWTGGAV 159

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
             G  + +      ++ K L    G    L S N  +P 
Sbjct: 160 EPGRIVAVHVHWDGVIVKRLQRYNGSWY-LYSDNPDHPP 197


>gi|183599591|ref|ZP_02961084.1| hypothetical protein PROSTU_03072 [Providencia stuartii ATCC 25827]
 gi|188021839|gb|EDU59879.1| hypothetical protein PROSTU_03072 [Providencia stuartii ATCC 25827]
          Length = 207

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 77/209 (36%), Gaps = 26/209 (12%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
           +  NLT + LA KAG+   S  +S   G   + R  +   I K L     +  + L    
Sbjct: 12  QELNLTQTELAEKAGISQQSI-ESIENGRTKKPR--NIIEIAKALQ----SHPEWLLNGK 64

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP-HNGIYAIQTQ 136
           S    +E   + IPLL +  +   G F     P  +         +        +A+   
Sbjct: 65  SIMPISEVNSRRIPLLSYVQA---GLFKDA-NPITDYEGNFEYILVDDDISANAFAL--- 117

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS--ID 194
               + +  SM P +++GDI+++++ I  N G+ +  K        K        +   +
Sbjct: 118 ----RVEGDSMTPEFKEGDIVVIDTEIWPNPGEFVFAKNGGNQGTFKKYRPTGIGTGEFE 173

Query: 195 LMSLNCCYPVDTVEMSDIEWI-----ARI 218
           L+ LN  YP        I  I      RI
Sbjct: 174 LVPLNPDYPTLNSHDYQISLIGVMVEHRI 202


>gi|218296125|ref|ZP_03496894.1| peptidase S24 and S26 domain protein [Thermus aquaticus Y51MC23]
 gi|218243502|gb|EED10031.1| peptidase S24 and S26 domain protein [Thermus aquaticus Y51MC23]
          Length = 220

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 59/160 (36%), Gaps = 16/160 (10%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPL----LYFPPSGSGGFFDSGVFPT 111
           E++ ++L     T  +             +    IP+    +    +G+G      ++  
Sbjct: 60  EAVQRLLHVLQWTPEEF-SRETGIHIPGSEIPGAIPVVRYRIPVIDAGAG----PPMWNE 114

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G ++ T+ +PE+R         + +    + +  SM P  R GDI++  +      G  +
Sbjct: 115 GAEYITLHIPELRGKR------EEELFAVRVKGDSMEPTLRDGDIVVFWTGGAPEPGRIV 168

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            +      ++ K L    G    L S N  +P   +  +D
Sbjct: 169 AVHVHWDGVIVKRLQRYNGSWY-LYSDNPDHPPVPLTEND 207


>gi|323517351|gb|ADX91732.1| S24 family peptidase [Acinetobacter baumannii TCDC-AB0715]
          Length = 218

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 62/171 (36%), Gaps = 22/171 (12%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSD-------GRTTEKKEKEIPLLYFPPSGSGGFFD 105
           P TES+ K+      +   L+                     + +P++ +  +GS   F 
Sbjct: 42  PKTESLKKLAELFGVSDSWLMHGTEEKLDNNVVLSEKMPSDGRPVPVISWVAAGS---FS 98

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
                  +      +P  R      YA+       K    SM P +  GD + +N  IQ 
Sbjct: 99  PIETVLKDTEIEEYLPPNRRCGKNGYAL-------KVVGYSMAPTFLPGDRIYVNPDIQT 151

Query: 166 --NCGDRLLIKPRTGDIVA---KVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
                D L+I    GD  A   K++I   G S  L  LN  +P   +++S+
Sbjct: 152 FDLKTDDLVIVACAGDSEATFKKLIIEGEGSSKFLEPLNPDWPDKIIKLSE 202


>gi|320450736|ref|YP_004202832.1| LexA repressor [Thermus scotoductus SA-01]
 gi|320150905|gb|ADW22283.1| LexA repressor [Thermus scotoductus SA-01]
          Length = 115

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 31/81 (38%), Gaps = 1/81 (1%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +T     K    SM PL  +GD  I+++      G  + +      IV K L  R  + +
Sbjct: 13  ETSLFAVKITGNSMEPLLYEGDYAIVDTETPPLTGAIVAVGIPGDGIVVKKLAERN-KQL 71

Query: 194 DLMSLNCCYPVDTVEMSDIEW 214
            L S+N  Y    +      W
Sbjct: 72  YLESVNPLYEDIPLPEDAKIW 92


>gi|319408510|emb|CBI82163.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 191

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 45/218 (20%), Positives = 81/218 (37%), Gaps = 39/218 (17%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT-N 66
           KIW + + + +   L+ S LAR+          S++     R  + S  ++ K+L     
Sbjct: 2   KIWLS-EAL-QESGLSQSSLARQ---------LSEKMQ---RPIYRS--AVNKMLTGERG 45

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW-NTVGVPEIRS 125
            ++ + + +         +K K IPL+ +  +GS       V P  + W   V +P    
Sbjct: 46  ISMQEGIAIEEITKYPLPRK-KTIPLMGYVGAGSE------VTPYEDGWLEEVEIPPY-- 96

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN--CGDRLLIKPRTGDIVAK 183
                  I       K +  SM P      IL  +  +  N     + ++  + G    K
Sbjct: 97  -------ITKDTYAVKVEGDSMEPFIEDKSILFYSQNMSPNLLLNKKAIVYTQDGRCFVK 149

Query: 184 VLISRR-GRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           ++         +L SLN  YP   ++   + W A I W
Sbjct: 150 IVKQGSKPDLFNLESLNRLYPE--IKDIQLVWAAPIDW 185


>gi|170721919|ref|YP_001749607.1| peptidase S24/S26 domain-containing protein [Pseudomonas putida
           W619]
 gi|169759922|gb|ACA73238.1| peptidase S24 and S26 domain protein [Pseudomonas putida W619]
          Length = 152

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 46/148 (31%), Gaps = 25/148 (16%)

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
             L +P             +P                 FP+    + +           +
Sbjct: 14  TFLGMPTGGTEPLPLYSFHVP---------------AGFPSPAA-DHLEGHISLDEIFDL 57

Query: 131 YAIQTQDTRHKTQDTSM--LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            A        K +  SM    +Y  GDI+I++   +   GD ++I     + V K L  R
Sbjct: 58  RA--PHVYLVKVEGDSMQGAGIY-SGDIVIVDRGREAEHGD-IVIAAVNCEPVCKRLHRR 113

Query: 189 RGRSIDLMSLNCCYPVDTVEMSD--IEW 214
               I L S N  YP   +   D  + W
Sbjct: 114 DAVVI-LKSENPAYPPRYIMEGDELVIW 140


>gi|303327564|ref|ZP_07358005.1| UmuD protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862504|gb|EFL85437.1| UmuD protein [Desulfovibrio sp. 3_1_syn3]
          Length = 160

 Score = 52.2 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 59/149 (39%), Gaps = 18/149 (12%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L+L  +         + +PL Y  P           FP+        +      H  +  
Sbjct: 19  LELLGASAPVRPGGREGLPL-YLSPV-------EAGFPSPA---EDDLDRKLDLHEYLVR 67

Query: 133 IQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            +      +    SML      GD+LI++ +++     R++I    G++  K L+ R GR
Sbjct: 68  NEAATFFLRAHGDSMLGAGIHDGDLLIVDRSVEA-GHRRVVIAALDGELTVKRLLRRAGR 126

Query: 192 SIDLMSLNCCYPVDTVEMSDIEWIARILW 220
            + L   N C+    +++++ E++   +W
Sbjct: 127 VL-LAPENPCFSP--IDITEREYVH--IW 150


>gi|57234333|ref|YP_181610.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57234921|ref|YP_181022.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57234968|ref|YP_180999.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57224781|gb|AAW39838.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57225369|gb|AAW40426.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57225416|gb|AAW40473.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
          Length = 217

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 81/224 (36%), Gaps = 40/224 (17%)

Query: 13  IDRMAERHNLTPSGLARKAGLDP---TSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           +  + ++  +T S LAR++G+D    +     K +          T  I + L A    I
Sbjct: 11  LKELRKKIGMTQSELARRSGVDRAYISQLESGKTYSA--------TLGIAQKL-ARGLDI 61

Query: 70  CQLLDLPFSDGRTTEKKEKE------------IPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
                L   +        +             IP++ + P+G     D          + 
Sbjct: 62  STSALLGEKEESLGNLLSRAQAISRRMDDIEFIPVIGYIPAGYPELVDEE-----AASDY 116

Query: 118 VGVPE--IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           V VP+  +++    +YA++      K     +      GDI+I++   ++  G    ++ 
Sbjct: 117 VPVPKELLKNASKRVYALRVSGESLK--GDGIE----NGDIIIVDKDSEMFEGKIYAVRT 170

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              ++ AK L       I L S N  Y    +  +DI  + R++
Sbjct: 171 AHNEVTAKHL-YLNNGQIILRSSNGDYKDLVMTNADI--LGRVI 211


>gi|323159200|gb|EFZ45190.1| peptidase S24-like family protein [Escherichia coli E128010]
          Length = 103

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 32/84 (38%), Gaps = 9/84 (10%)

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                    +A+       +    SM P +++GDI+I++  +    G+ ++ K    +  
Sbjct: 2   ADSDIPETCFAL-------RIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNDGHEAT 54

Query: 182 AKVLISRRGRS--IDLMSLNCCYP 203
            K            +L+ LN  YP
Sbjct: 55  FKKYRPLGIGIDDFELIPLNPDYP 78


>gi|218133316|ref|ZP_03462120.1| hypothetical protein BACPEC_01181 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992189|gb|EEC58193.1| hypothetical protein BACPEC_01181 [Bacteroides pectinophilus ATCC
           43243]
          Length = 217

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 40/110 (36%), Gaps = 11/110 (10%)

Query: 106 SGVFPTGNKWNTVG---VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
           +   P     + +    +PE  +     +A+       K +  SM P    GD++I+   
Sbjct: 98  AAGIPIEATTDIIDTEEIPEEMAKTGDFFAL-------KIKGNSMEPRIMDGDVVIVRKQ 150

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
            +   GD ++      D   K L  +    I+L+S N  Y        D+
Sbjct: 151 DEAENGDVIIAMVNGDDATCKRL-RKYKDGIELISNNPSYKPMFFSDMDV 199


>gi|85703699|ref|ZP_01034803.1| phage-related protein [Roseovarius sp. 217]
 gi|85672627|gb|EAQ27484.1| phage-related protein [Roseovarius sp. 217]
          Length = 219

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 73/236 (30%), Gaps = 41/236 (17%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNR--WPSTESIFKILAA 64
             I   ID   ++   + +  +R A   P S  K+ R   +G  R  W S E + ++L  
Sbjct: 2   DVILNQIDEALKKKGYSDAKASRLAVGHP-SLIKNFRMKRDGDKRYNWASLERLAEVLD- 59

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-----SGVFPTGNKWNTVG 119
                   L+L F   R                 G    FD           G     V 
Sbjct: 60  --------LELYFGPPREAGTVYTT-------QLGHDD-FDVILRLDARLAAGAG---VE 100

Query: 120 VPEIRSPHNGIYA---------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
             E+       +            +Q    +    SM P+ R  D+++++          
Sbjct: 101 NGEVSYEGALAFCRKWLNEHNISPSQACLMRVSGDSMCPMLRDDDVVMIDQRKTTIRNRH 160

Query: 171 L-LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV---DTVEMSDIEWIARILWAS 222
           +  +    G    K +       I L S N  YP       +M+ I  +  I+W+S
Sbjct: 161 VYALVDVDGSSRVKRVELVENEMIILSSDNPNYPTETRRGPDMNRIRILGEIVWSS 216


>gi|148257097|ref|YP_001241682.1| putative LexA repressor [Bradyrhizobium sp. BTAi1]
 gi|146409270|gb|ABQ37776.1| putative LexA repressor [Bradyrhizobium sp. BTAi1]
          Length = 206

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 79/211 (37%), Gaps = 44/211 (20%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I+R  E+   T  GLAR  G+ P +                    + +IL    + + + 
Sbjct: 7   IERALEKPGKTKGGLARAMGVRPGA--------------------VSEILG--GQRLIKA 44

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
            ++P     T   +   +P++     G+G   +         +  V    +       + 
Sbjct: 45  AEIPL---ITEYLELNSVPIMG--RVGAGSVIEPE-------YEQVPAEGLG-EVALPFP 91

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNC--GDRLLIKPRTGDIVAKVLIS- 187
           I  +    +    SMLP Y  GD++++       ++   G+  +++ +TG+   K +   
Sbjct: 92  ISEETIAFEVSGDSMLPKYENGDVIVVYREQRHPLSSFYGEEAVVRLKTGERYLKTIERG 151

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +    ++L S N   P+  V    ++WI  I
Sbjct: 152 KSSTLVNLKSFN-AKPILGV---KLDWIGEI 178


>gi|192291420|ref|YP_001992025.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|192285169|gb|ACF01550.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 264

 Score = 51.9 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL-LIK 174
                P        + A +++    +TQ  SM P    GD +I+++  ++   D +  I+
Sbjct: 152 EAWHFPARFLREE-LRAPESRVQILETQGDSMAPTILSGDRVIIDTGHRLPSPDGIYAIR 210

Query: 175 PRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
            R G IV K   VL      +I ++S N  +  + V   +I  + R+LW
Sbjct: 211 DRFGAIVVKRLQVLRRGEPPTIRVISDNKAHDSEDVGADEIHIVGRVLW 259


>gi|325679534|ref|ZP_08159114.1| peptidase S24-like protein [Ruminococcus albus 8]
 gi|324108821|gb|EGC03057.1| peptidase S24-like protein [Ruminococcus albus 8]
          Length = 228

 Score = 51.9 bits (123), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 2/79 (2%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                   +  SM P    GD +++     V+ G R+ +     + V K +    G  ++
Sbjct: 137 VDTICIIVKGQSMYPKIEDGDRIVVRRQDSVDNG-RVAVVMIGDEAVVKRVNF-DGERLE 194

Query: 195 LMSLNCCYPVDTVEMSDIE 213
           L S N  YP   +E  ++ 
Sbjct: 195 LTSFNPEYPPRIIEGEELA 213


>gi|160916111|ref|ZP_02078318.1| hypothetical protein EUBDOL_02138 [Eubacterium dolichum DSM 3991]
 gi|158431835|gb|EDP10124.1| hypothetical protein EUBDOL_02138 [Eubacterium dolichum DSM 3991]
          Length = 194

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 59/164 (35%), Gaps = 21/164 (12%)

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            RW S ES   I  A  E + +L ++        + K    P+L +  +G   F    + 
Sbjct: 33  KRWESGES-KNIPEAKLEKLSELFEIDVPTFLNGQVK----PILGYVKAGYDMFASENLL 87

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAIQVNCG 168
                +  V      +           D   K Q  SM       GD++ + +   V  G
Sbjct: 88  ----GYEEV------TKKEAA----QGDYYLKVQGDSMNGSRIHDGDLVYVKTCSDVENG 133

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           D  ++     ++  K ++ +   ++ LM+ N  Y     + +DI
Sbjct: 134 DIAVVIIDQSEVTIKKILKQ-EHALVLMATNPAYEPRFFDENDI 176


>gi|257467069|ref|ZP_05631380.1| LexA repressor [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918203|ref|ZP_07914443.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313692078|gb|EFS28913.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 252

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 57/141 (40%), Gaps = 21/141 (14%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
           +E + +E P+     +G G      + P       + +P +R    GIY           
Sbjct: 93  SEFEMREYPIYDSVSAGFG------IIPDAAPIEYISLPILRGEIVGIY----------V 136

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC 201
              SM P    GDI+++   I+V  G+  + +   TG+   K L  + G  I L S N  
Sbjct: 137 VGNSMEPSISDGDIILVKKDIEVQVGEIGVFVNQVTGEGFVKRLKYKNGCYI-LKSDNPM 195

Query: 202 YPVDTVEMSDIEW---IARIL 219
           Y    ++  DI     +ARI+
Sbjct: 196 YTDVEIQSDDIICCGKVARII 216


>gi|88808444|ref|ZP_01123954.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 7805]
 gi|88787432|gb|EAR18589.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 7805]
          Length = 147

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 51/138 (36%), Gaps = 16/138 (11%)

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
              LP      ++++   +PL     +          FP+    + V V      ++ + 
Sbjct: 7   FGQLPQP--LCSQRRPLHLPLACERVA--------AGFPSPAD-DYVEV--GIDLNDQLI 53

Query: 132 AIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
              +     +    SM       GD+L+++ ++    G R+++    G    K L   RG
Sbjct: 54  RHPSSTFFLRVSGDSMTGAGIHDGDLLVVDRSLDPRPG-RVVVAVLDGGFTLKRLARHRG 112

Query: 191 RSIDLMSLNCCYPVDTVE 208
           R + L + N  YP   +E
Sbjct: 113 R-LRLEAANPDYPPLELE 129


>gi|260556784|ref|ZP_05829002.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
 gi|260410043|gb|EEX03343.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
          Length = 224

 Score = 51.5 bits (122), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 61/165 (36%), Gaps = 20/165 (12%)

Query: 54  STESIFKILAATNETICQLLDLPFS--DGRTTEKKEKEIPLLYFPPSG---SGGFFDSGV 108
           ST SI ++  A   T  +L     S  D       +K IP+L +  +G   S    D   
Sbjct: 47  STGSILELATALGVTAEELKKGIVSKFDNNVEPITKKLIPVLSWVQAGTMTSVEAIDP-- 104

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV--N 166
               NK N    P      +G +         +    S  P Y +GD +++N   QV   
Sbjct: 105 ----NKINEWLPPLSADDPDGCF-------YLRVVGVSNSPRYEEGDYILVNPNYQVCDL 153

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
             D L++     D   K L+    +   L +LN  +  + +E  D
Sbjct: 154 IADDLIVVRNNSDATFKKLVIESDQRKYLQALNPNFHPNIIEFED 198


>gi|322832500|ref|YP_004212527.1| Peptidase S24/S26A/S26B, conserved region [Rahnella sp. Y9602]
 gi|321167701|gb|ADW73400.1| Peptidase S24/S26A/S26B, conserved region [Rahnella sp. Y9602]
          Length = 222

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 78/221 (35%), Gaps = 57/221 (25%)

Query: 17  AERHNLTPSGLARKAGL---DPTSF------NKSKRFG-------------IEGRNRWPS 54
           A +   +  G +  AGL   +PT        N +K+ G              +G   W  
Sbjct: 12  ARKLRDSAGGNSSFAGLIEREPTQVSRVIGKNPTKKIGDDLARHIEKCFDLPDG---W-- 66

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
              + K   ATN T          D   TE   K +P++ +  +G+              
Sbjct: 67  ---LDKEHQATNIT-------SAPDVTDTELTIKMVPVISWVQAGA-------------- 102

Query: 115 WNTVGVPEIRSPHNGIYAIQTQ----DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           W  +G  E+    +  Y             +    SM+  YR GD++ ++  +    GD 
Sbjct: 103 WTEIGYSEVDLSLSETYPCPVPCGSMTYILRVIGDSMIDEYRPGDMIFVDPEVAPVHGDD 162

Query: 171 LL-IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
           ++ +   +G+   K L+     S  L +LN  +P   +++ 
Sbjct: 163 VIALLLDSGETTFKRLVE-DAGSKYLKALNKGWPEQYIKID 202


>gi|9635582|ref|NP_061565.1| cI repressor protein [Pseudomonas phage D3]
 gi|2493333|sp|Q37906|RPC1_BPD3 RecName: Full=Repressor protein CI
 gi|1085700|pir||A55847 cI repressor homolog - Pseudomonas aeruginosa phage D3
 gi|403436|gb|AAA53553.1| cI repressor protein [Pseudomonas phage D3]
          Length = 223

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 82/225 (36%), Gaps = 38/225 (16%)

Query: 17  AERHN-LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           A +H  LT + LA++ GLD TS +  ++   +G      T  I ++ +A   +   L   
Sbjct: 10  ARKHAKLTQAQLAQRVGLDQTSISNLEQGKSQG------TSYIAQLASACGVSALWLAAG 63

Query: 76  PFS--------DGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTVGVPE 122
                       G  +EK    IP          G+F+              W    +  
Sbjct: 64  HGEMNSNKEALPGAPSEKDYALIPQYTARGECGDGYFNDHVETTEGLVFKRDW----LKR 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL-LIKPRTGDIV 181
           + S    ++ I            SM P   +GD+++ +++       ++ +I+   G + 
Sbjct: 120 VNSKPENLFVI-------YADGDSMEPYIFEGDVVLFDTSKTDPQDKQVYVIRRPDGGVS 172

Query: 182 AKVLISRRGRSIDLMSLNCC---YPVDTVEMS---DIEWIARILW 220
            K L  +   +  + S N     YP +    S   ++  I R++W
Sbjct: 173 IKRLNQQLTGAWLIRSDNPDKSAYPDEMASESSVHELPIIGRVIW 217


>gi|290580238|ref|YP_003484630.1| putative transcriptional regulator [Streptococcus mutans NN2025]
 gi|254997137|dbj|BAH87738.1| putative transcriptional regulator [Streptococcus mutans NN2025]
          Length = 297

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           I   D        SM PL+  GD++ +     ++ G  +++     +   K L  +  + 
Sbjct: 211 IPEHDIALIVNGNSMEPLFYNGDVIFVKKTKAIHHGQIIVVIVNN-EAYVKKLYRKN-KE 268

Query: 193 IDLMSLNCCYPVDTVEMSD 211
           I L+SLN  Y    ++  D
Sbjct: 269 IRLISLNPDYDDIILKEDD 287


>gi|24379803|ref|NP_721758.1| putative transcriptional regulator [Streptococcus mutans UA159]
 gi|24377771|gb|AAN59064.1|AE014973_4 putative transcriptional regulator [Streptococcus mutans UA159]
          Length = 284

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           I   D        SM PL+  GD++ +     ++ G  +++     +   K L  +  + 
Sbjct: 198 IPEHDIALIVNGNSMEPLFYNGDVIFVKKTKAIHHGQIIVVIVNN-EAYVKKLYRKN-KE 255

Query: 193 IDLMSLNCCYPVDTVEMSD 211
           I L+SLN  Y    ++  D
Sbjct: 256 IRLISLNPDYDDIILKEDD 274


>gi|148548161|ref|YP_001268263.1| putative prophage repressor [Pseudomonas putida F1]
 gi|148512219|gb|ABQ79079.1| putative prophage repressor [Pseudomonas putida F1]
          Length = 158

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 47/148 (31%), Gaps = 25/148 (16%)

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
             L +P             +P                 FP+    + +           +
Sbjct: 20  TFLGVPTGGTEPLPLYSFHVP---------------AGFPSPAA-DHLESHISLDELFDL 63

Query: 131 YAIQTQDTRHKTQDTSM--LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            A        K +  SM    +Y  GDI+I++   +   GD ++I     + V K L  R
Sbjct: 64  RA--PHVYLVKVEGDSMQGAGIY-SGDIVIVDRGREAEHGD-IVIAAVNSEPVCKRLHRR 119

Query: 189 RGRSIDLMSLNCCYPVDTVEMSD--IEW 214
            G  I L S N  YP   +   D  + W
Sbjct: 120 DGVVI-LKSENTAYPPRYIMEGDDLVVW 146


>gi|261366571|ref|ZP_05979454.1| LexA repressor [Subdoligranulum variabile DSM 15176]
 gi|282571390|gb|EFB76925.1| LexA repressor [Subdoligranulum variabile DSM 15176]
          Length = 209

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 62/180 (34%), Gaps = 32/180 (17%)

Query: 43  RFGIEGRNRWPSTES-IFKILAATNETICQLLDLPFSDGRTTEKKEKE-----IPLLYFP 96
           R   +     P T + + +IL  T + +  L   P                  IP++   
Sbjct: 38  RSTPD-----PQTVARLAEILDTTADVLLGLQKSPSEAPAVGRYAFSRYAECLIPVVGTV 92

Query: 97  PSGSGG--FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
            +G G   F +                 ++ P N  Y           +  SM P    G
Sbjct: 93  RAGYGALAFEEDYGK---------EYASVKDPQNYFY--------LVVKGDSMEPRISDG 135

Query: 155 DILILNSAIQVNCGDR-LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           D+ +++    ++ GD  +L+    G+   K  I +RG S+ L   N  Y    ++  +++
Sbjct: 136 DLALVHRQNTLDNGDLGVLVYGADGEGTLKKYI-QRGNSVVLHPFNPAYEELVIKGEELD 194


>gi|332853630|ref|ZP_08434860.1| peptidase S24-like protein [Acinetobacter baumannii 6013150]
 gi|332870803|ref|ZP_08439453.1| peptidase S24-like protein [Acinetobacter baumannii 6013113]
 gi|332728454|gb|EGJ59828.1| peptidase S24-like protein [Acinetobacter baumannii 6013150]
 gi|332732013|gb|EGJ63290.1| peptidase S24-like protein [Acinetobacter baumannii 6013113]
          Length = 227

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 58/140 (41%), Gaps = 29/140 (20%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY-----AIQTQDTRHKTQD 144
           IP+L F  +G               W+ V   +  +PH+  Y     +          Q 
Sbjct: 96  IPILDFVQAGF--------------WHEVVY-DGTTPHSYTYTDYISSNPEAIFSVIVQG 140

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR----GRSI-DLMSLN 199
            SM P +++GD+LI++++I    G  ++ +  + +   K          GR I +L+ LN
Sbjct: 141 NSMEPDFKEGDMLIVDASIAPKPGSYVIAQNGSHEATFKKYRVLSHDEYGRDIFELIPLN 200

Query: 200 CCYPVDTVEMSDIEWIARIL 219
             +P+ +    +I    RI+
Sbjct: 201 KDFPILSSITHEI----RII 216


>gi|33770547|ref|NP_892084.1| prophage repressor [Yersinia phage PY54]
 gi|33636130|emb|CAD91799.1| prophage repressor [Yersinia phage PY54]
          Length = 215

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 11/112 (9%)

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G   NT+   +IR P   +Y +       K  + + LP Y +G++LI +       G+ +
Sbjct: 103 GQGVNTLEFVDIRVPARRLYGL-------KVSNDASLPRYTEGEVLIADPDATPITGEEV 155

Query: 172 LIKPRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARILWA 221
           ++  + G + V KV  S+R   + L S +       + ++ +I  I  I++ 
Sbjct: 156 VVITKNGDEPVIKVFASKRDNQVLLESADRKQ--RVIRDLDEIIVIHPIIFV 205


>gi|220925622|ref|YP_002500924.1| putative phage repressor [Methylobacterium nodulans ORS 2060]
 gi|219950229|gb|ACL60621.1| putative phage repressor [Methylobacterium nodulans ORS 2060]
          Length = 230

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 49/139 (35%), Gaps = 16/139 (11%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
              + IP++     G GG        +G     V  P      +  Y+ +          
Sbjct: 99  PSGRLIPVVGRKRVGEGGAIVIDGTISGR----VECPGNLVDVDNAYSTE-------VVG 147

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLL--IKPRTGDI--VAKVLISRRGRSIDLMSLNC 200
             MLP Y  G+++ ++     + G  +   ++  +GD+  + K  +      + +  LN 
Sbjct: 148 DCMLPRYEPGELVFIHPTRPYHAGSYVFLNVRDASGDLIGLVKRYVRTTSEHVIVEQLNP 207

Query: 201 CYPVDTVEMSDIEWIARIL 219
                T +   +E +  I+
Sbjct: 208 PK-TLTFDRRSVEAVHLIV 225


>gi|289166201|ref|YP_003456339.1| phage repressor [Legionella longbeachae NSW150]
 gi|288859374|emb|CBJ13310.1| putative phage repressor [Legionella longbeachae NSW150]
          Length = 229

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 82/206 (39%), Gaps = 17/206 (8%)

Query: 24  PSGLARKAGLDPTSFNKSKRFGIEGR-NRWPS-TES--IFKILAATNETICQLLDLPFSD 79
             GL RKA  + T   K  R     R +R P  TE   +  +L  +   +  L D     
Sbjct: 19  AKGLTRKALAELTGELKISRINNYERGDRTPGPTEIKLLADVLEVSASYLMCLTDNREGK 78

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT-VGVPEIRSPHNGIYAIQTQDT 138
              +      IP+L +  +      D+ +       +T V    I        +I     
Sbjct: 79  ITKSPGMGALIPVLDYKQAAD---LDNCIQKIKEDVDTRVEF--IPVSSVVSDSIGKNAF 133

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVA---KVL-ISRRGRSI 193
             + +D SM+P +R  DILIL+       GD ++ +     +++    K L  S+  +  
Sbjct: 134 ALQIKDESMVPEFRINDILILDPETSPKPGDFVVALIEGEQEVIIRKYKQLSASKEAQQF 193

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
           +L++LN  +    V  S+++  A+I+
Sbjct: 194 ELIALNEDWADIRVGFSEMK--AQII 217


>gi|258405026|ref|YP_003197768.1| Peptidase S24, S26A and S26B, conserved region [Desulfohalobium
           retbaense DSM 5692]
 gi|257797253|gb|ACV68190.1| Peptidase S24, S26A and S26B, conserved region [Desulfohalobium
           retbaense DSM 5692]
          Length = 148

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 42/112 (37%), Gaps = 8/112 (7%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
              FP+    + +  P     H  + + +      +    SM       GDIL+++ ++ 
Sbjct: 32  PAGFPSPAD-DHLDRP--LDLHEYLISNEAATFMVRVSGDSMSGAGILDGDILVVDRSLS 88

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD--IEW 214
              G  +++    G++  K L  R  +   L + +  YP  TV      + W
Sbjct: 89  PRTG-HIVVAVLDGELTVKRLTRRGEQW-RLEAAHDGYPPLTVRPEQEFLVW 138


>gi|332974608|gb|EGK11526.1| LexA family repressor/S24 family protease [Psychrobacter sp.
           1501(2011)]
          Length = 212

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 57/160 (35%), Gaps = 35/160 (21%)

Query: 58  IFKILAATNETICQLL-DLPFSDGRT--TEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGN 113
           + K+      +I  L+  +P  D          + +P+L +  +G    +FD       +
Sbjct: 51  LSKVF---GCSIGYLVDGIPDGDNFKILPMDNVRRVPVLNYVQAGEFCEYFDDA---IAD 104

Query: 114 KWNTV--GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
            +  +    P                     +  SM P +  GD+++++   Q + GD +
Sbjct: 105 MFEVIIGDYP-------------PHVHWVIIEGLSMTPDFNPGDLILVDPDTQPSPGDYV 151

Query: 172 LIKPRTGDIVAKVLISRRGRSI--------DLMSLNCCYP 203
           + K + G+  A      R R          +L+ LN  +P
Sbjct: 152 VAK-KAGE-NAVTFKKWRPRGFDDDGIEYCELVPLNPDFP 189


>gi|257879532|ref|ZP_05659185.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257883466|ref|ZP_05663119.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294622463|ref|ZP_06701485.1| transcriptional regulator, Cro/CI family [Enterococcus faecium
           U0317]
 gi|257813760|gb|EEV42518.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257819124|gb|EEV46452.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291598010|gb|EFF29120.1| transcriptional regulator, Cro/CI family [Enterococcus faecium
           U0317]
          Length = 234

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR-RGRSI 193
             D        SM P+ R G  + +     V  G+  +++     +  K +      ++I
Sbjct: 148 AADFAVPIIGDSMEPVIRNGQFVFVKEQPDVEDGEIAIVELGGDGVTCKEIYKDYENQTI 207

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L S+N  Y    V    I  I +++
Sbjct: 208 ILRSINDLYEDRIVSPEQIRIIGKVV 233


>gi|329298588|ref|ZP_08255924.1| LexA repressor [Plautia stali symbiont]
          Length = 211

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 56/162 (34%), Gaps = 20/162 (12%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW-N 116
           + ++L  +   I      PF+    +      +PL+    +                W N
Sbjct: 54  LAELLQCSAAWIIDGDGQPFASTHASPA-LTAVPLVTLVQAAD--------------WLN 98

Query: 117 TVGVPEIRSPHNGIYA---IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
              +   +     +Y+   +         +D +M P YR GD LI +       GD +++
Sbjct: 99  KQRLQWQQQAVRFLYSDKPLSDSALAVTLEDDAMNPAYRAGDRLIFDPQHVPQPGD-VVL 157

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
                  + +++     +   L  LN  +PV   + S +E I
Sbjct: 158 ARVDEVAMVRIIRMHDEQIFSLRPLNEDFPVQQSQKSALELI 199


>gi|313900347|ref|ZP_07833841.1| peptidase S24-like protein [Clostridium sp. HGF2]
 gi|312954896|gb|EFR36570.1| peptidase S24-like protein [Clostridium sp. HGF2]
          Length = 194

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 55/165 (33%), Gaps = 21/165 (12%)

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            RW S ES   +  A  + + +L  +          K    P+L +  +G   F +  + 
Sbjct: 33  KRWESGES-SNVPQARLDRLSELFGIDVPACLQGHVK----PILGYVKAGYDLFANENLL 87

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAIQVNCG 168
                +  V                  D   + Q  SM       GD++ + S   V  G
Sbjct: 88  ----GYEEV----------SAREAAQGDYYLRVQGDSMTGSRIYDGDLVYVKSCSDVENG 133

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           D  ++     ++  K ++ +   ++ LM+ N           +IE
Sbjct: 134 DIAVVLLNHSEVTIKKILKK-EHTVILMATNPVVEPRVFTQEEIE 177


>gi|289522427|ref|ZP_06439281.1| LexA repressor [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289504263|gb|EFD25427.1| LexA repressor [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 216

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 76/216 (35%), Gaps = 22/216 (10%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I  + ++  +T + LAR+    P+  ++ +R       + PS   + KI      +I  L
Sbjct: 6   IRTLRKKMRMTATELARRVKTSPSHISEIERG-----EKTPSLNLLVKIAKELQTSIDYL 60

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPS-GSGGFFDSGV-FPTGNKWNTVGVPEIRSPHNGI 130
             L             E+ LL       +G   D    +P       + VPE      G 
Sbjct: 61  TGL--EGFSKKALNVTEVALLDQASVTAAGKALDQTGVYPVVE--EMIYVPEDALGPVG- 115

Query: 131 YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                     +    SM+        I+++N   +V  GD + +     +   K + ++ 
Sbjct: 116 ---DIPPFAVRISGESMIGAGITDNSIVVINPNAEVGQGD-VALVSIGNEWTVKYIYTKA 171

Query: 190 GRSIDLMSLNCCYPVDTVEMSD-----IEWIARILW 220
             S++L   N  Y     +  D     ++ I +++W
Sbjct: 172 DGSLELRPANPSYSPIFFDKEDLISGLVKVIGKVVW 207


>gi|259418034|ref|ZP_05741953.1| putative phage repressor [Silicibacter sp. TrichCH4B]
 gi|259346940|gb|EEW58754.1| putative phage repressor [Silicibacter sp. TrichCH4B]
          Length = 238

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 45/221 (20%), Positives = 87/221 (39%), Gaps = 33/221 (14%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           EA++       L+   LA KAG+   S+ + K+   +G+ +  + E   +I AA   ++ 
Sbjct: 36  EALNGAMSASGLSMRKLAEKAGV---SYEQLKKI-NQGKTQSTNAEDALRIAAALGISLE 91

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
             +   F    T       I +     +G+    FD+  +  G+    +  P +    +G
Sbjct: 92  SFMAGEFEGTPT-------IAIAGKVGAGASVPVFDA--YAKGDGPQVICPPGLS--PSG 140

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC-----GDRLLIKPRTGDIVAKV 184
           + A++        +  SM P+Y  GD+L  +     +      G R + +   G    K 
Sbjct: 141 VVAVE-------VEGDSMEPVYSAGDLLFYSRNGHDSVPSDVIGHRCVCEDEEGMGWVKQ 193

Query: 185 LIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL--WAS 222
           + +        L+SLN       +  + ++W AR+   W S
Sbjct: 194 VKAGDEPGLFHLISLNPGANN--IWNTRLKWAARVRLHWPS 232


>gi|331685806|ref|ZP_08386387.1| transcriptional regulator, Cro/CI family [Escherichia coli H299]
 gi|324014328|gb|EGB83547.1| helix-turn-helix protein [Escherichia coli MS 60-1]
 gi|331077003|gb|EGI48220.1| transcriptional regulator, Cro/CI family [Escherichia coli H299]
          Length = 228

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 79/223 (35%), Gaps = 28/223 (12%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT----------NE 67
           E+  ++ + LA K GL   S  K +    + + R    + I K+L  +          N 
Sbjct: 13  EKAGMSQAQLAEKIGLSQQSVAKIENGETQ-QPR--KIKEIAKVLGVSQKWLQLGIEDNA 69

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           +   L+                IP+L    S   G     +  +   W     P  R   
Sbjct: 70  SFPDLVVKEAESTALDPDIFANIPVLDVELSAGNGCLAE-IVESTVDW----FPLRRIDL 124

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILI--LNSAIQVNCGDRLLIKPRTGDIV-AKV 184
                  +     K    S+LP+   GD +   ++  + +  GD  L   R G ++  K+
Sbjct: 125 RKAGVCVSNAKIVKIWGNSLLPVLNNGDFVAVDVSQTVPIRDGD--LYAIRDGVLLRVKI 182

Query: 185 LISRRGRSIDLMSLN-CCYPVDTV----EMSDIEWIARILWAS 222
           LI+     + L S N   YP + +      S I  I R+ W+S
Sbjct: 183 LINLPDGGLILRSFNKDEYPDEILTFEDRRSRIHVIGRVFWSS 225


>gi|290510869|ref|ZP_06550239.1| lambdoid prophage e14 repressor protein C2 [Klebsiella sp. 1_1_55]
 gi|289777585|gb|EFD85583.1| lambdoid prophage e14 repressor protein C2 [Klebsiella sp. 1_1_55]
          Length = 219

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 50/132 (37%), Gaps = 12/132 (9%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
             D   T +    +P++ +  +G+   +    +   +  +T   P         Y +   
Sbjct: 79  SPDVSDTNRNFVMVPVISWVQAGA---WTEFGYAEVDLNSTENYPCPVPCGPMTYIL--- 132

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRSIDL 195
               +    SM+  YR GD++ ++  +    GD ++      G+   K LI   G+   L
Sbjct: 133 ----RVIGDSMIDEYRPGDMIFVDPEVPAVHGDDVIALMHDSGETTFKRLIEDAGQRY-L 187

Query: 196 MSLNCCYPVDTV 207
            +LN  +P   +
Sbjct: 188 KALNTNWPEPYI 199


>gi|33600663|ref|NP_888223.1| putative phage repressor [Bordetella bronchiseptica RB50]
 gi|33568263|emb|CAE32175.1| putative phage repressor [Bordetella bronchiseptica RB50]
          Length = 227

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 46/132 (34%), Gaps = 24/132 (18%)

Query: 81  RTTEKKEKEIPLLYFPPSGS----GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
                  + +PL+ +  +G     G  F      +G     +      S H   +A++  
Sbjct: 86  APAAAGSRRVPLINYVQAGELTEIGAAF------SGEAVEYLLTDMNLSQH--AFALE-- 135

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR-----RGR 191
                    SM P ++ GD +I++  I    GD ++ +    +   K    R        
Sbjct: 136 -----ITGLSMYPDFKPGDRIIVDQEICPQPGDFVVARNGGYEATFKKYRPRGLDANGND 190

Query: 192 SIDLMSLNCCYP 203
             +L+ LN  YP
Sbjct: 191 VFELVPLNDDYP 202


>gi|144897419|emb|CAM74283.1| SOS mutagenesis protein UmuD [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 192

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 43/137 (31%), Gaps = 8/137 (5%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
           P   G         +P     P  S        FP+    + +        H  +     
Sbjct: 45  PLPPGTRLASSRAFVPADGAAPIYSALV--PAGFPSPAD-DHLE--GKLDLHELMVKRPA 99

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                +    SM       GD+L+++ ++Q   GD +++    G +  K L  +     +
Sbjct: 100 ATFFCRADGDSMTGAGIHSGDLLVVDRSVQPQDGD-IVVATLDGGLTVKTL-RKTTEGWE 157

Query: 195 LMSLNCCYPVDTVEMSD 211
           L   N  YP   +   D
Sbjct: 158 LAPANPDYPSFPLNQED 174


>gi|210621011|ref|ZP_03292396.1| hypothetical protein CLOHIR_00339 [Clostridium hiranonis DSM 13275]
 gi|210154995|gb|EEA86001.1| hypothetical protein CLOHIR_00339 [Clostridium hiranonis DSM 13275]
          Length = 214

 Score = 50.7 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 59/161 (36%), Gaps = 22/161 (13%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEI--PLLYFPPSGSGGFFDSGVFP 110
           P  E + K+ +  + ++  LL       +   K +  +  P+L    +G+GG        
Sbjct: 51  PPLEILQKLASLYSVSLDYLLGNDDVRLKNEIKIDNVVKLPVLGSVRAGTGG-------- 102

Query: 111 TGNKWNTVGVPEIRSPHNGIYAI---QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
               W    V      H   + +    +     K +  SM P   +GD+ ++     V  
Sbjct: 103 ----WAIEEVIG----HEYAFNLCADTSDYYYLKVKGDSMEPRISEGDLALVKKQSDVES 154

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
           GD  ++     + V K +I R    ++L S N  YPV    
Sbjct: 155 GDLAIVLINGDEGVIKKVIKRD-DCLELHSFNAYYPVRVFS 194


>gi|221067974|ref|ZP_03544079.1| peptidase S24 and S26 domain protein [Comamonas testosteroni KF-1]
 gi|221068037|ref|ZP_03544142.1| peptidase S24 and S26 domain protein [Comamonas testosteroni KF-1]
 gi|220712997|gb|EED68365.1| peptidase S24 and S26 domain protein [Comamonas testosteroni KF-1]
 gi|220713060|gb|EED68428.1| peptidase S24 and S26 domain protein [Comamonas testosteroni KF-1]
          Length = 153

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 44/125 (35%), Gaps = 15/125 (12%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
              +  P++    +G          P G+ +  V            + ++          
Sbjct: 15  AGLRAYPVISRIQAGKVKEITCPYEP-GDGY-AVEF-GDDDASEWAFFLE-------IDG 64

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR----RGRSI-DLMSLN 199
            SMLP +  GD + ++  +    GD +  K  + +   K    R     G+ I +L+ LN
Sbjct: 65  DSMLPEFNPGDRVRIDPEVTPRPGDFVAAKNSSEESTFKKYRVRGIDLTGKEIFELVPLN 124

Query: 200 CCYPV 204
             YPV
Sbjct: 125 DNYPV 129


>gi|26249039|ref|NP_755079.1| putative repressor protein of prophage [Escherichia coli CFT073]
 gi|331651509|ref|ZP_08352529.1| repressor protein C2 [Escherichia coli M718]
 gi|26109446|gb|AAN81649.1|AE016765_51 Putative repressor protein of prophage [Escherichia coli CFT073]
 gi|331050782|gb|EGI22839.1| repressor protein C2 [Escherichia coli M718]
          Length = 208

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 60/159 (37%), Gaps = 20/159 (12%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV-FPT 111
           P  E++ K+    N +I  +L     +G+      + +P++ +  +G      +   F  
Sbjct: 43  PGGEALSKLAKFFNTSIDYILYGAEFEGKLV-TNMRRVPVISWVQAGQFTECRAAEVFSE 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVN 166
            +KW    +       +  +A++        +  SM     LP   +G  +I++   +  
Sbjct: 102 VDKWVDTSL----KVGDNSFALE-------VKGDSMTNPNGLPTIPEGATVIVDPDAEPR 150

Query: 167 CGDRLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPV 204
            G  ++ +     +   K L+    +   L+ LN  YP 
Sbjct: 151 HGKIVIARLDGTNEATVKKLVIDGPQKF-LVPLNPRYPN 188


>gi|282851280|ref|ZP_06260645.1| putative repressor LexA [Lactobacillus gasseri 224-1]
 gi|282557248|gb|EFB62845.1| putative repressor LexA [Lactobacillus gasseri 224-1]
          Length = 202

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 48/216 (22%), Positives = 85/216 (39%), Gaps = 39/216 (18%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTS----FNKSKRFGIEGRNRWPSTESI 58
             S ++I + ++++ E  +++ S LAR+ G+  +     FN ++ F I   NR P+    
Sbjct: 1   MRSSEEIIDYLNQLREEQDVSISELARRVGMAKSGVSRYFNHTREFPI---NRAPA---F 54

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN-T 117
            K L   +     LL L        + K + +PLL     G+         P   + N  
Sbjct: 55  AKAL---HIKTEDLLGL----EPINQNKPRMVPLLGTIAMGA---------PITAEQNIE 98

Query: 118 VGVPE---IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
             +PE    R   + ++A+       + Q  SM PL   G I I+     V  G+   + 
Sbjct: 99  KYIPEYMMDRYADDTLFAL-------RCQGDSMYPLIPNGAIAIIRQQADVEDGEVAAVL 151

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
                 + KVL    G+++ L   N  Y    ++  
Sbjct: 152 INGEATLKKVLH--VGKTVVLRPANPDYKDIILDKD 185


>gi|254497251|ref|ZP_05110059.1| prophage repressor CI-like protein [Legionella drancourtii LLAP12]
 gi|254353479|gb|EET12206.1| prophage repressor CI-like protein [Legionella drancourtii LLAP12]
          Length = 224

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 41/212 (19%), Positives = 69/212 (32%), Gaps = 39/212 (18%)

Query: 24  PSGLARKA------GLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
             GL RKA       L P+  N  +R       R P  E I ++  A +     L+ L  
Sbjct: 17  AKGLTRKALSELTDDLKPSRINNWERGI-----RTPGPEEIKQLAEALDVAPGYLMCLTD 71

Query: 78  SDGRTTEKK--EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV----PEIRSPHNGIY 131
                 E       IPLL    +     +   +     K + +      P++ +      
Sbjct: 72  DKQVKQEFPWLGALIPLLNAQQACDPKQYIQAIK-EDRKSDAISFIPLSPDLTAQ----- 125

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            +         QD SM P  + GDILI++    +  G  ++I  +              R
Sbjct: 126 -LGNNSFALCIQDDSMTPELKIGDILIVDPDQIIRPGGIVVIHLQDS-------KEVTVR 177

Query: 192 SI-DLMSLNCCYPVDTVEMSDIEWIARILWAS 222
               L + N     + + +++        WAS
Sbjct: 178 RYKQLSAGNPVKEYELIAVNEN-------WAS 202


>gi|262372962|ref|ZP_06066241.1| LexA repressor [Acinetobacter junii SH205]
 gi|262312987|gb|EEY94072.1| LexA repressor [Acinetobacter junii SH205]
          Length = 224

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 59/166 (35%), Gaps = 22/166 (13%)

Query: 54  STESIFKILAATNETICQLLDLPFS--DGRTTEKKEKEIPLLYFPPSG---SGGFFDSGV 108
           ST SI ++  A   T  +L     S  D        K IP+L +  +G   S    D   
Sbjct: 47  STGSILELANALGVTAEELKKGVISTLDNNVAPVSSKLIPVLSWVQAGTMTSVEAIDP-- 104

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV--- 165
                  N    P      +G +         +    S  P Y  GD +++N + QV   
Sbjct: 105 ----KNINEWLPPLSVDDPDGCF-------YLRVVGVSNYPTYADGDYILVNPSYQVCDL 153

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              D ++++  + D   K L+        L +LN  +  + +E  +
Sbjct: 154 ISEDLVVVRSNS-DATFKKLVIESDERKYLQALNPNFQPNIIEFEE 198


>gi|260463034|ref|ZP_05811237.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
 gi|259031155|gb|EEW32428.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
          Length = 234

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 59/188 (31%), Gaps = 34/188 (18%)

Query: 53  PSTESIFKILA-------ATNETICQLL--------DLPFSDGRTTEKKEKEIPLLYFPP 97
           P TE++ K  A       A  +     L            +D         +I LL    
Sbjct: 52  PKTENLLKTAAFLRVDPVALGQGQVVFLDDAGPVADAEIVTDAGPLPAGPMDIELLGAAV 111

Query: 98  SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDIL 157
            G  G F       G     V  P   +    ++A+            SM+P Y  G++L
Sbjct: 112 GGDDGDFTFNGEVAG----YVQRPPGIAHLRKVFAL-------HVLSDSMVPRYEPGEML 160

Query: 158 ILNSAIQVNCGDRLLIKP------RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
                  V  GD ++I+       R G    K L+ R    + +   N      T     
Sbjct: 161 YCGGRDAV-PGDHVVIETFPEENERNGKAFIKKLVKRTAGELVVEQYNPPK-TLTFNRYA 218

Query: 212 IEWIARIL 219
           I+ + R++
Sbjct: 219 IKHVWRVI 226


>gi|167769359|ref|ZP_02441412.1| hypothetical protein ANACOL_00685 [Anaerotruncus colihominis DSM
           17241]
 gi|167668327|gb|EDS12457.1| hypothetical protein ANACOL_00685 [Anaerotruncus colihominis DSM
           17241]
          Length = 205

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 66/207 (31%), Gaps = 34/207 (16%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW------PSTESIFKILAATN 66
           +  + +   ++   LA++ G              +   +W      P   ++  I     
Sbjct: 12  LKALRKECGISQRALAQRLG-----------VSQQAVAKWEAASSTPGPNALATIADVLG 60

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   LL          +   + +P+L    +G G +     + T          ++R P
Sbjct: 61  VSSDYLLGRERDFQDGAQDTAR-LPVLGTVKAGYGAYAFEEDYGTAPA-------QVRDP 112

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
            +  Y           +  SM P    GD+ +++    V  G+  ++     +   K +I
Sbjct: 113 RDYFY--------LIVRGDSMEPRIHSGDLALVHRQPDVESGELAVVLVAGEEGTLKRVI 164

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE 213
            + G  I L   N  Y        ++E
Sbjct: 165 KKEGAVI-LQPFNQAYQPQVFIGEELE 190


>gi|91200019|emb|CAJ73061.1| similar to transcriptional repressor [Candidatus Kuenenia
           stuttgartiensis]
          Length = 213

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 6/90 (6%)

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL-LIKPRTGDIVAKVLISRRGRSIDLM 196
                +D SM P  + GD++I++    V   D L L++        K +    G S+ L+
Sbjct: 120 YLFHVKDDSMEPTLKNGDVVIVDKKNNVLDRDGLYLLRTEGAAAFIKRVQRLPGGSLHLL 179

Query: 197 SLNCCYPV-----DTVEMSDIEWIARILWA 221
             N  Y         +E  DI  + R++W+
Sbjct: 180 CDNATYKPIEAKTAQIENGDIVIVGRVVWS 209


>gi|256024105|ref|ZP_05437970.1| Repressor protein C2 [Escherichia sp. 4_1_40B]
          Length = 208

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 60/159 (37%), Gaps = 20/159 (12%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV-FPT 111
           P  E++ K+    N +I  +L     +G+      + +P++ +  +G      +   F  
Sbjct: 43  PGGEALSKLAKFFNTSIDYILYGAEFEGKLV-TNMRRVPVISWVQAGQFTECRAAEVFSE 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVN 166
            +KW    +       +  +A++        +  SM     LP   +G  +I++   +  
Sbjct: 102 VDKWVDTSL----KIGDNSFALE-------VKGDSMTNPNGLPTIPEGATVIVDPDAEPR 150

Query: 167 CGDRLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPV 204
            G  ++ +     +   K L+    +   L+ LN  YP 
Sbjct: 151 HGKIVIARLDGTNEATVKKLVIDGPQKF-LVPLNPRYPN 188


>gi|218551631|ref|YP_002385423.1| Repressor protein C2 [Escherichia fergusonii ATCC 35469]
 gi|218359173|emb|CAQ91836.1| Repressor protein C2 [Escherichia fergusonii ATCC 35469]
          Length = 208

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 60/159 (37%), Gaps = 20/159 (12%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV-FPT 111
           P  E++ K+    N +I  +L     +G+      + +P++ +  +G      +   F  
Sbjct: 43  PGGEALSKLAKFFNTSIDYILYGAEFEGKLV-TNMRRVPVISWVQAGQFTECRAAEVFSE 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVN 166
            +KW    +       +  +A++        +  SM     LP   +G  +I++   +  
Sbjct: 102 VDKWVDTSL----KIGDNSFALE-------VKGDSMTNPNGLPTIPEGATVIVDPDAEPR 150

Query: 167 CGDRLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPV 204
            G  ++ +     +   K L+    +   L+ LN  YP 
Sbjct: 151 HGKIVIARLDGTNEATVKKLVIDGPQKF-LVPLNPRYPN 188


>gi|27381246|ref|NP_772775.1| hypothetical protein blr6135 [Bradyrhizobium japonicum USDA 110]
 gi|27354413|dbj|BAC51400.1| blr6135 [Bradyrhizobium japonicum USDA 110]
          Length = 202

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 61/177 (34%), Gaps = 21/177 (11%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTE---------KKEKEIPLLYFPPSGSGGFFDSGV 108
           I + L  T ++   L                     K  + IP++ +             
Sbjct: 7   IERGLEKTGKSKGGLAAAMGVRPGAVSEILGGERLVKASEIIPIMEYLELNLAPIMGRVG 66

Query: 109 FPT--GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQ 164
                   +  V  PE        + I  +    +    SMLP Y  GD++++  +    
Sbjct: 67  AGAVIEPDYEQVP-PEGLGDIALPFPIMEETIAFEIVGDSMLPKYESGDVIVVYKDQRHP 125

Query: 165 VNC--GDRLLIKPRTGDIVAKVLIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           ++   G+  +++ +TG+   K +   +    ++L S N   P+  V    ++W+  I
Sbjct: 126 LSSFYGEEAVVRLKTGERYLKTIERGKSPSVVNLNSFN-AKPIVGV---KLDWVGEI 178


>gi|83311166|ref|YP_421430.1| SOS-response transcriptional repressors [Magnetospirillum
           magneticum AMB-1]
 gi|82946007|dbj|BAE50871.1| SOS-response transcriptional repressors [Magnetospirillum
           magneticum AMB-1]
          Length = 156

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 47/137 (34%), Gaps = 8/137 (5%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
           P   G          PL    P  S     +  FP+        +      H  +     
Sbjct: 9   PLPPGTCQASSRGFAPLEATAPIYSALV--AAGFPSPA---DDHLEGKLDLHELMVKRPA 63

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                +    SM       GD+L+++ ++Q + GD +++    G +  K L  +     +
Sbjct: 64  ATFFCRADGDSMTGAGIHSGDLLVVDRSVQPHDGD-IVVATLDGGLTVKTL-RKTEDGWE 121

Query: 195 LMSLNCCYPVDTVEMSD 211
           L S N  YP  +V+  D
Sbjct: 122 LASANPDYPSFSVDPDD 138


>gi|169333724|ref|ZP_02860917.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259573|gb|EDS73539.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
          Length = 197

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 79/201 (39%), Gaps = 24/201 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +  + + H +T   LA    LD +S  K   +   G    PS +++ KI A  N +I  L
Sbjct: 6   LRSLRKEHGMTQVDLANALDLDKSSIAK---YESAGII--PSVDTLQKISALFNVSIDYL 60

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L+ PF D          + ++    +G  G            +  +G+ +  + +N    
Sbjct: 61  LNAPFGD----INNVMNVEIIGTVVAGRDGI---------ATYEFLGISQAININNK--- 104

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
              +    K +  SM P   +GD+ ++     ++ GD  ++     + V K +  +   S
Sbjct: 105 --DEYKYLKVRGDSMAPQILEGDLALVRLQPDIDSGDLAVVIIGGEEGVIKKVQ-KTDNS 161

Query: 193 IDLMSLNCCYPVDTVEMSDIE 213
           I L+S N  Y        D+E
Sbjct: 162 ISLISFNPMYDTRVFIGKDME 182


>gi|145306753|ref|YP_001144417.1| peptidase S24, S26A and S26B [Magnetospirillum gryphiswaldense
           MSR-1]
 gi|144901519|emb|CAM78241.1| Peptidase S24, S26A and S26B [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 192

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 43/137 (31%), Gaps = 8/137 (5%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
           P   G         +P     P  S        FP+    + +        H  +     
Sbjct: 45  PLPPGTRLASSRAFVPADGAAPIYSALV--PAGFPSPAD-DHLE--GKLDLHELMVKRPA 99

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                +    SM       GD+L+++ ++Q   GD +++    G +  K L  +     +
Sbjct: 100 ATFFCRADGDSMTGAGIHSGDLLVVDRSVQPQDGD-IVVATLDGGLTVKTL-RKTTEGWE 157

Query: 195 LMSLNCCYPVDTVEMSD 211
           L   N  YP   +   D
Sbjct: 158 LAPANPDYPSFPLNQED 174


>gi|332533845|ref|ZP_08409701.1| regulatory protein Cro [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036776|gb|EGI73239.1| regulatory protein Cro [Pseudoalteromonas haloplanktis ANT/505]
          Length = 206

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 67/193 (34%), Gaps = 24/193 (12%)

Query: 21  NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL--LDLPFS 78
            LT + LA  AG+   S  K +    +   R  + +++   L  T E   Q    +   S
Sbjct: 15  GLTQANLAELAGIIQQSLQKIESGSTKN-PR--NLKALADALDCTPE-FLQFGIAESINS 70

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD- 137
           +       +  +PL+ +  +G+              W+ +           +  +     
Sbjct: 71  NVSPGPDIKSTVPLISWVQAGA--------------WSEINEIRECDAERFMCPVNASSK 116

Query: 138 -TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVAKVLISRRGRSIDL 195
               + Q  SM P + +GD++ ++   +   G  ++ +    +    K LI   G    L
Sbjct: 117 TFALRVQGVSMEPKFYEGDLIFVDPEAECIHGSYVVARLDDDNHATFKQLIIESGHKF-L 175

Query: 196 MSLNCCYPVDTVE 208
            + N  +P   + 
Sbjct: 176 KAANPNWPEQLIP 188


>gi|182678381|ref|YP_001832527.1| putative phage repressor [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634264|gb|ACB95038.1| putative phage repressor [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 225

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 29/101 (28%), Gaps = 7/101 (6%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC---GDRLLI 173
               P         Y   +     +    SM P Y  GDI+I     Q      G    +
Sbjct: 100 EQEPPGGFDEVQIPYPAPSGAVAFEIVGDSMWPRYDPGDIVICWKVAQTRTEADGWEAAV 159

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEW 214
           +   G    K +        DL+S N       +    IEW
Sbjct: 160 RLTDGRRYLKTIRRVSKDRFDLISHNASP----IHNVQIEW 196


>gi|149195301|ref|ZP_01872389.1| hypothetical protein CMTB2_00374 [Caminibacter mediatlanticus TB-2]
 gi|149134565|gb|EDM23053.1| hypothetical protein CMTB2_00374 [Caminibacter mediatlanticus TB-2]
          Length = 206

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           I            SM P  + G I+ ++  I ++ G   +I    G +  K +  +    
Sbjct: 117 IDKNLDAIHVVGDSMEPTIKDGSIIFIDRNIPLSSGGIYVISTNAG-VFVKRINIKSSGE 175

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARIL 219
           I+L+S N  YP++ V++ +I+ I +++
Sbjct: 176 IELISDNKIYPIEKVKLEEIKVIGKVV 202


>gi|60099615|gb|AAX12919.1| transcriptional regulator [Escherichia blattae DSM 4481]
          Length = 246

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 39/225 (17%), Positives = 71/225 (31%), Gaps = 36/225 (16%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA------TNETICQ--LLD 74
           + +  A  AG+ P+  N   R    G    P   ++ K          T   + +  L  
Sbjct: 30  SNNAFAVAAGISPSGLN---RLLEGGYPTLPILIALAKAGGVSVEWLSTGGDLVESKLPA 86

Query: 75  LPFSD---GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           L   D      T+ K   + L  F          S  +     WN    P         +
Sbjct: 87  LVQGDVVGATVTDVKGNNVDLEEFVFVPRYNVCASAGY---GSWNDDETPMFTVSFRRFW 143

Query: 132 ------AIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDIVAKV 184
                 A   Q +       SM  +    DI+++N A  +   G  + +    G ++ K 
Sbjct: 144 VTNHLKADPAQLSVISVYGDSMEGVLNDKDIILINHADKEPREG--IYVLRIDGQLIVKR 201

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSD----------IEWIARIL 219
           +    G  + + S N  Y   ++ ++D          + W  R++
Sbjct: 202 VQRLPGSLLRITSTNPAYEPFSINLNDVPSDFDIVGKVVWYGRVV 246


>gi|288959078|ref|YP_003449419.1| transcriptional regulator [Azospirillum sp. B510]
 gi|288911386|dbj|BAI72875.1| transcriptional regulator [Azospirillum sp. B510]
          Length = 222

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/146 (14%), Positives = 47/146 (32%), Gaps = 13/146 (8%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSG-SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
           L  +      +    +P+      G     F     P     + +  P+        YA 
Sbjct: 84  LLRTTPAQQAQAAASMPVRAAARGGGDQEMFLEDG-PI----DWIARPDYLKNARDPYA- 137

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                       SM+P +R   +L +N       G  +++  R   ++ K  + R   S+
Sbjct: 138 ------MYVVGESMMPRFRPAQLLHVNPHKPPAPGAGVVVVKRNKAVLVKEFVRRASDSV 191

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L          +V + +++ +  ++
Sbjct: 192 ILREYRPAEREFSVALEELDTLHTVV 217


>gi|283852604|ref|ZP_06369871.1| putative phage repressor [Desulfovibrio sp. FW1012B]
 gi|283572052|gb|EFC20045.1| putative phage repressor [Desulfovibrio sp. FW1012B]
          Length = 241

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 77/248 (31%), Gaps = 55/248 (22%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI--- 69
           I  + +R+    S L R  G+  ++ N+  +         P  + + KIL A    +   
Sbjct: 7   IQALLDRYRGNQSELVRLTGVPQSTLNRLFKGTGS-----PKADILAKILDAVGAKLVLP 61

Query: 70  --------------CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
                          +++           +    +PL+    +G G   D  +      W
Sbjct: 62  GERPETTRDVCWVDAKIVSAGDGQPLPPSENYFAVPLVGEAGAGPGVMSDDVI----KSW 117

Query: 116 NTVGVPEIR-SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN-----SAIQ----- 164
             V   +      + + A++          TSM PL   GDI++ +              
Sbjct: 118 VLVYRHQHAVRLKSNLLAVEIGQ-----GSTSMEPLLHPGDIVLCDRDDFKPTKPGGIFL 172

Query: 165 VN--------CGDRLLIKPRTGDIVAKVLISRRGRS-IDLMSLNCCYPVDTVEMSDIEWI 215
           V            R+ IKP   D++          S  +  SL   Y  +  E      I
Sbjct: 173 VREPGQHGGAKIKRVSIKPVDHDLLITFYSQDTVNSPPETFSLRGDYNDNITEAI----I 228

Query: 216 ARILWASQ 223
            R +WA Q
Sbjct: 229 GRCVWAWQ 236


>gi|260889363|ref|ZP_05900626.1| putative LexA repressor [Leptotrichia hofstadii F0254]
 gi|260860774|gb|EEX75274.1| putative LexA repressor [Leptotrichia hofstadii F0254]
          Length = 187

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 48/130 (36%), Gaps = 15/130 (11%)

Query: 89  EIPLLYFPPSGSGGF-FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM 147
           +IP+     +G+G    D  V         +    I + +     ++ +D   + +  SM
Sbjct: 47  QIPIYGMASAGNGLIEMDENV-------EEIEYISIPNINKN---VKKRDFACRVRGDSM 96

Query: 148 LPLYRKGDILI--LNSAIQVN--CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
            P Y  GDI++  +   I +    G   LI       + +V       ++ L S N  Y 
Sbjct: 97  EPHYHDGDIIVVDVQDGIDIRILNGQEALIYQEDSKYLKRVFFEEGTGNLILKSYNPAYA 156

Query: 204 VDTVEMSDIE 213
              +   +++
Sbjct: 157 DYIIPNHELD 166


>gi|148239417|ref|YP_001224804.1| SOS-regulated protein [Synechococcus sp. WH 7803]
 gi|147847956|emb|CAK23507.1| Bacterial UmuD protein homolog (SOS-regulated protein)
           [Synechococcus sp. WH 7803]
          Length = 147

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 14/133 (10%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
           P       ++    +PL     +          FP+    + V V      ++ +    T
Sbjct: 9   PVPLPLRCQRPPLHLPLAGERVA--------AGFPSPAD-DYVEV--GIDLNDQLIRHPT 57

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                +    SM       GD+L+++ ++    G R+++    G    K L   RG+ + 
Sbjct: 58  STFFLRVSGDSMTGAGIHDGDLLVVDRSLDPRPG-RVVVAVLDGGFTLKRLARHRGQ-LR 115

Query: 195 LMSLNCCYPVDTV 207
           L + N  YP   +
Sbjct: 116 LEAANPDYPPLDL 128


>gi|59712644|ref|YP_205420.1| Cro/Cl family transcriptional regulator [Vibrio fischeri ES114]
 gi|59480745|gb|AAW86532.1| transcriptional repressor, Cro/CI family [Vibrio fischeri ES114]
          Length = 215

 Score = 49.9 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 46/127 (36%), Gaps = 18/127 (14%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI--QTQDTRHKT 142
           K +   P++ +  +G               WN + + ++         +         K 
Sbjct: 86  KPQGSYPVISWVQAG--------------GWNDIHLTDLHDADYYPCPVRCSKNTFLLKV 131

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG-DIVAKVLISRRGRSIDLMSLNCC 201
              SM P++R+G+++ ++  ++   G  ++ +         K LI   G+   L + N  
Sbjct: 132 VGKSMNPVFREGELIFVDPDVEAVNGKYVVARLDDENQATFKQLIIEDGKKF-LQAANPD 190

Query: 202 YPVDTVE 208
           +P   + 
Sbjct: 191 WPTPIIP 197


>gi|332652440|ref|ZP_08418185.1| toxin-antitoxin system, antitoxin component, Xre family
           [Ruminococcaceae bacterium D16]
 gi|332517586|gb|EGJ47189.1| toxin-antitoxin system, antitoxin component, Xre family
           [Ruminococcaceae bacterium D16]
          Length = 275

 Score = 49.9 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 54/166 (32%), Gaps = 37/166 (22%)

Query: 69  ICQLLDLPFSDGRTTEKKEK------EIPLLYFP-PSGSGGFFDSGVFPTGNKWNTVGVP 121
           + +      + GR     E+      E+P+      +G G F D G F        +  P
Sbjct: 113 LDEYKMDLIASGRYRPAPERYTETYIEMPVSTLAVSAGVGEFLDEGGF------EMIRFP 166

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +   P N  + +       +    SM P+Y  G I+ +     +  G  + +    G+  
Sbjct: 167 KSAVPGNADFGV-------RVNGDSMEPVYHDGQIVWVEKRDTLQPG-EVGVFICNGEGY 218

Query: 182 AKVLISRRG----------------RSIDLMSLNCCYPVDTVEMSD 211
            KV   +                  + I L+S N  Y    +  SD
Sbjct: 219 LKVYDHQEPSEESKDDYVDSYGILHQQIILVSYNKLYSPKLISPSD 264


>gi|54296142|ref|YP_122511.1| hypothetical protein lpp0165 [Legionella pneumophila str. Paris]
 gi|53749927|emb|CAH11312.1| hypothetical protein lpp0165 [Legionella pneumophila str. Paris]
          Length = 227

 Score = 49.9 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 64/193 (33%), Gaps = 25/193 (12%)

Query: 21  NLTPSGLARKAG-LDPTSFNKSKRFGI--EGRNRWPSTE---SIFKILAATNETICQLLD 74
            LT   L   AG L  T      R     +G  R P  E   S+ + L  +   +  L D
Sbjct: 22  GLTLKALGELAGGLKQT------RLTNWEQGV-RTPGPEEIKSLARALDVSPAYLMCLSD 74

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
                      +   IPLL +  +            +      + V     P      + 
Sbjct: 75  ELQFKEAKNPSQL--IPLLDYRQACEASL--HTGAESSGDKVFISVSTSLQPE-----LS 125

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD---IVAKVLISRRGR 191
           T     K  D SM+P  R  D+L++  ++    GD + +K        I     +S    
Sbjct: 126 TDAFALKITDDSMMPEIRINDVLVIEPSVLPEPGDFVAVKINGKPETIICQYKKLSYTSS 185

Query: 192 SIDLMSLNCCYPV 204
             +L++LN  +P 
Sbjct: 186 EFELLTLNDNWPN 198


>gi|71065042|ref|YP_263769.1| Cro/CI family transcriptional regulator [Psychrobacter arcticus
           273-4]
 gi|71038027|gb|AAZ18335.1| possible transcriptional regulator, Cro/CI family [Psychrobacter
           arcticus 273-4]
          Length = 224

 Score = 49.9 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 47/121 (38%), Gaps = 10/121 (8%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
           + ++ +K  K +P+      G  GF+    +        + V         I A+     
Sbjct: 73  EAKSAKKLIKYVPVKGSAQMGDNGFWSELDYMGAGGDGYLEVNNASDSAYVIRAV----- 127

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSL 198
                  SM P  R G  ++ + + +   G+ + I  + G  + K  +S +   ++L+S+
Sbjct: 128 -----GDSMFPAIRSGWYIVFDPSREACSGEYVHIVLKDGRNMVKEYVSCQHGIVNLISV 182

Query: 199 N 199
           N
Sbjct: 183 N 183


>gi|162147707|ref|YP_001602168.1| LexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542331|ref|YP_002274560.1| LexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|189046538|sp|A9HJ64|LEXA_GLUDA RecName: Full=LexA repressor
 gi|161786284|emb|CAP55866.1| putative lexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530008|gb|ACI49945.1| SOS-response transcriptional repressor, LexA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 253

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 47/162 (29%), Gaps = 16/162 (9%)

Query: 53  PST-ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           P+T ES        N       +        TE     +P      +G        +  T
Sbjct: 93  PATDESAAAESFVPNVIKGDFANRLAGASVATEAGAIHLPFYGRIAAGQPI---EALRET 149

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           G     + VP     H   YA++           SM       GD +I+        G  
Sbjct: 150 GA---QIEVPMNLLGHGEHYALE-------VAGDSMIEAGILDGDTVIIRRGDVAQNGQI 199

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           ++      ++  K L  R G +I L   N  Y    V    +
Sbjct: 200 VVALIDDQEVTLKRLRRR-GSTIALEPANARYEPRIVPSDRV 240


>gi|297568146|ref|YP_003689490.1| Peptidase S24/S26A/S26B, conserved region [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924061|gb|ADH84871.1| Peptidase S24/S26A/S26B, conserved region [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 145

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + +        +  + A        +    SM+       DIL+++ +++
Sbjct: 29  SAGFPSPAD-DYIE--GRLDLNQLMIANPAATFFVRVAGDSMIGAGIHHHDILVVDRSLE 85

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
              G +++I    G++  K L  + G +I L + N  YP
Sbjct: 86  PTDG-KVVIAVVDGELTVKRLRRQNG-TIRLQAENPDYP 122


>gi|227499696|ref|ZP_03929799.1| XRE family transcriptional regulator [Anaerococcus tetradius ATCC
           35098]
 gi|227218293|gb|EEI83552.1| XRE family transcriptional regulator [Anaerococcus tetradius ATCC
           35098]
          Length = 233

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 43/156 (27%), Gaps = 13/156 (8%)

Query: 57  SIFKILAAT-NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           S  K+LA+    +I +L   P        K    I +                 P     
Sbjct: 74  SKLKMLASIYGISISELTGEPEKKEPIQNKDYITINIYGSI---------PAGIPIEAIE 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           +     ++       Y         +    SM P Y  GD +I+        G    +  
Sbjct: 125 DISDTEDLSLKE---YDKNKTYLGLRVDGDSMYPKYLDGDTVIIEKTPDCESGTDAAVYV 181

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              +   K +I     +I L  +N  Y   T    D
Sbjct: 182 NGYEATLKTVIKNENGTITLKPINANYAPRTYGPGD 217


>gi|148557717|ref|YP_001265299.1| putative phage repressor [Sphingomonas wittichii RW1]
 gi|148502907|gb|ABQ71161.1| putative phage repressor [Sphingomonas wittichii RW1]
          Length = 216

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 74/216 (34%), Gaps = 9/216 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             +  A+D +        S ++R  G +P      ++F   G  R  S E   ++ A   
Sbjct: 3   DDVRSALDALIRERGEDYSAISRLLGRNPAYI---QQFIKRGSPRKLSEEDRLRLAAYFR 59

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
               +L     +DG           L+  P    G     G      + +     +    
Sbjct: 60  VPETRLGG--RADGGPAGDMALAAALVTVPRIAIGASAGPGGIAEIEERDRPIAFDDGLL 117

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGDIVAKVL 185
            +     +   +  +    SM P    GD ++++     +  G   +++     ++ K L
Sbjct: 118 RDLGAGRRAALSIIRVAGESMEPTLHDGDDILVDRDASEIRPGGIYVLRLDD-LLMVKRL 176

Query: 186 ISRRGRSIDLMSLNCCYPVDT-VEMSDIEWIARILW 220
           +    R + + S N  +P     + + ++ I R+LW
Sbjct: 177 LRDD-RGLVVHSDNPAHPEIAGFDPATLQVIGRVLW 211


>gi|323517754|gb|ADX92135.1| putative repressor protein from bacteriophage [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 246

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 51/126 (40%), Gaps = 11/126 (8%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP 149
           +P+  +   G  G++    +  GN  +   VP + +  N  YA++           SM P
Sbjct: 105 VPVKSYSKMGMDGYYTEMGY-LGNGGDGY-VPSLTAGPN-AYAVRGT-------GDSMYP 154

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
             R G  ++ +   +    + + ++ + G    K  I      + L+++N      T++M
Sbjct: 155 AIRNGWYVVCDPDAEPTPTEFVEVQLKDGRRTIKEFIGIVNNVLHLLAVNGE-ARMTIDM 213

Query: 210 SDIEWI 215
            D+  I
Sbjct: 214 EDVSAI 219


>gi|270157680|ref|ZP_06186337.1| putative phage repressor [Legionella longbeachae D-4968]
 gi|269989705|gb|EEZ95959.1| putative phage repressor [Legionella longbeachae D-4968]
          Length = 228

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 66/205 (32%), Gaps = 20/205 (9%)

Query: 19  RHNLTPSGLARKAGLDPTSFNKSKRFGIEGR-NRWPSTESIFKILAATNETICQLLDLPF 77
           ++  T  GL RKA  + T   K  R     R  R P    I ++  A   +   L+ L  
Sbjct: 14  KNERTAKGLTRKALAELTESLKVSRINNYERGERTPGPNEIKQLAEALEVSPAFLMCLSD 73

Query: 78  SDGR---TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR----SPHNGI 130
                          IPLL +  +     +   +           +P             
Sbjct: 74  DRQGKLKQAPGLGSLIPLLNYNQACKPELYIEEIKNESYSEKVTLIPISSLLYERIGKNA 133

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRR 189
           +A++        +D SM P  R  D +I +     + GD ++ K     +++ +      
Sbjct: 134 FALE-------IKDDSMSPELRVNDTVIADPDTPPSPGDFVIAKLEHNNEVIIRKYKQLS 186

Query: 190 GRSI----DLMSLNCCYPVDTVEMS 210
              I    +L++LN  +    V   
Sbjct: 187 AAKIANEFELIALNQDWASIHVGAE 211


>gi|19919304|gb|AAM08234.1| putative phage repressor [Legionella pneumophila]
 gi|307608914|emb|CBW98314.1| putative phage repressor [Legionella pneumophila 130b]
          Length = 227

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 67/192 (34%), Gaps = 23/192 (11%)

Query: 21  NLTPSGLARKAG-LDPTSFNKSKRFGI--EGRNRWPSTESIFKILAATNETICQLLDLPF 77
            LT   L   AG L  T      R     +G  R P  E I  +  A + +   L+ L  
Sbjct: 22  GLTLKALGELAGGLKQT------RLTNWEQGV-RTPGPEEIKLLAQALDVSPAYLMCLSD 74

Query: 78  SDGRTTEKKEKE-IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
           +      K   + IPLL +  +                + +V            +A+   
Sbjct: 75  TQLHREAKNPSQLIPLLDYRQACEAKLHTGAEISGDKVFISVSTALQPELSTDAFAL--- 131

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR----RGRS 192
               K  D SM+P  R  D+L++   +    GD + +K  +G   A +   +        
Sbjct: 132 ----KITDDSMMPEIRINDVLVIEPCVLPEPGDFVAVKI-SGKPEAIICQYKKLSYTSSE 186

Query: 193 IDLMSLNCCYPV 204
            +L++LN  +P 
Sbjct: 187 FELLTLNDNWPN 198


>gi|324017929|gb|EGB87148.1| peptidase S24-like domain protein [Escherichia coli MS 117-3]
          Length = 103

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 36/100 (36%), Gaps = 6/100 (6%)

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQ----DTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
             W  VG  E+       Y             +    SM+  YR GD++ ++  +    G
Sbjct: 5   GAWKEVGYSEVDLSTAETYPCPVPCGEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHG 64

Query: 169 DRLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
           D ++      G+   K LI    +   L +LN  +P   +
Sbjct: 65  DDVIALMHDSGETTFKRLIEDGTQRY-LKALNPNWPEPYI 103


>gi|38505658|ref|NP_942279.1| hypothetical protein sll5123 [Synechocystis sp. PCC 6803]
 gi|38423682|dbj|BAD01893.1| sll5123 [Synechocystis sp. PCC 6803]
          Length = 144

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 6/103 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + +        +  +          +    SM+      GDILI++ +++
Sbjct: 28  SAGFPS-PAEDYLE--GKLDLNQYLIKHPAATFFVRVTGDSMIGAGIHAGDILIVDRSLE 84

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
              G +++I    G+++ K L     + I L S N  YP   +
Sbjct: 85  PRDG-KVVIAVVNGELLVKRL-RMEKQKIYLASENSDYPPLVI 125


>gi|307608926|emb|CBW98330.1| putative repressor [Legionella pneumophila 130b]
          Length = 227

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 64/193 (33%), Gaps = 25/193 (12%)

Query: 21  NLTPSGLARKAG-LDPTSFNKSKRFGI--EGRNRWPSTE---SIFKILAATNETICQLLD 74
            LT   L   AG L  T      R     +G  R P  E   S+ + L  +   +  L D
Sbjct: 22  GLTLKALGELAGGLKQT------RLTNWEQGV-RTPGPEEIKSLARALDVSPAYLMCLSD 74

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
                      +   IPLL +  +            +      + V     P      + 
Sbjct: 75  ELQFKEAKNPSQL--IPLLDYRQACEATL--HTGAESSGDKVFISVSTSLQPE-----LS 125

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD---IVAKVLISRRGR 191
           T     K  D SM+P  R  D+L++  ++    GD + +K        I     +S    
Sbjct: 126 TDAFALKITDDSMMPEIRINDVLVIEPSVLPEPGDFVAVKINGKPETIICQYKKLSYTSS 185

Query: 192 SIDLMSLNCCYPV 204
             +L++LN  +P 
Sbjct: 186 EFELLTLNDNWPN 198


>gi|110598195|ref|ZP_01386472.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340209|gb|EAT58707.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Chlorobium
           ferrooxidans DSM 13031]
          Length = 241

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 54/167 (32%), Gaps = 26/167 (15%)

Query: 57  SIFKILAATNETICQLL-----------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
           S+ K    +  +  +                 +          ++PL  +  +   G  D
Sbjct: 71  SMLKKPEESGISPDEFSRRITLLEKQMQQFVINTIEPESPSLAKVPL--YSSAVPAGMPD 128

Query: 106 SGVFPTGNKWNTVGVPEIRSP-HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAI 163
                +      + +P   +     IYA+       K    SM+ +    GD+L++ +  
Sbjct: 129 PA---SDEIEEYLDMPASWAQGKKNIYAL-------KVNGDSMVDIGIMPGDLLMVEART 178

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
               G ++++    G++  K L      +I LM  N  YP   +   
Sbjct: 179 TARDG-QVVVACINGEVTVKTLCISNTGTISLMPENKRYPPIAITAD 224


>gi|85372990|ref|YP_457052.1| prophage MuMc02-like, S24 family peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84786073|gb|ABC62255.1| prophage MuMc02-like, peptidase, family S24 [Erythrobacter
           litoralis HTCC2594]
          Length = 211

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 55/151 (36%), Gaps = 10/151 (6%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
            L             EIP+L     +G G    S    T   ++   +  + S  +   +
Sbjct: 62  QLLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGFDERWLRHLTSAKSASLS 121

Query: 133 IQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR-G 190
           I         +  SM P    GD +L+  S       D + +      +V K +  +  G
Sbjct: 122 I------VGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDALVVKRIAIKPGG 175

Query: 191 RSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
           R I + S N  YP    ++ S++  + R++W
Sbjct: 176 RQITIASDNPAYPTWHDMDRSEVHVVGRVIW 206


>gi|28870585|ref|NP_793204.1| repressor protein c2 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28853833|gb|AAO56899.1| repressor protein c2 [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 243

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 52/129 (40%), Gaps = 19/129 (14%)

Query: 82  TTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
                  ++PL+ +  +G+    + +    +   W +  VP           I +     
Sbjct: 106 PLPNTSGKVPLISWVQAGAWCETYSNVESESAESWLSCPVP-----------ISSSGYAL 154

Query: 141 KTQDTSML-P----LYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRRGRSID 194
           K +  SM  P     Y  G I+ ++  ++V+ GDR++ +  RT +   KV +   G+   
Sbjct: 155 KVRGDSMTNPGLGRSYPAGCIIFVDPEVEVHTGDRVIARLDRTNEATFKVFVEDAGQQF- 213

Query: 195 LMSLNCCYP 203
           L  +N  YP
Sbjct: 214 LKPINPQYP 222


>gi|226940501|ref|YP_002795575.1| UmuD protein [Laribacter hongkongensis HLHK9]
 gi|226715428|gb|ACO74566.1| UmuD protein [Laribacter hongkongensis HLHK9]
          Length = 206

 Score = 49.6 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 59/161 (36%), Gaps = 15/161 (9%)

Query: 58  IFKILAATN-ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           + K   A    +I +L      +        +  P+L  P   +G        P+    +
Sbjct: 47  LVKARQAARLASIEELAGQYPGEVLL---PARLAPVLGMPLHAAGV---RAGMPSPAD-D 99

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYR-KGDILILNSAIQVNCGDRLLIKP 175
            V   +    ++ +          + +  SM   +   GDIL+++ +   + GD +++  
Sbjct: 100 YVE--DTLDLNHYLIDDAPSTFLVRAKGESMTGAHVFDGDILVVDKSRTPSSGD-IVVAA 156

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPV--DTVEMSDIEW 214
             G+   K L  + GR I L + N  YP    + E   + W
Sbjct: 157 IEGEFTVKRLQRQGGRVI-LKAANPDYPDIVPSYEQELVIW 196


>gi|259418887|ref|ZP_05742804.1| LexA repressor [Silicibacter sp. TrichCH4B]
 gi|259345109|gb|EEW56963.1| LexA repressor [Silicibacter sp. TrichCH4B]
          Length = 232

 Score = 49.6 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            Q    + +  SM+      GD++++      + GD ++      +   K    + GR I
Sbjct: 142 GQHYALEVRGDSMIDAGINDGDVVVIRETDAADNGDIVVALVEGHEATLKRFERK-GRMI 200

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
           +L + N  YP  +     ++   R++
Sbjct: 201 ELHAANPAYPTRSYSEDQVKVQGRLV 226


>gi|257440049|ref|ZP_05615804.1| SOS-response transcriptional repressor [Faecalibacterium
           prausnitzii A2-165]
 gi|257197401|gb|EEU95685.1| SOS-response transcriptional repressor [Faecalibacterium
           prausnitzii A2-165]
          Length = 209

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 82/219 (37%), Gaps = 44/219 (20%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75
           ++ +++ + LA   G+   +  K  S +   +     P+T  + K+    + T   LL L
Sbjct: 12  KQKHMSQAELASLLGVTQQAVGKWESGKSSPD-----PTT--VAKLAEILDTTADYLLGL 64

Query: 76  --PFSDGRTTEKKEKE-----IPLLYFPPSGSGG--FFDSGVFPTGNKWNTVGVPEIRSP 126
             P ++G+T E+         IP++    +G G   + +                 ++ P
Sbjct: 65  FDPTAEGQTEERFFGSYVYSLIPVIGTVKAGYGALAYEEDYGK---------EYARVKDP 115

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVL 185
            +  Y           +  SM P    GD+ +++    +  GD  +LI    G+     L
Sbjct: 116 SSYFY--------LVVRGDSMEPRIHDGDLALVHRQDTLENGDLGVLIYGDEGE---GTL 164

Query: 186 IS--RRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RIL 219
               +RG  + L   N  Y    ++  ++  +    R++
Sbjct: 165 KRYLQRGNCVVLQPFNPAYKEMVIKGEELNHLHIAGRVV 203


>gi|226940092|ref|YP_002795165.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
 gi|226715018|gb|ACO74156.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
          Length = 242

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
            N + A   + +       SM  +    D++++N A +   G   +++   G +V K + 
Sbjct: 141 ENYLRANPDELSVIAVDGDSMEGVLNDRDVILVNHADRDPRGSIYVLRI-DGHLVVKQVQ 199

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDI----EWIARILW 220
              G  +++ S N  Y   TVE+  +    + I R++W
Sbjct: 200 RLPGGILEVSSSNPAYKPFTVELGKVGDDFDVIGRVVW 237


>gi|13477014|ref|NP_108584.1| repressor protein C [Mesorhizobium loti MAFF303099]
 gi|14027777|dbj|BAB54370.1| repressor protein C [Mesorhizobium loti MAFF303099]
          Length = 246

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 53/160 (33%), Gaps = 25/160 (15%)

Query: 74  DLPFSDGRTTEKKEK-----EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
            LP  +     + E+      IP+L     G  G F       G     V  P +     
Sbjct: 93  SLPKPNASFPPRYEQFPQVGTIPVLGQSVGGPNGRFVLNGQEAGR----VFCPPMLENVE 148

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV------A 182
           G YA+       +   TSM P Y  G+ + +N    V  GD ++++    D         
Sbjct: 149 GAYAV-------RVYGTSMEPRYFAGETIWINPHEPVRSGDFVVVQVVGDDDDDTRDSYI 201

Query: 183 KVLISRRGRSIDLMSLNCCY---PVDTVEMSDIEWIARIL 219
           K  +SR    + L  LN               +  + +I+
Sbjct: 202 KQFMSRSNSLVRLRQLNPDEGENETLDFPTKRVFSVHKIV 241


>gi|82542851|ref|YP_406799.1| phage repressor [Shigella boydii Sb227]
 gi|81244262|gb|ABB64970.1| putative phage repressor [Shigella boydii Sb227]
          Length = 224

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 20/135 (14%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ- 136
            +   T K+   +P++ +  +G+              W  VG  E+       Y      
Sbjct: 80  PEVSITNKQITLVPVISWVQAGA--------------WKEVGYSEVDLSTAETYPCPVPC 125

Query: 137 ---DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRS 192
                  +    SM+  YR GD++ ++  +    GD ++      G+   K LI    + 
Sbjct: 126 GEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQR 185

Query: 193 IDLMSLNCCYPVDTV 207
             L +L+  +P   +
Sbjct: 186 Y-LKALHPNWPEPYI 199


>gi|34556743|ref|NP_906558.1| hypothetical protein WS0307 [Wolinella succinogenes DSM 1740]
 gi|34482457|emb|CAE09458.1| hypothetical protein WS0307 [Wolinella succinogenes]
          Length = 218

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 96  PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGD 155
             +G GG F+        K +   V  +            Q         SM P    GD
Sbjct: 94  ASAG-GGAFNDTEACERIKLDAFWVERLGGEKEI-----KQIEAIAVTGDSMEPTLEDGD 147

Query: 156 ILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEW 214
           ++ ++    Q++ G   +I+   G I  K L  R    +D++S N  YP  T+E   IE 
Sbjct: 148 LIFIHRQKRQISKGGIFVIQTPHG-IFVKRLQERLDGGVDILSDNSLYPTQTLERDGIEV 206

Query: 215 IARIL 219
           I R++
Sbjct: 207 IGRVV 211


>gi|224823653|ref|ZP_03696762.1| putative phage repressor [Lutiella nitroferrum 2002]
 gi|224604108|gb|EEG10282.1| putative phage repressor [Lutiella nitroferrum 2002]
          Length = 324

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 74/235 (31%), Gaps = 40/235 (17%)

Query: 12  AIDRMAER-------HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           ++D + +R         LT   LA++ G+   + N    F   GRN+   T+ +  I  A
Sbjct: 93  SMDTLGKRVTHARELKGLTQLELAKRVGVSAQTIN----FVENGRNK--GTKHLLAIAKA 146

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPL----LYFPPSGSGGFFDS-GVFP-TGNKWNTV 118
              +      L    G  TE   + I +         SG   F     V P  G      
Sbjct: 147 LGVSA---TWLDSGKGSMTEVSLRPIEVWEDEEQLAQSGEYIFLPELSVRPSAGPGAQVW 203

Query: 119 GVPEIRSPHNGIYAI--------QTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNCG 168
            V +         A                     SM P    GD +++       +  G
Sbjct: 204 HV-DTAGQRQAFTAKWARRMSIDPACAATMVVSGDSMEPRLLDGDSIVVDYCQNDTIIDG 262

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC---YPVDTVEMSDIEWIA-RIL 219
            ++ +     ++  K L    G  + + S N     +P   V   ++  +  RI+
Sbjct: 263 -KVYVLVINDEVKVKRLFKAIGGGLIIRSDNPDKNTHPDLNVRAEEM--MHVRIV 314


>gi|121611811|ref|YP_999618.1| LexA repressor [Verminephrobacter eiseniae EF01-2]
 gi|171769494|sp|A1WSJ3|LEXA_VEREI RecName: Full=LexA repressor
 gi|121556451|gb|ABM60600.1| SOS-response transcriptional repressor, LexA [Verminephrobacter
           eiseniae EF01-2]
          Length = 224

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 55/154 (35%), Gaps = 21/154 (13%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN-------TVGVPEIRS 125
           ++L     R      + +  ++   SG  G       P  + W          G P +  
Sbjct: 59  IELVSGTSRGIRLHSETLRSIHAARSGPSG----AGNPGSSPWVLPLIGRVAAGSPILAQ 114

Query: 126 PH-NGIYAIQ------TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRT 177
            H    Y+++        D   K +  SM       GD+L + +  +   G  ++ +   
Sbjct: 115 EHVEQTYSVENGLFQHKPDYLLKVRGMSMRDAGIIDGDLLAVQATREARNGQIIVARLGD 174

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            D+  K L  R   +I+L+  N  YPV  V+  +
Sbjct: 175 -DVTVKRL-RRTASTIELLPENPDYPVIVVQPGE 206


>gi|332875243|ref|ZP_08443075.1| peptidase S24-like protein [Acinetobacter baumannii 6014059]
 gi|332736500|gb|EGJ67495.1| peptidase S24-like protein [Acinetobacter baumannii 6014059]
          Length = 227

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 52/133 (39%), Gaps = 23/133 (17%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVF----PTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
              +  +IP+L +  +   G F+S  +    P G  + T              A +    
Sbjct: 89  NNDEISKIPVLDYVQA---GLFNSVGYDGVNPIGETYTTYKS-----------AKEKSVF 134

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR----GRSI- 193
               Q  SMLP ++ GD+L +++A+    G  ++ +    +   K          GR I 
Sbjct: 135 SLTVQGDSMLPDFKPGDLLTIDTALMPQPGSFVVAQNGDYEATFKKYRVIGYDDFGREIF 194

Query: 194 DLMSLNCCYPVDT 206
           +L+ LN  YP  +
Sbjct: 195 ELVPLNPDYPTLS 207


>gi|226357661|ref|YP_002787401.1| repressor lexA [Deinococcus deserti VCD115]
 gi|226319652|gb|ACO47647.1| putative repressor lexA [Deinococcus deserti VCD115]
          Length = 211

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 57/173 (32%), Gaps = 19/173 (10%)

Query: 53  PSTESIFKILAATNETICQL---LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           P+T  +  +  AT  T   +     L            +  PL+    + +      G F
Sbjct: 25  PAT--LGAVAQATGLTKQAVSYQTVLLREAHYLEPAASRYAPLILTSKARA--LIGGGGF 80

Query: 110 PTGNKWNTVGVPEIRSPHNGIYA--------IQTQDTRHKTQDTSMLPL-YRKGDILILN 160
           P        G P     +   Y         ++  D   + +  SM+ +     DI+I+ 
Sbjct: 81  PL-VGEIAAGQPGHAEQNVEAYITRLDQVIDMKEGDYLLRVRGDSMIGVGIYPQDIVIVR 139

Query: 161 SAIQVNCGD-RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
               V  GD  +++ P       K +  +  + I L S N  YP  T    D+
Sbjct: 140 PNETVPNGDIAVVLLPGESTATLKRVEHQNSK-ITLHSANPDYPPMTFPARDV 191


>gi|309973095|gb|ADO96296.1| Probable prophage repressor protein [Haemophilus influenzae R2846]
          Length = 218

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 63/179 (35%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFNSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        + + A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTVIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIAPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +      K L +R    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYKELGTRTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|53728788|ref|ZP_00135141.2| COG1974: SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
          Length = 169

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 61/174 (35%), Gaps = 32/174 (18%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG----SGGFFDSGVFPT 111
           E I K++        +L     +      K     PL+    +G    S  F DS  +  
Sbjct: 8   EVIAKVI---GIEPAKLAFGDPNVEPVIVKDSYSYPLVSSIQAGVWTESCDFRDSQGY-- 62

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
               + +   EI +  +G +         +    SM P + +GD+++++   Q   GD +
Sbjct: 63  ----DYID-SEIDAGEDGFF--------LRVSGMSMEPKFSEGDLVLIDVRKQPRPGDFV 109

Query: 172 LIKPRTGDIVAK------VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 G+   K       L        +L+ LN  +P  +    DI    RI+
Sbjct: 110 AAVNGNGEATLKRYRELGDLSPSGNPHFELVPLNPDFPTLSSMKQDI----RII 159


>gi|319776463|ref|YP_004138951.1| putative prophage repressor CI [Haemophilus influenzae F3047]
 gi|329123953|ref|ZP_08252504.1| LexA family repressor/S24 family protease [Haemophilus aegyptius
           ATCC 11116]
 gi|317451054|emb|CBY87286.1| Putative prophage repressor CI [Haemophilus influenzae F3047]
 gi|327468035|gb|EGF13524.1| LexA family repressor/S24 family protease [Haemophilus aegyptius
           ATCC 11116]
          Length = 218

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 64/179 (35%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        + + A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTVIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  ++      +      K L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVVAINGDNEATFKQYKELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|296283572|ref|ZP_06861570.1| prophage MuMc02-like, S24 family peptidase [Citromicrobium
           bathyomarinum JL354]
          Length = 211

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 56/151 (37%), Gaps = 10/151 (6%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
            +             EIP+L     +G G    S    T   ++   +  + S  +   +
Sbjct: 62  QVLGGPANPVTDGMIEIPVLDVEASAGFGAVAASETAHTRFGFDERWLRHLTSAKSASLS 121

Query: 133 IQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR-G 190
           I         +  SM P    GD +L+ +S       D + +      +V K +  +  G
Sbjct: 122 I------VGVKGDSMEPTLSDGDEVLVDSSDHGSRLRDGIYVLRSDDTLVVKRIAIKPGG 175

Query: 191 RSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
           R I + S N  YP    ++ +++  + R++W
Sbjct: 176 RQITIASDNPAYPTWHDMDRAEVHVVGRVIW 206


>gi|188533594|ref|YP_001907391.1| Protein UmuD [Erwinia tasmaniensis Et1/99]
 gi|188028636|emb|CAO96498.1| Protein UmuD [Erwinia tasmaniensis Et1/99]
          Length = 139

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 40/107 (37%), Gaps = 7/107 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
              FP+    + V   +    +  + A        K    SM       GD+L+++ ++ 
Sbjct: 23  PCGFPS-PAQDYVE--DRLDLNTLLIAHPGATYFIKVSGESMTGAGIGDGDLLVVDRSLS 79

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              GD ++I    G+   K L  R   S+ L+  N  Y   T   ++
Sbjct: 80  ARHGD-IVIAAVAGEFTVKEL--RTHPSLQLVPHNDSYSPMTFHNAE 123


>gi|259908182|ref|YP_002648538.1| Protein UmuD [Erwinia pyrifoliae Ep1/96]
 gi|224963804|emb|CAX55306.1| Protein UmuD [Erwinia pyrifoliae Ep1/96]
 gi|283478109|emb|CAY74025.1| Error-prone repair, SOS-response transcriptional repressor [Erwinia
           pyrifoliae DSM 12163]
 gi|310767905|gb|ADP12855.1| Protein UmuD [Erwinia sp. Ejp617]
          Length = 139

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 40/107 (37%), Gaps = 7/107 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V   +    +       +     K    SM       GD+LI++ ++ 
Sbjct: 23  PCGFPS-PAQDYVE--DRIDLNKLAIKHPSATYFIKVSGDSMREAGIGDGDLLIVDRSLN 79

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              GD +++    G+   K L  R    + L+  N  YP  + + ++
Sbjct: 80  AVHGD-IVVAAIAGEFTVKEL--RTHPVLQLVPHNPHYPPISFQNAE 123


>gi|149184889|ref|ZP_01863206.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. SD-21]
 gi|148831000|gb|EDL49434.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. SD-21]
          Length = 211

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 43/216 (19%), Positives = 80/216 (37%), Gaps = 25/216 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +DR+ ++  L  S ++R  G + +     ++F   G  R        K+      T+   
Sbjct: 8   LDRLIQQRRLGYSSISRMIGRNSSYI---QQFIKRGSPR--------KLDDDDRRTLASF 56

Query: 73  LDLPFSDGRTTEKKEK----EIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
             +            +    EIP+L     +G G   +S    T   ++   +  +    
Sbjct: 57  FGVDEQVLGGPPAPMRDGLIEIPVLNVDASAGFGAIAESETAHTRFGFDERWLARLTRAK 116

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
           +   +I            SM P    GD +L+  S       D + +      +V K + 
Sbjct: 117 SASLSI------IHVLGDSMEPTLSDGDEVLVDASDQGSRLRDGIYVLRADDALVVKRVT 170

Query: 187 SRR-GRSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
            +  GR I + S N  YP  D V+ S+I+ + R++W
Sbjct: 171 LKPGGRKITISSDNSAYPSWDDVDRSEIQVVGRVIW 206


>gi|153800394|ref|ZP_01954980.1| HTH-type transcriptional regulator for conjugative element SXT
           [Vibrio cholerae MZO-3]
 gi|124124020|gb|EAY42763.1| HTH-type transcriptional regulator for conjugative element SXT
           [Vibrio cholerae MZO-3]
          Length = 215

 Score = 49.2 bits (116), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 72/205 (35%), Gaps = 49/205 (23%)

Query: 21  NLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILA------ATNETICQL 72
            +T S LAR+ G+   S ++  S   G   R+R+  T  I + L       AT       
Sbjct: 16  GVTQSELARRIGIKQQSISQICS---GKSARSRY--TMQIAEALRVNAHWLATG---DGE 67

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGS-----GGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           + L   +       +  IPL+ +  +G       GF          +W  V        H
Sbjct: 68  IGLGVGNVEVGPDIKGRIPLINWVQAGDWTEIAEGFAHED----AEEWREV----TGKAH 119

Query: 128 NGIYAIQTQDTRHKTQDTSML--------PLYRKGDILILNSAIQVNCGDRLLIKPRTG- 178
            G +A+       + +  SM         P   +G I++++  +  + G  ++       
Sbjct: 120 EGCFAL-------RVKGDSMENPSGKKSIP---EGAIIVVDPEMPYSSGSLVVACLDDSI 169

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYP 203
           +   K L+    +   L  LN  YP
Sbjct: 170 EATFKQLVIDGDQRY-LKPLNPQYP 193


>gi|291296371|ref|YP_003507769.1| peptidase S24 and S26 domain-containing protein [Meiothermus ruber
           DSM 1279]
 gi|290471330|gb|ADD28749.1| peptidase S24 and S26 domain protein [Meiothermus ruber DSM 1279]
          Length = 241

 Score = 49.2 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 69/177 (38%), Gaps = 23/177 (12%)

Query: 43  RFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG 102
           R    G    P   +++++  A +  +  L++  + D    E    +IP++ +  +GSG 
Sbjct: 65  RQSAAGTWVRPDIRTLWRLAKALDVPLVYLIERFYDDLEDVEALWPQIPIIGWVGAGSG- 123

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM----LPLYRKGDILI 158
                        +   + E   P +   A++      K +  SM     P+   GD++I
Sbjct: 124 -------------SEEDIREKYVPVDMDIALRGSAVAFKVRGNSMCAGPKPIC-DGDVII 169

Query: 159 LNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP---VDTVEMSDI 212
           ++   +   G R++ +   G+ V K+L      +  L+S N        D +  S +
Sbjct: 170 VDCRNKGRVGSRVVARLADGNYVCKLLKHGPNGNY-LVSANPSSDNSYPDVIPASSV 225


>gi|307308739|ref|ZP_07588435.1| transcriptional regulator, XRE family [Sinorhizobium meliloti
           BL225C]
 gi|306900745|gb|EFN31356.1| transcriptional regulator, XRE family [Sinorhizobium meliloti
           BL225C]
          Length = 272

 Score = 49.2 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 73/221 (33%), Gaps = 34/221 (15%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           W+ +D   +      + LAR++G+   + NK  R  IE + R  + E++ + +      +
Sbjct: 42  WKRLDERRKELGWNKAELARRSGIPYDNINKYLRGEIE-QPRGDALETLARTIKRPLLWL 100

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSG---SGGFFDSGVFPTGNKWNTVGVPEIRSP 126
              +++   +      +     L+    +G       FD            + VP     
Sbjct: 101 RDGIEVEGGELVPAPGRLVAGALVGKAEAGTFREVDAFDQAER------EVIAVPPDERF 154

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILI------LNSAIQVNCGDRLLI-K 174
            N       +         SM      P+   GD LI      +     +  G  +++ +
Sbjct: 155 PNA------RILVFDVAGDSMNDLRPRPIL-DGDRLICVAYEDVAHEAVLRDGMVVVVER 207

Query: 175 PRTG----DIVAKVLISRRGRS-IDLMSLNCCYPVDTVEMS 210
            R G    +   K +   +GR+     S N  +    VE  
Sbjct: 208 TRDGGQTREWSVKQVEIYQGRTEFHPRSTNPKHKPIVVERD 248


>gi|312897732|ref|ZP_07757148.1| LexA repressor family protein [Megasphaera micronuciformis F0359]
 gi|310621116|gb|EFQ04660.1| LexA repressor family protein [Megasphaera micronuciformis F0359]
          Length = 218

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 67/202 (33%), Gaps = 21/202 (10%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTESIFKILAATNETICQLLDL 75
           + H L+     ++ GL     +  +R       +   PS +++  I       +  LL  
Sbjct: 13  QSHGLSMEEFGKRVGLSKAYISLIERGKNTRSNKPIVPSIDTMKAIADGLEMDLDVLLRS 72

Query: 76  PFSDGR----TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
                +     T  K  +IP+L    +           P       +   EI        
Sbjct: 73  IDPSQKIKINNTHPKGVQIPVLGRVVA---------GVPLEAVEEILDYEEITPE----L 119

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
           A   +    + +  SM P   +GD++I+     V+ GD  ++     +   K +  +  R
Sbjct: 120 AATGEFFALQIRGRSMEPRMLEGDVVIVRRQSDVDSGDIAIVLVNGDEATVKRVS-KSDR 178

Query: 192 SIDLMSLNCC-YPVDTVEMSDI 212
            I L++ N   Y        +I
Sbjct: 179 GITLIATNPNVYEPHFYSSEEI 200


>gi|311695997|gb|ADP98870.1| phage repressor [marine bacterium HP15]
          Length = 225

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 75/211 (35%), Gaps = 23/211 (10%)

Query: 21  NLTPSGLAR----KAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            L  SG AR    KAG+  ++F    R  + G    P  +S+ +I  A   ++  L    
Sbjct: 24  GLVGSGSARSFAHKAGMGDSTF----RNILNGAL--PRLDSLLRIAKAAGVSVEWLATGK 77

Query: 77  FSDGRTTEKKE--KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
                 ++ +E    IP      +   G       PT      +     R        +Q
Sbjct: 78  EPAKSDSQFEEEFALIPGYNVQVAAGHGSIAGDEAPT----RELAF---RRKWLRFRGLQ 130

Query: 135 TQDTRHKTQ-DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
             +         SM P     + ++++++ +      + +      ++ K + +     +
Sbjct: 131 ENELALVFAKGDSMEPTISDNETVMVDTSEKKLRDGHIYVIRNGDHLLVKRIQTLWNDGV 190

Query: 194 DLMSLNCCYPVDTVEMSDIE---WIARILWA 221
            L+S N  YP   +  SD+E    I +++W 
Sbjct: 191 QLLSDNKEYPPQEISKSDLENLDVIGKVVWV 221


>gi|167746119|ref|ZP_02418246.1| hypothetical protein ANACAC_00815 [Anaerostipes caccae DSM 14662]
 gi|167654634|gb|EDR98763.1| hypothetical protein ANACAC_00815 [Anaerostipes caccae DSM 14662]
          Length = 209

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 32/107 (29%), Gaps = 5/107 (4%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
           +   P       +   EI        A        +    SM P + +GD++I+      
Sbjct: 90  AAGIPIDAVEEIIDTEEITED----MAKTGTFFGLQIHGNSMEPKFSEGDVVIVRQQDDA 145

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
              D ++      +   K L       I L+S N  Y        +I
Sbjct: 146 ETDDIVIAIVNGDEATCKKLKKYN-DGIVLISTNPAYEPMYFSNKEI 191


>gi|293433433|ref|ZP_06661861.1| transcriptional regulator [Escherichia coli B088]
 gi|291324252|gb|EFE63674.1| transcriptional regulator [Escherichia coli B088]
          Length = 228

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 82/224 (36%), Gaps = 30/224 (13%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKILAAT----------N 66
           E+  ++ + LA K GL   S   +K    E  + R    + I K+L  +          N
Sbjct: 13  EKAGMSQAQLAEKIGLSQQSV--AKIENGETLQPR--KIKEIAKVLGVSQKWLQLGIEDN 68

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +I  L+                IP+L    S   G     +  +   W     P  R+ 
Sbjct: 69  ASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAE-IVESAIDW----FPLRRAD 123

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNCGDRLLIKPRTGDIV-AK 183
                   +     +    S+LP+   GD++ +  +  + +  GD  L   R G ++  K
Sbjct: 124 LRKSGVCASNAKIVQIWGNSLLPVLNNGDLVAVDISQTVPIRDGD--LYAVRDGVLLRVK 181

Query: 184 VLISRRGRSIDLMSLN-CCYPVDTV----EMSDIEWIARILWAS 222
           +LI+     + L S N   YP + +      + I  I R+ W+S
Sbjct: 182 ILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVFWSS 225


>gi|307544695|ref|YP_003897174.1| phage repressor [Halomonas elongata DSM 2581]
 gi|307216719|emb|CBV41989.1| putative phage repressor [Halomonas elongata DSM 2581]
          Length = 251

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 70/217 (32%), Gaps = 39/217 (17%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET---- 68
           I R+          +AR+AG+  ++   S+     G+   PS   + K+      +    
Sbjct: 31  IRRLINESGKRAIDVAREAGVPQSTL--SRILT--GKIEEPSDRPVAKLAEYFGVSGDQI 86

Query: 69  --------------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
                         I Q   L  S+     K E  +P++ +  +GS              
Sbjct: 87  RGREPIETEGSADKIAQHPALHESNVAPPPKLEGYVPVISWVQAGS-------------- 132

Query: 115 WNTVGVPEIRSPHNGIY--AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           W  V   +  S        A   +    + +  SM P Y    I+ ++  +    GD ++
Sbjct: 133 WTEVCNVDAVSEEMVPRPPACSDRTFALRVKGQSMAPKYEPDLIIYVDPEVLPFDGDDVV 192

Query: 173 -IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
            +   + +   K  +   G    L + N  +P   + 
Sbjct: 193 AVLTDSNEATFKQFVEEPGDDKMLKARNPSWPDPYIP 229


>gi|215484235|ref|YP_002326462.1| Repressor protein C2 [Acinetobacter baumannii AB307-0294]
 gi|213987961|gb|ACJ58260.1| Repressor protein C2 [Acinetobacter baumannii AB307-0294]
          Length = 230

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 57/140 (40%), Gaps = 29/140 (20%)

Query: 90  IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY-----AIQTQDTRHKTQD 144
           IP+L +  +G               W+ V   +  SPH+  Y                Q 
Sbjct: 98  IPVLDYVQAGF--------------WHEVAY-DGSSPHSYTYTDYVSCSPESIFSVIVQG 142

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK----VLISRRGRSI-DLMSLN 199
            SM P +++GD+LI++++I    G  ++ +  + +   K    +     GR + +L+ +N
Sbjct: 143 KSMEPDFKEGDMLIVDASINPKPGSYVIAQNGSHEATFKKYRVLAHDEYGRDVFELIPIN 202

Query: 200 CCYPVDTVEMSDIEWIARIL 219
             +P  +    DI    RI+
Sbjct: 203 SDFPTLSSVTHDI----RII 218


>gi|330992626|ref|ZP_08316572.1| phage transcriptional regulator and peptidase [Gluconacetobacter
           sp. SXCC-1]
 gi|329760308|gb|EGG76806.1| phage transcriptional regulator and peptidase [Gluconacetobacter
           sp. SXCC-1]
          Length = 287

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 20/173 (11%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           ESI +   A+       + +   DG  T  +    P      +G G   D      G   
Sbjct: 126 ESISRAERAS-------MPVHDDDGAITVHEYDISP-----QAGGGAIVDHTACGDGEGH 173

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRH-KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
            T+    I       Y   T      +    SM P +  GD +++++  ++   D + + 
Sbjct: 174 PTLESWRIPRNFIRNYLPDTAGLAIIRVTGNSMEPEFLAGDRVLVDTGHRIPSPDGVYVL 233

Query: 175 PRTGDIVAKVL----ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL--WA 221
                +V K L     SR  R I ++S+N  YPVD V+ SD+    R++  W 
Sbjct: 234 WNGMGVVIKQLMLVPNSRPPR-IRIISVNPTYPVDEVDASDLVINGRVVGKWV 285


>gi|324115562|gb|EGC09501.1| helix-turn-helix protein [Escherichia coli E1167]
          Length = 228

 Score = 48.8 bits (115), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 48/224 (21%), Positives = 82/224 (36%), Gaps = 30/224 (13%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKILAAT----------N 66
           E+  ++ + LA K GL   S   +K    E  + R    + I K+L  +          N
Sbjct: 13  EKAGMSQAQLAEKIGLSQQSV--AKIENGETLQPR--KIKEIAKVLGVSQKWLQLGIEDN 68

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +I  L+                IP+L    S   G     +  +   W     P  R+ 
Sbjct: 69  ASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAE-IVESAIDW----FPLRRAD 123

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQVNCGDRLLIKPRTGDIV-AK 183
                   +     K    S+LP+   GD++ +  +  + +  GD  L   R G ++  K
Sbjct: 124 LRKSGVCASNAKIVKIWGNSLLPVLNNGDLVAVDISQTVPIRDGD--LYAVRDGVLLRVK 181

Query: 184 VLISRRGRSIDLMSLN-CCYPVDTV----EMSDIEWIARILWAS 222
           +LI+     + L S N   YP + +      + I  I R+ W+S
Sbjct: 182 ILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVFWSS 225


>gi|218885456|ref|YP_002434777.1| phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756410|gb|ACL07309.1| putative phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 261

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 49/150 (32%), Gaps = 11/150 (7%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            +P             +P +    S  GG F+    P G +              G    
Sbjct: 114 AMPAPHHGDLPPAVHMVPKVRARLSAGGGSFEVQAMPVGGQ----PFAHAWLARKGT--- 166

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            +          SM P  R GD ++++ A +     ++        ++ K ++      +
Sbjct: 167 PSAMVLMDVVGDSMEPEIRDGDTVLVDRATEDLRFGQVYAVGLEDAVLVKRVMR-TPDGL 225

Query: 194 DLMSLNCCYPVDTVEMSDIEW---IARILW 220
            L+S N  Y    V   ++E    I R++W
Sbjct: 226 ALVSDNPAYSPIRVRGDELEQFRVIGRVVW 255


>gi|114797550|ref|YP_760490.1| LexA repressor [Hyphomonas neptunium ATCC 15444]
 gi|122942416|sp|Q0C1A3|LEXA_HYPNA RecName: Full=LexA repressor
 gi|114737724|gb|ABI75849.1| LexA repressor [Hyphomonas neptunium ATCC 15444]
          Length = 227

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 48/147 (32%), Gaps = 15/147 (10%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            L  + G    +    IPL+    +GS       +     +   V  P      +  +A+
Sbjct: 88  ALVTNQGAEAPRIAGMIPLVGRIAAGS------PISAIQQENGQVASPGGLPEGDDYFAL 141

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           +        Q  SM+      GD +IL        GD ++      +   K L  +   S
Sbjct: 142 E-------VQGDSMIQAGILNGDTVILKRTNTAQTGDIVVALIDGEEATLKRLRRKGA-S 193

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + L + N  +         +E   R++
Sbjct: 194 VALEAANPAFETRIFGPDRVEVQGRLV 220


>gi|148555124|ref|YP_001262706.1| putative phage repressor [Sphingomonas wittichii RW1]
 gi|148500314|gb|ABQ68568.1| putative phage repressor [Sphingomonas wittichii RW1]
          Length = 250

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 44/116 (37%), Gaps = 18/116 (15%)

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI-- 173
           + +  P       GIYA          +  SM P Y  G+   ++        D +L+  
Sbjct: 139 DQLRRPFRLIGRPGIYA-------FYFEGDSMEPKYSPGEPAFVDGNKPPVVMDYVLVQL 191

Query: 174 KPRTGD------IVAKVLISRRGRSIDLMSLNCCYPVD-TVEMSDIEWIARILWAS 222
           +   GD      ++AK L+ R    ++L   N   P+   V    I  + +IL +S
Sbjct: 192 RRPEGDDETIHTVLAKRLVKRTAAYVELEQFNP--PMRFKVPREQIARMHKILQSS 245


>gi|283954061|ref|ZP_06371586.1| hypothetical protein C414_000080049 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794340|gb|EFC33084.1| hypothetical protein C414_000080049 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 224

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 43/117 (36%), Gaps = 13/117 (11%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILN 160
           +  +  G   N +   EI       Y      I T+    K    SM P    GDI+ ++
Sbjct: 85  AAGY--GATNNQLEYTEITISKKFAYEALDLPISTKLDIIKIIGDSMEPFVHSGDIIAVD 142

Query: 161 SAIQ----VNCGDRLLIKPRTGDIVAKVLISRR-GRSIDLMSLNCCYPVDTVEMSDI 212
                   V  GD ++I    G+I  K L+ +     I L S+N  Y    + +  I
Sbjct: 143 ITKNKLELVKNGDIVVINL-DGEIYCKKLLKQPFVNEIVLSSMNSFYKDIVISVEQI 198


>gi|21233670|ref|NP_639968.1| UV protection and mutation protein [Proteus vulgaris]
 gi|11245982|gb|AAG33672.1| MucA [IncT plasmid Rts-1]
 gi|21202854|dbj|BAB93570.1| UV protection and mutation protein [Proteus vulgaris]
          Length = 145

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 35/108 (32%), Gaps = 9/108 (8%)

Query: 106 SGVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAI 163
              FP+    W    +    + H  +          +    SM       GD+L+++ + 
Sbjct: 24  PAGFPSPAAGWEEAEL----NLHTLVVTHPASTYFLRVTGDSMQDARIHSGDVLVVDRSE 79

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
               G  +++     +   K LI R      LM +N  YP    +   
Sbjct: 80  TPEQGS-IVVASIDNEFTVKKLILRP--RSCLMPMNPAYPPIYFDPES 124


>gi|83858367|ref|ZP_00951889.1| LexA repressor [Oceanicaulis alexandrii HTCC2633]
 gi|83853190|gb|EAP91042.1| LexA repressor [Oceanicaulis alexandrii HTCC2633]
          Length = 227

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 53/156 (33%), Gaps = 19/156 (12%)

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
           TN            +         E+P+L    +G        +    ++ + + VP   
Sbjct: 83  TNVVSADFGSSVSDE----RSHGVEVPVLGRIAAGV------PIEAIQHETDRLPVPAEM 132

Query: 125 SPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
                 +A++           SM       GD++I+      N GD ++      +   K
Sbjct: 133 ISGGEHFALE-------VHGDSMIEAGILDGDLVIIKRGDTANTGDIVVALVHDEEATLK 185

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            L  ++G SI L + N  Y       ++++   R++
Sbjct: 186 KL-RKKGGSIALEAANPAYETRIFGPNEVKVQGRLV 220


>gi|167856791|ref|ZP_02479443.1| putative prophage repressor CI [Haemophilus parasuis 29755]
 gi|167852086|gb|EDS23448.1| putative prophage repressor CI [Haemophilus parasuis 29755]
          Length = 217

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 65/191 (34%), Gaps = 42/191 (21%)

Query: 48  GRNRWPSTESIFKILAATNE---------TICQLLDLPFSDGRTTEKKEKEIPLLYFPPS 98
           GR R P+   + +++  T           TI            T+ KK +  PL+    +
Sbjct: 40  GR-RMPNVNEVAQMINLTGVNKVILNGDGTIEDFDPNITP---TSVKKSRAYPLVSSIQA 95

Query: 99  G----SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
           G    +  F DS  +      + +       P              +    SM P + +G
Sbjct: 96  GMWTETYDFRDSEGY------DYIDTEIDAGPDAFF---------LRVSGMSMEPKFSEG 140

Query: 155 DILILNSAIQVNCGDRLLIKPRTGDIVAK---VLISRRGR---SIDLMSLNCCYPVDTVE 208
           D+++++   + + GD +      G+   K    L           +L+ LN  +P  +  
Sbjct: 141 DLVLIDVRKRPHPGDFVAAVNGNGEATLKRYRELGELSPSGNPHFELVPLNQDFPTLSSM 200

Query: 209 MSDIEWIARIL 219
             DI    RI+
Sbjct: 201 KQDI----RII 207


>gi|114764299|ref|ZP_01443527.1| LexA repressor [Pelagibaca bermudensis HTCC2601]
 gi|114543247|gb|EAU46264.1| LexA repressor [Roseovarius sp. HTCC2601]
          Length = 231

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 51/165 (30%), Gaps = 8/165 (4%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD--SGVFPTGNKW 115
           I K+  +                R   +  K  P+     +         +   P  +  
Sbjct: 66  IVKLPESLGGKPAGFTPQVIDGDRPDSRPAKAQPVSN-AEALELPLLGRIAAGEPIQSIA 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIK 174
           +    P   +    + +        + +  SM       GD++I+      + GD ++ +
Sbjct: 125 DN---PPNIAVPGAMLSSNAHHYALEVKGDSMIEAGIHDGDVVIIRETSSASNGDIVVAQ 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               +   K    + G +I L + N  Y    + +  ++   R++
Sbjct: 182 IEGYEATLKRFRRQ-GDTIVLEAENAAYEPRVLPLGAVKVQGRLV 225


>gi|291614655|ref|YP_003524812.1| phage repressor [Sideroxydans lithotrophicus ES-1]
 gi|291584767|gb|ADE12425.1| putative phage repressor [Sideroxydans lithotrophicus ES-1]
          Length = 130

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSL 198
                  SM P + +G+IL++     V+ G  ++ +    + + + L         L +L
Sbjct: 32  ALMVLGDSMAPEFTEGEILVIEMGAPVSDGSFVVGEANE-EFIFRQLRRGDHGGWQLHAL 90

Query: 199 NCCYPVDTVE 208
           N  YP   + 
Sbjct: 91  NPAYPDIAIA 100


>gi|255319235|ref|ZP_05360452.1| phage repressor [Acinetobacter radioresistens SK82]
 gi|255303628|gb|EET82828.1| phage repressor [Acinetobacter radioresistens SK82]
          Length = 247

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 53/140 (37%), Gaps = 20/140 (14%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW-NTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
              K +P+L +  +G+              W   + +P        +  +          
Sbjct: 110 DGLKRVPILTYVQAGN--------------WREAIQMPSDNFIFVSVD-VSPNSFGAYVV 154

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV----LISRRGRSIDLMSLN 199
             SMLP +R GD++I+++ ++    D ++ +   G    K     +        DL+ LN
Sbjct: 155 GDSMLPDFRDGDLIIIDTQVKPQPTDFVMAEDPEGITFKKYRSRGINEEGKEVFDLVPLN 214

Query: 200 CCYPVDTVEMSDIEWIARIL 219
             +P+   + S +E I  ++
Sbjct: 215 PDFPIIRSDRSRVEIIGTVV 234


>gi|237746102|ref|ZP_04576582.1| phage repressor [Oxalobacter formigenes HOxBLS]
 gi|229377453|gb|EEO27544.1| phage repressor [Oxalobacter formigenes HOxBLS]
          Length = 227

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 10/89 (11%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           +       +    +M+P + KGD +I++ AI    GD ++ K   GD +  +L   R + 
Sbjct: 121 LSAHSFALEITGLAMMPEFEKGDWVIVDPAIAPEPGDFVVAKY--GDKMNVILRKYRPKG 178

Query: 193 I--------DLMSLNCCYPVDTVEMSDIE 213
           +        +L++LN  YP     +  +E
Sbjct: 179 LDLSHTMLFELIALNDDYPRIRSHLDAVE 207


>gi|148727133|ref|YP_001285627.1| putative cI repressor [Aeromonas phage phiO18P]
 gi|110349268|gb|ABG73156.1| putative cI repressor [Aeromonas phage phiO18P]
          Length = 238

 Score = 48.4 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 75/230 (32%), Gaps = 45/230 (19%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I   A R +++ SGL              KR+  EG     +   I + L          
Sbjct: 29  IRAFARRADMSDSGL--------------KRYLYEG-----TIPPIDRALNLARAGGVTF 69

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF----------PTGNKWNTVGVPE 122
             L F  G          P+   P S   GF  +  F            G+  N    P 
Sbjct: 70  DWLVFGIGEAGSSARTNPPIA--PASDVQGFQVTEEFTTIPAYQVFASAGHGANITDEPL 127

Query: 123 IRSPHNGIYAIQTQDTR------HKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIK 174
                     ++ +          + +  SM P    GD++++   +       D L + 
Sbjct: 128 AEPMAFRTDWLRREGFDPAKMAVIRAKGDSMEPTINDGDVILVRLKNGEAPR--DGLYVL 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARILWA 221
              G +  K L    G  + ++S N  Y    +   E+++++ + R++WA
Sbjct: 186 RLDGGLFVKRLQFDLGG-VRIISDNPLYKSRDLSKAELAELDLVGRVVWA 234


>gi|241663869|ref|YP_002982229.1| phage repressor [Ralstonia pickettii 12D]
 gi|240865896|gb|ACS63557.1| putative phage repressor [Ralstonia pickettii 12D]
          Length = 292

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 38/121 (31%), Gaps = 19/121 (15%)

Query: 106 SGVFPTGNKWNTV------GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
                 GN   T        +P        + A        K +  SM P     D +++
Sbjct: 161 DVALSAGNGRETWHIEEKEPLPFQADYIRRLDASPKNLVAVKVRGDSMEPRLFDDDTVVV 220

Query: 160 NSAIQVNCGDR-------LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +        DR       +      G+++ K L      SID++S N  Y    V+   +
Sbjct: 221 D------RADRRIPASGGVFAIVYAGEMLVKRLFKLPDGSIDIVSDNPKYKSLVVQPDQL 274

Query: 213 E 213
           E
Sbjct: 275 E 275


>gi|241765209|ref|ZP_04763193.1| SOS-response transcriptional repressor, LexA [Acidovorax
           delafieldii 2AN]
 gi|241365138|gb|EER60010.1| SOS-response transcriptional repressor, LexA [Acidovorax
           delafieldii 2AN]
          Length = 224

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 153 KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
            GD+L + +  +   G  ++ +    D+  K L  R   SI+L+  N  YP+  V+  ++
Sbjct: 150 DGDLLAVQATREARNGQIVVARLGD-DVTVKRL-RRTASSIELLPENPDYPIIVVQPGEV 207


>gi|254449351|ref|ZP_05062795.1| prophage MuMc02, peptidase, family S24 [gamma proteobacterium
           HTCC5015]
 gi|198261055|gb|EDY85356.1| prophage MuMc02, peptidase, family S24 [gamma proteobacterium
           HTCC5015]
          Length = 230

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 55/175 (31%), Gaps = 24/175 (13%)

Query: 62  LAATNETI------CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           L A             ++ +              +PL     +   G             
Sbjct: 61  LEAIGVDWRYVMNGGDVVGIREPAAAYDYSDYVRLPLFDVQAAAGNGL-------VAQAE 113

Query: 116 NTVGVPEIRSP--HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRL 171
             V           N +          +    SM+P    GD+++LN      V   D +
Sbjct: 114 ELVEFLSFDRDWLRNALKVSPKDLVMIEVDGESMVPTLSPGDVIMLNTLDTGVVR--DGI 171

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEW-----IARILWA 221
            +    G ++ K L S  G  ++++S N  +P  T++  D+       I R++W+
Sbjct: 172 YVLLVDGALLVKRLQSLPGGVLNVISDNQAFPTWTMKRDDLGAETQRVIGRVVWS 226


>gi|104783161|ref|YP_609659.1| transcriptional regulator [Pseudomonas entomophila L48]
 gi|95112148|emb|CAK16875.1| putative transcriptional regulator [Pseudomonas entomophila L48]
          Length = 248

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 41/257 (15%), Positives = 82/257 (31%), Gaps = 52/257 (20%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESI 58
           M +   + +   +  + +RH L+P+ L R+ G+  ++ ++  S++         PS + +
Sbjct: 1   MHAMQKRNVASVLRALLDRHGLSPTELHRRTGVPQSTLSRILSEKIVD------PSDKHV 54

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            +I      +  QL                 +             +D    P  +  + V
Sbjct: 55  SRIAEYFGVSTDQLRGRAELGEPREAAALTPV----HAALSDISLWDDE-TPVED--DEV 107

Query: 119 GVPEIRS----PHNGIYAIQTQDTR---------------------HKTQDTSMLPLYRK 153
            VP +R       +G + I+  +                          +  SMLP+ R 
Sbjct: 108 SVPFLREVELAAGSGRFVIEESENARLRFGKRSLRHNGVQFDHAKCVTVRGNSMLPVLRD 167

Query: 154 GDILILNSA----IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD---- 205
           G  + +N+       +  GD L      G +  K +       I L S N     D    
Sbjct: 168 GATVGVNTGKCTIGDIIDGD-LYAINHNGQLRVKQVYRLPTG-IRLRSFNRDEHPDEDYS 225

Query: 206 --TVEMSDIEWIARILW 220
              ++   I  +  + W
Sbjct: 226 FQQMQEEQISLLGHVFW 242


>gi|153212036|ref|ZP_01947853.1| repressor protein C2 [Vibrio cholerae 1587]
 gi|124116832|gb|EAY35652.1| repressor protein C2 [Vibrio cholerae 1587]
          Length = 225

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 47/127 (37%), Gaps = 14/127 (11%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
            +     E++ P+L +  +   G +     P  N  +   +P       G Y +      
Sbjct: 85  AQVGPPVEQKCPILSWVQA---GMWTEMGSPVSN-EDVELMPCPVKCSAGTYVL------ 134

Query: 140 HKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTG-DIVAKVLISRRGRSIDLMS 197
            + +  SM   Y +GD L ++   I+   GD ++       +   K  I   GR + L +
Sbjct: 135 -RVRGDSMRHEYEEGDYLFVDPTKIEPANGDYVIAMLEDSKEATFKQYIELDGRKM-LKA 192

Query: 198 LNCCYPV 204
            N  YP 
Sbjct: 193 TNPDYPP 199


>gi|99080976|ref|YP_613130.1| LexA repressor [Ruegeria sp. TM1040]
 gi|122984325|sp|Q1GHJ8|LEXA_SILST RecName: Full=LexA repressor
 gi|99037256|gb|ABF63868.1| SOS-response transcriptional repressor, LexA [Ruegeria sp. TM1040]
          Length = 241

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            Q    + +  SM+      GD++++      + GD ++      +   K    + GR I
Sbjct: 151 GQHYALEVRGDSMIDAGINDGDVVVIRETDAADNGDIVVALVEGHEATLKRFERK-GRMI 209

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
           +L + N  YP  +     ++   R++
Sbjct: 210 ELHAANPAYPTRSYTEDQVKVQGRLV 235


>gi|94263341|ref|ZP_01287156.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|93456296|gb|EAT06426.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
          Length = 145

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 6/100 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + +        +  + A        +    SM+       DIL+++ +++
Sbjct: 29  SAGFPS-PAEDYLE--GQLDLNQLMVAHPAATFFVRVAGDSMINAGIHHNDILVVDRSLE 85

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
              G R++I    G++  K L+ + G +  LM+ N  YP 
Sbjct: 86  PTNG-RVVIAVLNGELTVKRLVQKNG-TARLMAENPNYPP 123


>gi|94266498|ref|ZP_01290188.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|93452885|gb|EAT03399.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
          Length = 145

 Score = 48.4 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 6/100 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + +        +  + A        +    SM+       DIL+++ +++
Sbjct: 29  SAGFPS-PAEDYLE--GQLDLNQLMVAHPAATFFVRVAGDSMINAGIHHNDILVVDRSLE 85

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
              G R++I    G++  K L+ + G +  LM+ N  YP 
Sbjct: 86  PTNG-RVVIAVLNGELTVKRLVQKNG-TARLMAENPNYPP 123


>gi|254425161|ref|ZP_05038879.1| Peptidase S24-like domain protein [Synechococcus sp. PCC 7335]
 gi|196192650|gb|EDX87614.1| Peptidase S24-like domain protein [Synechococcus sp. PCC 7335]
          Length = 156

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 45/101 (44%), Gaps = 8/101 (7%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP--LYRKGDILILNSAI 163
           S  FP+    + +   +    +  +          +    SM P  ++  GD+LI++ +I
Sbjct: 36  SAGFPSPAD-DYIE--KTLDLNAHLIENPAATFFARACGDSMEPGGIF-DGDLLIIDRSI 91

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
           +   G R+++    G+++ K L +   R++ L + N  YP 
Sbjct: 92  EPRNG-RVVVVALNGEMLVKRLHTTLDRTV-LSADNRNYPP 130


>gi|198385590|gb|ACH86126.1| PrtR [Pseudomonas phage DVM-2008]
          Length = 267

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 79/226 (34%), Gaps = 27/226 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++     + G+   PS + I K
Sbjct: 15  MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSR----ILSGKIVDPSDKHISK 70

Query: 61  ILAATNETICQL---LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP------- 110
           I      +  QL    D+  +     ++   E+  +      +    D    P       
Sbjct: 71  IAEYFAVSTDQLRGRADVVPAGNARRDEPHSELKDISLWDDETPVEEDEVSVPFLREVEL 130

Query: 111 -TGNKWNTVGVPEIRSPHNGIYAIQTQDTRH------KTQDTSMLPLYRKGDILILNSA- 162
             G+    +   E  S   G  +++    +         +  SMLP+ R G  + +N+  
Sbjct: 131 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 190

Query: 163 ---IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
                +  GD L      G +  K L       I L S N     D
Sbjct: 191 CGIGDIVDGD-LYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPD 234


>gi|329768682|ref|ZP_08260166.1| LexA repressor [Gemella haemolysans M341]
 gi|328836396|gb|EGF86061.1| LexA repressor [Gemella haemolysans M341]
          Length = 224

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 35/107 (32%), Gaps = 5/107 (4%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
           +   P     + +   E+          Q +    + +  SM P    GD +I+      
Sbjct: 105 AAGIPISAVEDILDYEEVPQSWEN----QGEFFGLRIKGDSMKPDINDGDTVIVRQQSTA 160

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           N GD ++      D   K    + G  I L+S N  Y        ++
Sbjct: 161 NNGDVVIALVNGDDATCKKF-EKLGNGIMLISNNSEYSPMYFSNEEV 206


>gi|330807816|ref|YP_004352278.1| XRE family transcriptional regulator [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375924|gb|AEA67274.1| putative Transcription factor, Xre family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 247

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 79/226 (34%), Gaps = 27/226 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++     + G+   PS + I K
Sbjct: 1   MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSR----ILSGKIVDPSDKHISK 56

Query: 61  ILAATNETICQL---LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP------- 110
           I      +  QL    D+  +     ++   E+  +      +    D    P       
Sbjct: 57  IAEYFAVSTDQLRGRADVVPAGNARRDEPHSELKDISLWDDETPVEEDEVSVPFLREVEL 116

Query: 111 -TGNKWNTVGVPEIRSPHNGIYAIQTQDTRH------KTQDTSMLPLYRKGDILILNSA- 162
             G+    +   E  S   G  +++    +         +  SMLP+ R G  + +N+  
Sbjct: 117 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 176

Query: 163 ---IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
                +  GD L      G +  K L       I L S N     D
Sbjct: 177 CGIGDIVDGD-LYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPD 220


>gi|218890289|ref|YP_002439153.1| putative c repressor [Pseudomonas aeruginosa LESB58]
 gi|218770512|emb|CAW26277.1| putative c repressor [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%), Gaps = 3/87 (3%)

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
           +  +    SM PL   GD ++++ +      + + +      + AK +  +    + ++S
Sbjct: 146 SAVRIGGDSMEPLLSDGDTVMIDHSCNEVRDEAVYVIRLDDHLYAKRVQRQINGGLAIIS 205

Query: 198 LNCCYPVDTVEMSDIEW---IARILWA 221
            N  Y    V   D+E    I R++W+
Sbjct: 206 ANPAYQTMFVSKQDLEAVDIIGRVVWS 232


>gi|325272250|ref|ZP_08138668.1| peptidase S24/S26 domain-containing protein [Pseudomonas sp.
           TJI-51]
 gi|324102622|gb|EGC00051.1| peptidase S24/S26 domain-containing protein [Pseudomonas sp.
           TJI-51]
          Length = 142

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 44/128 (34%), Gaps = 10/128 (7%)

Query: 91  PLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM--L 148
           P           F     FP+    + +           I A        K +  SM   
Sbjct: 9   PTGGTESFPQYSFHVPAGFPSPAA-DHLEGHISLDELFDIRA--PHVYLVKVEGDSMQGA 65

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
            +Y  GD++I++   +   GD ++I     + V K L  R G  I L S N  YP   + 
Sbjct: 66  GIY-SGDLVIVDRGREAEHGD-IVIAAVNCEPVCKRLHRRDGVVI-LKSENPAYPARYIM 122

Query: 209 MSD--IEW 214
             D  + W
Sbjct: 123 EGDDFVVW 130


>gi|258543098|ref|YP_003188531.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634176|dbj|BAI00152.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637236|dbj|BAI03205.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640288|dbj|BAI06250.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643345|dbj|BAI09300.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646400|dbj|BAI12348.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649453|dbj|BAI15394.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652439|dbj|BAI18373.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655497|dbj|BAI21424.1| phage transcriptional regulator and peptidase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 249

 Score = 48.0 bits (113), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 48/129 (37%), Gaps = 7/129 (5%)

Query: 96  PPSGSGGFFDS-GVFPTGNK-WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
           P +G+G + D        +       +P+         +        +    SM P    
Sbjct: 117 PQAGAGAYIDEHCGLAESHVVLGAWEIPKNYIESYLPNS--ESLAIVRVVGNSMEPELNA 174

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI---SRRGRSIDLMSLNCCYPVDTVEMS 210
           GD +++++  ++   D + +      IV K L          + ++S+N  YP D   +S
Sbjct: 175 GDRVLVDTDHKIPTPDGMYVIWNGLGIVIKQLQVIPRSNPPRVRIISVNPTYPADEALLS 234

Query: 211 DIEWIARIL 219
           +I    R++
Sbjct: 235 EIVVNGRVV 243


>gi|260426266|ref|ZP_05780245.1| LexA repressor [Citreicella sp. SE45]
 gi|260420758|gb|EEX14009.1| LexA repressor [Citreicella sp. SE45]
          Length = 231

 Score = 48.0 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 21/165 (12%), Positives = 50/165 (30%), Gaps = 8/165 (4%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFP--PSGSGGFFDSGVFPTGNKW 115
           I K+  +                    +     P+           G   +   P  +  
Sbjct: 66  IVKLPESLGGRPAGFAPKVIDGDIPDSRPAAARPVATIEAMELQVLGRI-AAGEPIQSIA 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIK 174
           +    P   +   G+ +   +    + +  SM       GD++I+        GD ++ +
Sbjct: 125 DN---PPGIAVPTGMLSANARHYALEVRGDSMIEAGINDGDVVIIRETSSAENGDIVVAQ 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               +   K    + G +I L + N  Y    + +  ++   R++
Sbjct: 182 IEGYEATLKRFRRK-GDAIVLEAANPAYEPRVLPVGSVKVQGRLV 225


>gi|6491870|gb|AAF14052.1|AF039836_1 MucA [IncT plasmid R394]
          Length = 145

 Score = 48.0 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 19/108 (17%), Positives = 35/108 (32%), Gaps = 9/108 (8%)

Query: 106 SGVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAI 163
              FP+    W    +    + H  +          +    SM       GD+L+++ + 
Sbjct: 24  PAGFPSPAAGWEEAEL----NLHTLVVTHPASTYFLRVTGDSMQDARIHSGDVLVVDRSE 79

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
               G  +++     +   K LI R      LM +N  YP    +   
Sbjct: 80  TPEQGS-IVVASIDNEFTVKKLILRP--RPCLMPMNPAYPPIYFDPES 124


>gi|303246530|ref|ZP_07332809.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio
           fructosovorans JJ]
 gi|302492240|gb|EFL52115.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio
           fructosovorans JJ]
          Length = 140

 Score = 48.0 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/110 (18%), Positives = 40/110 (36%), Gaps = 14/110 (12%)

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK-----GDILILNS 161
             FP+    + +   +    +  +          +    SM    R      GDIL+++ 
Sbjct: 25  AGFPS-PAEDYID--KKLDLNEQLVRHPAATFFVRVDGDSM----RDAGVASGDILVVDR 77

Query: 162 AIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           A++   G  ++I    G++  K L  + G+ + L+  N  Y    V    
Sbjct: 78  AVEPRDG-HIVIAALDGELTVKRLRRKNGQVL-LVPENPDYAPVAVGPEA 125


>gi|218547977|ref|YP_002381768.1| Cro/CI family transcriptional regulator [Escherichia fergusonii
           ATCC 35469]
 gi|218355518|emb|CAQ88129.1| putative transcriptional regulator, Cro/CI family from phage origin
           [Escherichia fergusonii ATCC 35469]
          Length = 228

 Score = 48.0 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 65/183 (35%), Gaps = 25/183 (13%)

Query: 58  IFKILAAT----------NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
           I K+L  +          N +I  L+                IP+L    S   G     
Sbjct: 50  IAKVLGVSQKWLQLGIEDNASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAE- 108

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL--NSAIQV 165
           +  +   W     P  R+         +     K    S+LP+   GD++ +  +  + +
Sbjct: 109 IVESAIDW----FPLRRADLRKSGVCASNAKIVKIWGNSLLPVLNNGDLVAVDISQTVPI 164

Query: 166 NCGDRLLIKPRTGDIV-AKVLISRRGRSIDLMSLN-CCYPVDTV----EMSDIEWIARIL 219
             GD  L   R G ++  K+LI+     + L S N   YP + +      + I  I R+ 
Sbjct: 165 RDGD--LYAVRDGVLLRVKILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVF 222

Query: 220 WAS 222
           W+S
Sbjct: 223 WSS 225


>gi|290475034|ref|YP_003467918.1| putative phage repressor (fragment) [Xenorhabdus bovienii SS-2004]
 gi|289174351|emb|CBJ81145.1| Putative phage repressor (fragment) [Xenorhabdus bovienii SS-2004]
          Length = 116

 Score = 48.0 bits (113), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 38/102 (37%), Gaps = 17/102 (16%)

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
               +A+       +    SM P ++ GDI++++  +  N G+ ++      +   K   
Sbjct: 17  SERAFAL-------RIDGDSMEPDFKAGDIVVIDPEVTPNPGEFVVAASYEREATFKKYR 69

Query: 187 SRR-----GRSIDLMSLNCCYPVDTVEMSDIEWI-----ARI 218
                    +  +L+ LN  YP+   +   I  I      RI
Sbjct: 70  PITINIDGTQHFELIPLNNDYPILDNQRIKITIIGTMVEHRI 111


>gi|160897980|ref|YP_001563562.1| peptidase S24/S26 domain-containing protein [Delftia acidovorans
           SPH-1]
 gi|160363564|gb|ABX35177.1| peptidase S24 and S26 domain protein [Delftia acidovorans SPH-1]
          Length = 149

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 30/75 (40%), Gaps = 5/75 (6%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI-----SRR 189
                 +    SM P +R+GD ++++  ++   GD +  +    + + +           
Sbjct: 51  VHAFFLQLAGNSMTPEFREGDRVLIDPGVKPQPGDYVAAQVGKTEALFRKYRLHGNDRLG 110

Query: 190 GRSIDLMSLNCCYPV 204
               +L+ LN  +PV
Sbjct: 111 NEVFELIPLNQDHPV 125


>gi|84687233|ref|ZP_01015114.1| LexA repressor [Maritimibacter alkaliphilus HTCC2654]
 gi|84664821|gb|EAQ11304.1| LexA repressor [Rhodobacterales bacterium HTCC2654]
          Length = 230

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/166 (15%), Positives = 48/166 (28%), Gaps = 21/166 (12%)

Query: 59  FKILAATN-------ETICQLLDLPFSDGRTTEKKEKEIPLLYFP-PSGSGGFFDSGVFP 110
            + +  T                      R   +  + +PL          G   +   P
Sbjct: 61  ARAIEVTRLPDALDPSGKAGFEPRVIDGDRPDSRPAQAMPLEGSAMDLPLLGRI-AAGTP 119

Query: 111 TGNKWN---TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
                +    V VP     +   YA++        +  SM+      GD++I+      +
Sbjct: 120 IEAIEDGQSHVSVPGAMVGNGKHYALE-------VKGDSMINAGINSGDVVIIRETSHAD 172

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
            GD ++ +    +   K    R G  I L + N  +    +    I
Sbjct: 173 NGDIVVAQVDGYEATLKRF-RRAGDMIALEAANPAFETRILPQGQI 217


>gi|319957707|ref|YP_004168970.1| phage repressor [Nitratifractor salsuginis DSM 16511]
 gi|319420111|gb|ADV47221.1| putative phage repressor [Nitratifractor salsuginis DSM 16511]
          Length = 218

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 31/82 (37%)

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
                +  SM P    G I+ ++        D + +      +  K +  R    ++L+S
Sbjct: 131 EAIHVEGESMEPTLPDGSIVFIDREQTDPSKDGIFVAATGNGLFIKRIRRRADGMVELIS 190

Query: 198 LNCCYPVDTVEMSDIEWIARIL 219
            N  Y  + +    +E + R++
Sbjct: 191 DNPLYTPEVLSPDQVEIVGRVV 212


>gi|283954007|ref|ZP_06371533.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794490|gb|EFC33233.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 222

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 63/194 (32%), Gaps = 20/194 (10%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   +  L    +A++ G++P +FN  K        +      I   L   N +I  
Sbjct: 25  DILASEGKRELKTKDIAKELGINPDTFNSMKFRNPIPYPQ------ILNFLQERNISINY 78

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR-SPHNGI 130
                    +   + + +I   Y   +  GG         G   + +   ++        
Sbjct: 79  FFYGSSPKEQLESENKYKILKFYKTNASLGG---------GGINDLIDYSKLIIDEKLLS 129

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +              SM PL + G I I++           +I  R G +  K ++ +  
Sbjct: 130 FFGSKNCEFITCYGESMEPLIKDGSICIVDRNKTFKDKSICVINTRDG-LFIKQVLKQDD 188

Query: 191 RSIDLMSLNCCYPV 204
             I L SLN  Y  
Sbjct: 189 GVI-LHSLNPLYED 201


>gi|78184864|ref|YP_377299.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. CC9902]
 gi|78169158|gb|ABB26255.1| UmuD protein. Serine peptidase. MEROPS family S24 [Synechococcus
           sp. CC9902]
          Length = 147

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 38/105 (36%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V +      +  +          K    SM       GD+L+++ ++ 
Sbjct: 31  PAGFPSPAD-DYVEM--GIDLNEQLIRHPGSTFFLKVSGESMTEAGIHDGDLLVVDRSLD 87

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G R+++    G    K L    GR + L + +  YP   ++ 
Sbjct: 88  PRPG-RVVVAVLDGAFTLKRLARHHGR-LRLEAAHPDYPPLELQH 130


>gi|90021432|ref|YP_527259.1| LexA repressor [Saccharophagus degradans 2-40]
 gi|123396174|sp|Q21JT2|LEXA_SACD2 RecName: Full=LexA repressor
 gi|89951032|gb|ABD81047.1| SOS-response transcriptional repressor, LexA [Saccharophagus
           degradans 2-40]
          Length = 201

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 50/135 (37%), Gaps = 14/135 (10%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           S G    +  + IPL+    +G+       +    N  +   VP         Y ++ Q 
Sbjct: 63  SRGIRLPETIQGIPLIGRVAAGN------PILAEQNIEDYCDVPPDFFYPQANYLLKVQG 116

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS-RRGRSIDLM 196
              +            GD+L ++S  QV  GD ++ +    ++  K     R   +I L+
Sbjct: 117 MSMRDAG------ILDGDLLAVHSTTQVKNGDIVVARIED-EVTVKRFKRERNNATIQLL 169

Query: 197 SLNCCYPVDTVEMSD 211
             N  + +  V++ D
Sbjct: 170 PENPDFNIIEVDLRD 184


>gi|116070738|ref|ZP_01468007.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. BL107]
 gi|116066143|gb|EAU71900.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. BL107]
          Length = 147

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 38/105 (36%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V +      +  +          K    SM       GD+L+++ ++ 
Sbjct: 31  PAGFPSPAD-DYVEM--GIDLNEQLIRHPGSTFFLKVSGESMTEAGIHDGDLLVVDRSLD 87

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G R+++    G    K L    GR + L + +  YP   ++ 
Sbjct: 88  PRPG-RVVVAVLDGAFTLKRLARHHGR-LRLEAAHPDYPPLELQH 130


>gi|317051665|ref|YP_004112781.1| peptidase S24/S26A/S26B [Desulfurispirillum indicum S5]
 gi|316946749|gb|ADU66225.1| Peptidase S24/S26A/S26B, conserved region [Desulfurispirillum
           indicum S5]
          Length = 150

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 7/100 (7%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
              FP+    + V        +             + +  SM+    R GDILI++ +++
Sbjct: 26  PAGFPS-PAQDYVE--RTLDLNELCIRNAPATFFVRAEGDSMINAGIRPGDILIVDRSLE 82

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
               D ++ K   G++  K+L      +I L+ +N  Y  
Sbjct: 83  PRHKDIVIAKIH-GELTVKLLH--TTPTISLVPMNPNYQP 119


>gi|83593475|ref|YP_427227.1| XRE family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83576389|gb|ABC22940.1| transcriptional regulator, XRE family [Rhodospirillum rubrum ATCC
           11170]
          Length = 196

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 64/211 (30%), Gaps = 40/211 (18%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
           +   ++   LA+  G++ ++    +R     +  W   E + +IL  +       L    
Sbjct: 13  KDQGMSQYALAKLLGVNQSTIAYYERGRNTPKP-W-IVEDLARILNVS----AAFLLYGR 66

Query: 78  SDGRTTEKKEKEIPLLY---FPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
                       + L       P+   GF      P G                      
Sbjct: 67  ERTDPLVPVVGRVGLGGQVTLAPAEPIGF---TELPPGAS-------------------- 103

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC-----GDRLLIKPRTGDIVAKVLIS-R 188
           ++      +  ++ P+YR GDI+  +            G   +++   G  + K++   R
Sbjct: 104 SRTEALIVEGDALWPVYRAGDIVFFSEEDVHRSPEDLHGRDCVVRLADGTTLIKLIKRGR 163

Query: 189 RGRSIDLMSLN-CCYPVDTVEMSD-IEWIAR 217
                 L S N        +E +  I W+ R
Sbjct: 164 TKALFTLASYNAPDIEDIALEKAAPIRWVKR 194


>gi|255318670|ref|ZP_05359900.1| Peptidase S24-like domain protein [Acinetobacter radioresistens
           SK82]
 gi|262379502|ref|ZP_06072658.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255304271|gb|EET83458.1| Peptidase S24-like domain protein [Acinetobacter radioresistens
           SK82]
 gi|262298959|gb|EEY86872.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 232

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 51/132 (38%), Gaps = 15/132 (11%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
              + +  P+L +   GS     +      ++W    +P      +  + +Q        
Sbjct: 88  PRVRARMAPVLSWVQVGSFTNVAAVDMSEVSQW----LPLPEDECSNCFFLQ-------V 136

Query: 143 QDTSMLPLYRKGDILILNSAIQ---VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
           Q  S  P + +GD +++N       +  GD ++++        K++I   G+   L +LN
Sbjct: 137 QGISNFPDFIEGDYIVVNPDAYYGDMQSGDIIVVRRGEDATFKKLVIETNGKRY-LQALN 195

Query: 200 CCYPVDTVEMSD 211
             +  + +E  +
Sbjct: 196 PDFKPNIIEFDE 207


>gi|323700030|ref|ZP_08111942.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio sp. ND132]
 gi|323459962|gb|EGB15827.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio
           desulfuricans ND132]
          Length = 153

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 35/98 (35%), Gaps = 6/98 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
              FP+      +   +    +  +          +    SM+      GD+L+++ ++ 
Sbjct: 37  PAGFPS-PAEEYLE--KRLDLNEHLVTRPEATYFVRVSGDSMIGAGIHHGDLLVVDRSLD 93

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              G+ ++I    G+   K L  +    ++L   N  Y
Sbjct: 94  PRPGN-VVIALVEGEFTVKRL-RKSPLGLELAPENPEY 129


>gi|317051151|ref|YP_004112267.1| peptidase S24/S26A/S26B [Desulfurispirillum indicum S5]
 gi|316946235|gb|ADU65711.1| Peptidase S24/S26A/S26B, conserved region [Desulfurispirillum
           indicum S5]
          Length = 218

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 4/87 (4%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           +    SM P    GDIL+++   Q    D + I    G++V K +      S+ +MS N 
Sbjct: 128 EVCGDSMEPTIYAGDILLVDQRFQKVGNDGIYILRLHGELVVKRVQRLIDGSLRIMSDNK 187

Query: 201 CYPVDTVEM---SDIEWIARILW-ASQ 223
            Y   T+       +  +  ++W ASQ
Sbjct: 188 AYMDQTISAELSEQVCVVGFVVWRASQ 214


>gi|310815580|ref|YP_003963544.1| LexA repressor [Ketogulonicigenium vulgare Y25]
 gi|308754315|gb|ADO42244.1| LexA repressor [Ketogulonicigenium vulgare Y25]
          Length = 221

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 48/158 (30%), Gaps = 14/158 (8%)

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN-- 116
            + L             P +  R  +     +  L        G   +   P        
Sbjct: 61  ARALEVVRMP-EMTAHKPAAAARKPQLVASALNTLAAIEVDVMGRI-AAGVPIAAISEVS 118

Query: 117 -TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIK 174
             V VP+        YA++        Q  SM+ +    GDI+++  A   + GD ++  
Sbjct: 119 HQVAVPQGMIGTGNHYALE-------VQGDSMIGIGINDGDIVVIRHADLASNGDIVVAL 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
               +   K    + G  I L + N  Y    +  + +
Sbjct: 172 VDEAEATLKRFRRQNG-MIALEAANPAYETRLLPEARV 208


>gi|145300731|ref|YP_001143572.1| prophage transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853503|gb|ABO91824.1| prophage transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 238

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 75/230 (32%), Gaps = 45/230 (19%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +   A R +++ SGL              KR+  EG     +   I + L          
Sbjct: 29  LRAFARRADMSDSGL--------------KRYLYEG-----TIPPIDRALNLARAGGVTF 69

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF----------PTGNKWNTVGVPE 122
             L F  G         +   +   SG+ G + +  F            G+       P 
Sbjct: 70  DWLVFGIGDGVNSPLSHV--SHDATSGAQGSYRADEFTTISAYQVEASAGHGSQITDEPL 127

Query: 123 IRSPHNGIYAIQTQDTR------HKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIK 174
                     ++ +          + +  SM P    GD++++   +      G  +L  
Sbjct: 128 AEPMAFRSDWLRREGFEPAKMAVIRAKGDSMEPTINDGDVILIRLKNGEAPRDGLYVL-- 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARILWA 221
              G +  K L    G  I ++S N  Y    +   E+++++ + R++WA
Sbjct: 186 RLEGGLFVKRLQFDLGG-IRVISDNPLYKSRDLNKAELAELDLVGRVVWA 234


>gi|163731991|ref|ZP_02139437.1| LexA repressor [Roseobacter litoralis Och 149]
 gi|161394289|gb|EDQ18612.1| LexA repressor [Roseobacter litoralis Och 149]
          Length = 233

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 67/209 (32%), Gaps = 41/209 (19%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDG--RTTEKKEKEIPLLYFPPS 98
           KR   +G    PS + + + L   +   I +L+      G  R    + + I ++  P +
Sbjct: 15  KRVQRDGVP--PSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHRARAIEIVKLPEA 72

Query: 99  ---GSGGFFD---------SGVFPTGN----KWNTVGVPEIRS-----------PHNGIY 131
               + G F              P G       + V +P +              ++   
Sbjct: 73  LGGAAQGRFTPRVIEGDKPDAPLPAGAQAVSSADAVSLPLVGRIAAGLPIEAINQNSASV 132

Query: 132 AIQTQ-------DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
           A+  Q           + +  SM+      GD++++      + GD ++      +   K
Sbjct: 133 AVPGQMLSGKGDHYALEVKGDSMIDAGINDGDVVVIRETSAADNGDIVVALIEDHEATLK 192

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
             + R G SI L + N  Y         +
Sbjct: 193 RYMRR-GSSIALEAANPAYETRVFTEDKV 220


>gi|26989752|ref|NP_745177.1| transcriptional repressor pyocin R2_PP [Pseudomonas putida KT2440]
 gi|24984646|gb|AAN68641.1|AE016494_1 pyocin R2_PP, transcriptional repressor, CI/C2 family [Pseudomonas
           putida KT2440]
          Length = 243

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 90  IPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
           +PL+ +  +G+      +      + W +  VP   S     YA++              
Sbjct: 114 VPLISWVQAGAWCEAISNFEPYQADSWLSCPVPISDSG----YALKVLGDSMTNPGPGRS 169

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             Y  G I+ ++  ++ N GDR++ + PRT ++  KVL+S  GR   L  +N  YP
Sbjct: 170 --YPTGCIIFVDPEVEANTGDRVIARVPRTNEVTFKVLVSDAGRQF-LRPINPQYP 222


>gi|126731368|ref|ZP_01747175.1| LexA repressor [Sagittula stellata E-37]
 gi|126708279|gb|EBA07338.1| LexA repressor [Sagittula stellata E-37]
          Length = 231

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/169 (16%), Positives = 53/169 (31%), Gaps = 16/169 (9%)

Query: 58  IFKILAATNETICQLLDLPFSDGRT--TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           I K+  +                R   T  +  EI  L        G   +   P  +  
Sbjct: 66  IVKLPESLGGAPAGFSPRVIEGDRPDNTPGRATEINTLDVTELPIMGRI-AAGVPIESIN 124

Query: 116 NT---VGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           +    + VP +     G  YA++        +  SM       GD++++        GD 
Sbjct: 125 DEPPGIAVPGMMLKGQGRHYALE-------VRGDSMIEAGINDGDVVVIRETSDAADGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ +    +   K    + G  I L + N  Y    +   D+    R++
Sbjct: 178 VVAQIEGYEATLKRFRRK-GEMIVLEAANPAYEPRVLPRGDVNVQGRLV 225


>gi|33865578|ref|NP_897137.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 8102]
 gi|33632747|emb|CAE07559.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 8102]
          Length = 143

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 14/133 (10%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
                    +    +PL     +          FP+    + V V      ++ +    T
Sbjct: 5   HQPLPLQPRRTRLSLPLAGERVA--------AGFPSPAD-DYVEV--GIDLNDQLIRHPT 53

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                +    SML      GD+L+++ ++    G R+++    G+   K L+   GR + 
Sbjct: 54  STFFLRVSGESMLGAGIHDGDLLVVDRSLDPRPG-RVVVAVLDGEFTLKRLVQHHGR-LR 111

Query: 195 LMSLNCCYPVDTV 207
           L + N  YP   +
Sbjct: 112 LEAANPAYPPLEL 124


>gi|56750016|ref|YP_170717.1| DNA polymerase V [Synechococcus elongatus PCC 6301]
 gi|81300358|ref|YP_400566.1| SOS mutagenesis protein UmuD [Synechococcus elongatus PCC 7942]
 gi|56684975|dbj|BAD78197.1| DNA polymerase V [Synechococcus elongatus PCC 6301]
 gi|81169239|gb|ABB57579.1| UmuD protein. Serine peptidase. MEROPS family S24 [Synechococcus
           elongatus PCC 7942]
          Length = 186

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 43/103 (41%), Gaps = 6/103 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + +   +    +  +          +    SM+ +    GD++I++ +++
Sbjct: 70  SAGFPSPAD-DYIE--QRLDLNRHLIKNPAATFMARVSGDSMIGVGIHDGDVIIVDRSLE 126

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
              G +++I    G++  K L  +  + + L + N  YP   +
Sbjct: 127 PRDG-QIVIAVLNGELTVKRL-RQERQRLFLQAENPNYPDLEI 167


>gi|303257626|ref|ZP_07343638.1| prophage MuSo1, transcriptional regulator, Cro/CI family
           [Burkholderiales bacterium 1_1_47]
 gi|302859596|gb|EFL82675.1| prophage MuSo1, transcriptional regulator, Cro/CI family
           [Burkholderiales bacterium 1_1_47]
          Length = 230

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 33/80 (41%), Gaps = 1/80 (1%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +           SM P +R GD+++++   +    D +      GD+  K +    G ++
Sbjct: 133 EQGYELITASGDSMEPTFRNGDLIVVDRQDRDLKRDGVFCVLVDGDLYVKRVQRIPG-AV 191

Query: 194 DLMSLNCCYPVDTVEMSDIE 213
             +S N  Y    + + ++E
Sbjct: 192 LFISDNSLYRPFEIPIKEVE 211


>gi|300907046|ref|ZP_07124714.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|301304048|ref|ZP_07210165.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|300401193|gb|EFJ84731.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|300840655|gb|EFK68415.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|315257709|gb|EFU37677.1| peptidase S24-like domain protein [Escherichia coli MS 85-1]
          Length = 237

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGYKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|254448318|ref|ZP_05061780.1| protein ImpA [gamma proteobacterium HTCC5015]
 gi|198262185|gb|EDY86468.1| protein ImpA [gamma proteobacterium HTCC5015]
          Length = 160

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 45/117 (38%), Gaps = 8/117 (6%)

Query: 101 GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILIL 159
            G+   G FP+    + +        ++ + A        + Q  SM       GDIL++
Sbjct: 33  AGYSIQGGFPS-PAEDFLE--SRLDLNDLLIARPAATFYLRYQGDSMRDAGLHPGDILVV 89

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD--IEW 214
           + A     GD +++    G++  K L +R    I L + +  +P   +      + W
Sbjct: 90  DRAESPRHGD-IVVAVVDGEMTCKRLYNR-AGLIRLDAEHPEFPNIELRQDSELVIW 144


>gi|116748371|ref|YP_845058.1| SOS-response transcriptional repressor LexA [Syntrophobacter
           fumaroxidans MPOB]
 gi|171460792|sp|A0LGS1|LEXA_SYNFM RecName: Full=LexA repressor
 gi|116697435|gb|ABK16623.1| SOS-response transcriptional repressor, LexA [Syntrophobacter
           fumaroxidans MPOB]
          Length = 206

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 42/133 (31%), Gaps = 17/133 (12%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
                   IP L    +G+         P       V +PE         A    +   +
Sbjct: 70  PLHTGAVSIPFLGVVAAGT---------PI----EAVEIPESVEVPESFLA-NGNNFALR 115

Query: 142 TQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
            +  SM     R+GDILI+    +   G + ++    G+   K    +RG  I+L   N 
Sbjct: 116 VKGDSMIEEGIREGDILIVARQSRAENG-QTVVALVQGEATVKKF-YQRGEEIELRPANS 173

Query: 201 CYPVDTVEMSDIE 213
                      +E
Sbjct: 174 RMQPIHARADAVE 186


>gi|254498302|ref|ZP_05111042.1| phage repressor [Legionella drancourtii LLAP12]
 gi|254352464|gb|EET11259.1| phage repressor [Legionella drancourtii LLAP12]
          Length = 198

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 63/159 (39%), Gaps = 9/159 (5%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFS-DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           R P  E I ++  A       L+ L        T+K  + IPL     +       + + 
Sbjct: 21  RTPGPEEIKQLANALEVPAAFLMCLSDEKQENQTKKLSRLIPLFNHHQACDAKHCLNELR 80

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
             G+  N V    I      +  ++      K  D SM+P +R  D L+++S+ Q   G+
Sbjct: 81  EQGSSDNAVL---ISVSAALLPTLEGDAFALKMIDDSMMPEFRLNDTLVIDSSAQPKPGN 137

Query: 170 RLLIKPRT-GDIVA---KVLISRRGRSIDLMSLNCCYPV 204
            ++++     +++    K L        +L++LN  +P 
Sbjct: 138 YVVVRMDGKSEVIICQYKKLSYTSPE-FELLTLNDNWPN 175


>gi|89069553|ref|ZP_01156897.1| LexA repressor [Oceanicola granulosus HTCC2516]
 gi|89044888|gb|EAR50978.1| LexA repressor [Oceanicola granulosus HTCC2516]
          Length = 229

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 43/138 (31%), Gaps = 13/138 (9%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---VGVPEIRSPHNGIYAIQT 135
              +     K +           G   +   P          V VP+        YA++ 
Sbjct: 88  PDASPPPAAKPVEAAGAVELPVMGRI-AAGVPIAAISEESSRVAVPQGMIGRGPHYALE- 145

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                  +  SM+ +    GD++++      + GD ++      +   K    + G SI 
Sbjct: 146 ------VRGDSMIDMGINDGDVVVIRETATADDGDVVVALVEEQEATLKRFRRQ-GSSIA 198

Query: 195 LMSLNCCYPVDTVEMSDI 212
           L + N  Y    +  + +
Sbjct: 199 LEAANPAYETRILPAAMV 216


>gi|85708240|ref|ZP_01039306.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. NAP1]
 gi|85689774|gb|EAQ29777.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. NAP1]
          Length = 211

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 55/151 (36%), Gaps = 10/151 (6%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
            +             EIP+L     +G G    S    T   ++   +  + S  +   +
Sbjct: 62  QVLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGFDERWLRHLTSAKSASLS 121

Query: 133 IQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR-G 190
           I         +  SM P    GD +L+  S       D + +      +V K +  +  G
Sbjct: 122 I------VGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDALVVKRIAIKPGG 175

Query: 191 RSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
           R I + S N  YP    ++ S++  + R++W
Sbjct: 176 RQITIASDNPAYPTWYDMDRSEVHVVGRVIW 206


>gi|34495811|ref|NP_900026.1| transcriptional regulator [Chromobacterium violaceum ATCC 12472]
 gi|34101666|gb|AAQ58034.1| probable transcriptional regulator [Chromobacterium violaceum ATCC
           12472]
          Length = 248

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 5/93 (5%)

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
           A          +  SM  +    D +++N   + + G+ L +     DI  K L    G 
Sbjct: 151 ASPRNLVVISVKGDSMSGVLEDRDTILVN-TAERHPGEGLFVIRIGDDIFVKQLQRLPGG 209

Query: 192 SIDLMSLNCCYPVDTVEMS----DIEWIARILW 220
           ++ + S N  Y   TV++S    + E I R++W
Sbjct: 210 AVQVKSANPLYETFTVDLSRASGEFEVIGRVVW 242


>gi|84515591|ref|ZP_01002953.1| LexA repressor [Loktanella vestfoldensis SKA53]
 gi|84510874|gb|EAQ07329.1| LexA repressor [Loktanella vestfoldensis SKA53]
          Length = 227

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 45/154 (29%), Gaps = 12/154 (7%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN---TVGVPEIRSP 126
                   +  +        +P+     S       +   P          V VP+    
Sbjct: 76  SGFQPRVIAGDKPASIPTAALPVEGGSMSLPVMGRIAAGVPIEAISEVSHHVHVPQSMLG 135

Query: 127 HNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
               YA++        +  SM       GD++++      N GD ++      +   K  
Sbjct: 136 KGEHYALE-------VKGDSMIEAGINDGDVVVIRETSVANNGDIVVALVEGQEATLKRF 188

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             R G +I L + N  Y         ++   R++
Sbjct: 189 -RRTGSAIALEAANPAYETRVFRDDQVKVQGRLV 221


>gi|331663913|ref|ZP_08364823.1| repressor protein phage e14 [Escherichia coli TA143]
 gi|325496547|gb|EGC94406.1| e14 prophage; repressor protein phage e14 [Escherichia fergusonii
           ECD227]
 gi|331059712|gb|EGI31689.1| repressor protein phage e14 [Escherichia coli TA143]
          Length = 97

 Score = 47.2 bits (111), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT-GDIVAKVLISRRGRSIDL 195
               +    SM+  YR GD++ ++  +    GD ++      G+   K LI    +   L
Sbjct: 2   TYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQRY-L 60

Query: 196 MSLNCCYPVDTV 207
            +LN  +P   +
Sbjct: 61  KALNPNWPEPYI 72


>gi|307294055|ref|ZP_07573899.1| putative phage repressor [Sphingobium chlorophenolicum L-1]
 gi|306880206|gb|EFN11423.1| putative phage repressor [Sphingobium chlorophenolicum L-1]
          Length = 223

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 50/146 (34%), Gaps = 9/146 (6%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
                +      +P L    S   G  D     TG     +        H G+     + 
Sbjct: 78  PVKGRSLPSVITVPRLSLGASAGPGSLDEDERATGA----MAFDANWLRHLGVR--PQKI 131

Query: 138 TRHKTQDTSMLPLYRKGDILILNS-AIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI-DL 195
           +  +    SM P    GD ++++         D + +    G ++ K +     R +  +
Sbjct: 132 SIIRVDGESMAPTLSDGDEIMVDHDDDATRLRDGVYVLRLDGVLMVKRVALGPRRGLFSV 191

Query: 196 MSLNCCYPV-DTVEMSDIEWIARILW 220
           +S N  YP    ++ + +  + R++W
Sbjct: 192 LSDNPHYPDWIDIDPALVVIVGRVVW 217


>gi|85373679|ref|YP_457741.1| prophage MuMc02-like, S24 family peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84786762|gb|ABC62944.1| prophage MuMc02-like, peptidase, family S24 [Erythrobacter
           litoralis HTCC2594]
          Length = 211

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 77/216 (35%), Gaps = 25/216 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +DR+  +     + ++R  G +P      ++F   G  R        K+     +T+   
Sbjct: 8   LDRLILKSGYGYASISRLLGRNPAYV---QQFIKRGSPR--------KLDDEDRKTLACF 56

Query: 73  LDLPF----SDGRTTEKKEKEIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
             +                 EIP+L     +G G    S    T   ++   +  + S  
Sbjct: 57  FGVDEQVLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGFDERWLRHLTSAK 116

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
           +   +I         +  SM P    GD +L+  S       D + +      +V K + 
Sbjct: 117 SASLSI------VGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDALVVKRIA 170

Query: 187 SRR-GRSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
            +  GR I + S N  YP    ++ S++  + R++W
Sbjct: 171 IKPGGRQITIASDNPAYPTWYDMDRSEVHVVGRVIW 206


>gi|85375768|ref|YP_459830.1| prophage MuMc02, S24 family peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84788851|gb|ABC65033.1| prophage MuMc02, peptidase, family S24 [Erythrobacter litoralis
           HTCC2594]
          Length = 211

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 78/216 (36%), Gaps = 25/216 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +DR+ ++  L  S ++R  G + +     ++F   G  R        K+       +   
Sbjct: 8   LDRLIQQRRLGYSAISRLIGRNSSYI---QQFIKRGSPR--------KLDDDDRRVLASF 56

Query: 73  LDLPF----SDGRTTEKKEKEIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
             +                 EIP+L     +G G   +S    T   ++   +  +    
Sbjct: 57  FGVDEQVLGGPPAPIRDGLIEIPVLNVDASAGFGAIAESETAHTRFGFDERWLAALTRAK 116

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
           +   +I            SM P    GD +L+  S       D + +      +V K + 
Sbjct: 117 SASLSI------IHVLGDSMEPTLSDGDEVLVDASDEGSRLRDGIYVLRADDALVVKRVT 170

Query: 187 SRR-GRSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
            +  GR I + S N  YP  D V+ S+I+ + R++W
Sbjct: 171 LKPGGRKITISSDNAAYPSWDDVDRSEIQVVGRVIW 206


>gi|120611227|ref|YP_970905.1| LexA repressor [Acidovorax citrulli AAC00-1]
 gi|326317456|ref|YP_004235128.1| transcriptional repressor, LexA family [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|171769179|sp|A1TQ93|LEXA_ACIAC RecName: Full=LexA repressor
 gi|120589691|gb|ABM33131.1| SOS-response transcriptional repressor, LexA [Acidovorax citrulli
           AAC00-1]
 gi|323374292|gb|ADX46561.1| transcriptional repressor, LexA family [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 224

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 121 PEIRSPH-NGIYAIQTQ------DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
           P +   H +  Y+++        D   K +  SM       GD+L + S  +   G  ++
Sbjct: 110 PILAEEHVDQTYSVEGSLFQHKPDYLLKVRGMSMRDAGIMDGDLLAVQSTREARNGQIIV 169

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            +    ++  K L  R   +I+L+  N  YP+ TV+  +
Sbjct: 170 ARLGD-EVTVKRL-RRTAGAIELLPENPDYPIITVQPGE 206


>gi|117926824|ref|YP_867441.1| phage lambda repressor protein. serine peptidase. MEROPS family S24
           [Magnetococcus sp. MC-1]
 gi|117610580|gb|ABK46035.1| phage repressor protein, Serine peptidase, MEROPS family S24
           [Magnetococcus sp. MC-1]
          Length = 235

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 72/212 (33%), Gaps = 44/212 (20%)

Query: 15  RMAERH-NLTPSGLARKAGLDPTSFNK-----SKRFGIEG--------RNRWPSTESIFK 60
           RMA  H  ++ S LAR+ G+ P +        ++R G           R  W        
Sbjct: 32  RMALDHVGMSQSELARRVGIRPQTVQHVCAGHTRRSGYTAEFAQVLGVRPEW-------- 83

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LA  + ++ +                + +P+L +        +    +          +
Sbjct: 84  -LAIGHGSLREFA------NEQNSGAVRRLPMLNWSNVIH---WSQSGYQAQQMGEVYDL 133

Query: 121 PEIRSP-HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            E+  P  N  +A+       K    SM P   +G  ++++    V   + L+I    G+
Sbjct: 134 VEVTKPFGNHAFAL-------KVGGDSMEPKVPEGSTILVDP-AYVAQNNYLVIAHLEGE 185

Query: 180 IVA--KVLISRRGRSIDLMSLNCCYPVDTVEM 209
             A  K L+   G    L  LN  YP+  +  
Sbjct: 186 PEATFKQLVLEGGGRY-LKPLNPRYPIVDLSR 216


>gi|330503085|ref|YP_004379954.1| protein MucA [Pseudomonas mendocina NK-01]
 gi|328917371|gb|AEB58202.1| protein MucA [Pseudomonas mendocina NK-01]
          Length = 143

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 41/107 (38%), Gaps = 6/107 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + V      S  +            + +  SM  L    GDI++++ ++ 
Sbjct: 24  SAGFPS-PAEDHVD--ANLSLDDLCVQHPAATFFLRVRGDSMRDLGIFDGDIVVVDRSLT 80

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              G  +++    G    K L S+ GR + L + N  YP   +   +
Sbjct: 81  PRVG-MVVVALVNGAFTCKQLGSQDGRPV-LHAANPAYPDIHLGEGE 125


>gi|260583034|ref|ZP_05850816.1| dihydroorotate dehydrogenase 2 [Haemophilus influenzae NT127]
 gi|260093885|gb|EEW77791.1| dihydroorotate dehydrogenase 2 [Haemophilus influenzae NT127]
          Length = 218

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 62/179 (34%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        +   A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +      K L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYKELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|148825949|ref|YP_001290702.1| putative prophage repressor CI [Haemophilus influenzae PittEE]
 gi|229846735|ref|ZP_04466842.1| putative prophage repressor CI [Haemophilus influenzae 7P49H1]
 gi|148716109|gb|ABQ98319.1| putative prophage repressor CI [Haemophilus influenzae PittEE]
 gi|229810224|gb|EEP45943.1| putative prophage repressor CI [Haemophilus influenzae 7P49H1]
          Length = 218

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 62/179 (34%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        +   A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVAK---VLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +   K    L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYRELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|145632034|ref|ZP_01787780.1| putative prophage repressor CI [Haemophilus influenzae R3021]
 gi|144982305|gb|EDJ89901.1| putative prophage repressor CI [Haemophilus influenzae R3021]
          Length = 218

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 62/179 (34%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        +   A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +      K L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYKELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|317152101|ref|YP_004120149.1| peptidase S24/S26A/S26B [Desulfovibrio aespoeensis Aspo-2]
 gi|316942352|gb|ADU61403.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 156

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 38/122 (31%), Gaps = 14/122 (11%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
               + +PL                FP+    + +   +    +  +          +  
Sbjct: 26  RSAARPLPLAGEAV--------PAGFPS-PAEDYIE--KTLDLNEYLAPRPEATFFVRVA 74

Query: 144 DTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
             SM       GDIL+++ ++  N G+ ++I    G    K L       ++L   N  Y
Sbjct: 75  GDSMTGASIHHGDILVVDRSVTPNPGN-VVIACIDGGFTVKRLQR-TAGGLELAPENPDY 132

Query: 203 PV 204
             
Sbjct: 133 AP 134


>gi|145632822|ref|ZP_01788555.1| putative prophage repressor CI [Haemophilus influenzae 3655]
 gi|145635978|ref|ZP_01791661.1| putative prophage repressor CI [Haemophilus influenzae PittAA]
 gi|229844113|ref|ZP_04464254.1| putative prophage repressor CI [Haemophilus influenzae 6P18H1]
 gi|144986478|gb|EDJ93044.1| putative prophage repressor CI [Haemophilus influenzae 3655]
 gi|145266765|gb|EDK06786.1| putative prophage repressor CI [Haemophilus influenzae PittAA]
 gi|229813107|gb|EEP48795.1| putative prophage repressor CI [Haemophilus influenzae 6P18H1]
          Length = 218

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/179 (18%), Positives = 62/179 (34%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEILAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        +   A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +      K L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYKELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 208


>gi|169795366|ref|YP_001713159.1| putative repressor [Acinetobacter baumannii AYE]
 gi|293609635|ref|ZP_06691937.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|169148293|emb|CAM86158.1| conserved hypothetical protein; putative repressor [Acinetobacter
           baumannii AYE]
 gi|292828087|gb|EFF86450.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 231

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 9/82 (10%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQ---VNCGDRLLIKPRTGDIVA---KVLISRR 189
                K    SMLP +  GD + +N  IQ   +   D +++    G+  A   K++I   
Sbjct: 138 NGYGLKITGNSMLPRFEPGDRIYVNPDIQTFDLQTNDLVIV-ACAGETEATFKKLIIEGN 196

Query: 190 GRSIDLMSLNCCYPVDTVEMSD 211
            R ++   LN  +P   + +++
Sbjct: 197 NRYLE--PLNPDWPEKIIRLTE 216


>gi|224372655|ref|YP_002607027.1| hypothetical protein NAMH_0610 [Nautilia profundicola AmH]
 gi|223589461|gb|ACM93197.1| conserved hypothetical protein [Nautilia profundicola AmH]
          Length = 205

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
           I            SM P  + G I+ ++     V  G   ++    G +  K +  R   
Sbjct: 117 IDKDLDAINVIGDSMEPTIKDGSIIFIDRNDKSVQNGGIFVVSTPAG-VFVKRINLRSDG 175

Query: 192 SIDLMSLNCCYPVDTVEMSDIEW-IARIL 219
            I+L+S N  YP +TVE ++I   + RI+
Sbjct: 176 KIELISDNKLYPGETVEDAEIIGKVVRIM 204


>gi|327251986|gb|EGE63658.1| repressor protein CI [Escherichia coli STEC_7v]
          Length = 197

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 26  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 79

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 80  RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 138

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 139 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 172


>gi|312965228|ref|ZP_07779464.1| repressor protein CI [Escherichia coli 2362-75]
 gi|312290112|gb|EFR17996.1| repressor protein CI [Escherichia coli 2362-75]
          Length = 237

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|9634163|ref|NP_037735.1| prophage repressor CI [Enterobacteria phage HK97]
 gi|193069559|ref|ZP_03050512.1| prophage repressor [Escherichia coli E110019]
 gi|215487607|ref|YP_002330038.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218688908|ref|YP_002397120.1| Repressor protein CI from prophage [Escherichia coli ED1a]
 gi|300825481|ref|ZP_07105548.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
 gi|6901592|gb|AAF31095.1|AF069529_8 prophage repressor CI [Enterobacteria phage HK97]
 gi|133874013|gb|ABO40704.1| prophage repressor [Enterobacteria phage mEp234]
 gi|133874022|gb|ABO40712.1| prophage repressor [Enterobacteria phage HK106]
 gi|192957106|gb|EDV87556.1| prophage repressor [Escherichia coli E110019]
 gi|215265679|emb|CAS10082.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218426472|emb|CAR07300.1| Repressor protein CI from prophage [Escherichia coli ED1a]
 gi|300522067|gb|EFK43136.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
          Length = 237

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 52/155 (33%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|312134838|ref|YP_004002176.1| XRE family transcriptional regulator [Caldicellulosiruptor
           owensensis OL]
 gi|311774889|gb|ADQ04376.1| transcriptional regulator, XRE family [Caldicellulosiruptor
           owensensis OL]
          Length = 230

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 56/176 (31%), Gaps = 32/176 (18%)

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGR-----------------TTEKKEKEIPL 92
            R PS E + K     N +   L+ L  S                        K   IP+
Sbjct: 50  KRMPSLEMVKKFADFFNVSTDYLMGLTNSPNPNQDDDVVKKFLENNPDVRPVGKMIPIPI 109

Query: 93  LYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYR 152
           +    +GS G      +        V V  ++                + +  SM P   
Sbjct: 110 IGTVRAGSDGSLACEEY---LGSELVEVDTVKDGEYFF---------LRVKGDSMYPEIF 157

Query: 153 KGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV 207
           +GD++++     V  G+  ++I      +V KV+       I L S+N  Y    +
Sbjct: 158 EGDLVLVRKQPDVESGELAVVIVNGDEGVVKKVIKKENA--IILQSVNPKYEPIVI 211


>gi|315124225|ref|YP_004066229.1| signal peptidase I, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315017947|gb|ADT66040.1| signal peptidase I, putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 208

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQ----VNCGDRLLIKPRTGDIVAKVLISRR-GRSID 194
            K    SM P    GD++ ++ +      V  GD ++I    G+I  K L+ +     I 
Sbjct: 122 IKVIGDSMEPFIHNGDVIAVDVSKNKLELVKNGDIVVINL-DGEIYCKKLLKQPFVNEIV 180

Query: 195 LMSLNCCYPVDTVEMSDI 212
           L S+N  Y    V +  I
Sbjct: 181 LSSMNSFYKDIVVNIDQI 198


>gi|77457362|ref|YP_346867.1| phage repressor [Pseudomonas fluorescens Pf0-1]
 gi|77381365|gb|ABA72878.1| putative regulatory protein of cro/cI family [Pseudomonas
           fluorescens Pf0-1]
          Length = 270

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 80/247 (32%), Gaps = 33/247 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++     + G+   PS + I K
Sbjct: 24  MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSR----ILSGKIVDPSDKHISK 79

Query: 61  ILAATNETICQLLDLPFSDGRTTEKK---EKEIPLLYFPPSGSGG--------FFDSGVF 109
           I      +  QL             +     E+  +      +          F      
Sbjct: 80  IAEYFAVSTDQLRGRADVAPAANAGRDELHSELKDISLWDDDTPVDDDEVSVPFLREVEL 139

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH------KTQDTSMLPLYRKGDILILNSA- 162
             G+    +   E  S   G  +++    +         +  SMLP+ R G  + +N+  
Sbjct: 140 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 199

Query: 163 ---IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT------VEMSDIE 213
                +  GD L      G +  K L       I L S N     D       ++   I 
Sbjct: 200 CGIGDIIDGD-LYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPDEDYSFQDMQEEQIV 257

Query: 214 WIARILW 220
            +  + W
Sbjct: 258 ILGHVFW 264


>gi|86149763|ref|ZP_01067992.1| signal peptidase I, putative [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|86151693|ref|ZP_01069907.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85839581|gb|EAQ56841.1| signal peptidase I, putative [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85841322|gb|EAQ58570.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|313116387|gb|ADR32195.1| phage repressor protein, putative [Campylobacter jejuni]
          Length = 224

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQ----VNCGDRLLIKPRTGDIVAKVLISRR-GRSID 194
            K    SM P    GD++ ++ +      V  GD ++I    G+I  K L+ +     I 
Sbjct: 122 IKVIGDSMEPFIHNGDVIAVDVSKNKLELVKNGDIVVINL-DGEIYCKKLLKQPFVNEIV 180

Query: 195 LMSLNCCYPVDTVEMSDI 212
           L S+N  Y    V +  I
Sbjct: 181 LSSMNSFYKDIVVNIDQI 198


>gi|311234974|gb|ADP87828.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio vulgaris
           RCH1]
          Length = 201

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  +    SML      GD+L+++ A+    G R++I    G++  K L+   GR 
Sbjct: 110 PAATFYVRASGESMLGAGVHDGDLLVVDRALDPRPG-RVVIAAVDGELTVKRLVREGGRL 168

Query: 193 IDLMSLNCCYPVDTVE-MSDIE 213
           + L   N  YP   +    D+E
Sbjct: 169 L-LAPENAAYPPLDITGREDVE 189


>gi|217979165|ref|YP_002363312.1| putative phage repressor [Methylocella silvestris BL2]
 gi|217504541|gb|ACK51950.1| putative phage repressor [Methylocella silvestris BL2]
          Length = 211

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 64/184 (34%), Gaps = 29/184 (15%)

Query: 42  KRFGIEGRNRWPSTESI---FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS 98
           KR    G  R  +TE++     +L  T   + +        G         + ++    +
Sbjct: 38  KRAVKSGDRRGVTTETLTALAPVLKTTAAWLLE--------GVGDPTPGNRVHVVGRIGA 89

Query: 99  GSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILI 158
           G+       +FP    +     PE        + I T     + +  SM P Y  GD++I
Sbjct: 90  GAE------IFPE---FEQTP-PEGLYEIEVPFPIATDAIAFQVEGDSMWPRYDPGDVII 139

Query: 159 L---NSAIQVNCGDRLLIKPRTGDIVAKVLIS-RRGRSIDLMSLNCCYPVDTVEMSDIEW 214
                +  +   G    ++   G    K +    +  + DL S N   P+ +V    IEW
Sbjct: 140 CWREGADAEEVVGWEAAVRTADGKRYLKRIQRGAKAGTFDLESHNAA-PIRSV---KIEW 195

Query: 215 IARI 218
            A I
Sbjct: 196 AAAI 199


>gi|294668761|ref|ZP_06733854.1| prophage MuMc02, peptidase, family S24 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309278|gb|EFE50521.1| prophage MuMc02, peptidase, family S24 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 231

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 52/177 (29%), Gaps = 23/177 (12%)

Query: 56  ESIFKILAATNETICQLL---DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF--- 109
           E   KI   T  ++  L+             E+K+  +  ++     +   F    F   
Sbjct: 42  EQCIKIAERTGVSLDWLILGKGEMKGGSAAPERKKSVMEEVWAALEENRSPFPDVAFVPL 101

Query: 110 -----PTGNKWNT--------VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDI 156
                  GN            +   +      G+Y              SM+P    GDI
Sbjct: 102 FDAEVGAGNGIEVYGENIIQLIPFSQSWLAAEGLYI--RDLACLPVNGDSMIPSLTSGDI 159

Query: 157 LILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           +++        GD + +      +  K L       + + S N  Y  + +  +++ 
Sbjct: 160 VLV--NHAKRNGDGVFVVRMGNALRVKRLQWLANGDLRISSDNPIYQTEQITPAELA 214


>gi|15799951|ref|NP_285963.1| putative cI repressor protein for prophage CP-933H [Escherichia
           coli O157:H7 EDL933]
 gi|15829528|ref|NP_308301.1| hypothetical protein ECs0274 [Escherichia coli O157:H7 str. Sakai]
 gi|168750234|ref|ZP_02775256.1| prophage repressor [Escherichia coli O157:H7 str. EC4113]
 gi|168757277|ref|ZP_02782284.1| prophage repressor [Escherichia coli O157:H7 str. EC4401]
 gi|168763488|ref|ZP_02788495.1| prophage repressor [Escherichia coli O157:H7 str. EC4501]
 gi|168771975|ref|ZP_02796982.1| prophage repressor [Escherichia coli O157:H7 str. EC4486]
 gi|168776110|ref|ZP_02801117.1| prophage repressor [Escherichia coli O157:H7 str. EC4196]
 gi|168783011|ref|ZP_02808018.1| prophage repressor [Escherichia coli O157:H7 str. EC4076]
 gi|195938652|ref|ZP_03084034.1| hypothetical protein EscherichcoliO157_19857 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808008|ref|ZP_03250345.1| prophage repressor [Escherichia coli O157:H7 str. EC4206]
 gi|208812242|ref|ZP_03253571.1| prophage repressor [Escherichia coli O157:H7 str. EC4045]
 gi|208819276|ref|ZP_03259596.1| prophage repressor [Escherichia coli O157:H7 str. EC4042]
 gi|209396038|ref|YP_002268874.1| prophage repressor [Escherichia coli O157:H7 str. EC4115]
 gi|217326454|ref|ZP_03442538.1| prophage repressor [Escherichia coli O157:H7 str. TW14588]
 gi|254791408|ref|YP_003076245.1| putative cI repressor protein for prophage CP-933H [Escherichia
           coli O157:H7 str. TW14359]
 gi|331682213|ref|ZP_08382835.1| repressor protein CI [Escherichia coli H299]
 gi|12513020|gb|AAG54571.1|AE005202_9 putative cI repressor protein for prophage CP-933H [Escherichia
           coli O157:H7 str. EDL933]
 gi|13359731|dbj|BAB33697.1| repressor protein CI [Escherichia coli O157:H7 str. Sakai]
 gi|187768417|gb|EDU32261.1| prophage repressor [Escherichia coli O157:H7 str. EC4196]
 gi|188015589|gb|EDU53711.1| prophage repressor [Escherichia coli O157:H7 str. EC4113]
 gi|188999620|gb|EDU68606.1| prophage repressor [Escherichia coli O157:H7 str. EC4076]
 gi|189355754|gb|EDU74173.1| prophage repressor [Escherichia coli O157:H7 str. EC4401]
 gi|189359431|gb|EDU77850.1| prophage repressor [Escherichia coli O157:H7 str. EC4486]
 gi|189366359|gb|EDU84775.1| prophage repressor [Escherichia coli O157:H7 str. EC4501]
 gi|208727809|gb|EDZ77410.1| prophage repressor [Escherichia coli O157:H7 str. EC4206]
 gi|208733519|gb|EDZ82206.1| prophage repressor [Escherichia coli O157:H7 str. EC4045]
 gi|208739399|gb|EDZ87081.1| prophage repressor [Escherichia coli O157:H7 str. EC4042]
 gi|209157438|gb|ACI34871.1| prophage repressor [Escherichia coli O157:H7 str. EC4115]
 gi|217322675|gb|EEC31099.1| prophage repressor [Escherichia coli O157:H7 str. TW14588]
 gi|254590808|gb|ACT70169.1| putative cI repressor protein for prophage CP-933H [Escherichia
           coli O157:H7 str. TW14359]
 gi|326338747|gb|EGD62566.1| Phage repressor [Escherichia coli O157:H7 str. 1044]
 gi|326342468|gb|EGD66248.1| Phage repressor [Escherichia coli O157:H7 str. 1125]
 gi|331080637|gb|EGI51813.1| repressor protein CI [Escherichia coli H299]
          Length = 237

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +      + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAEKWVSTTKKASGSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|21230556|ref|NP_636473.1| LexA repressor [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66769453|ref|YP_244215.1| LexA repressor [Xanthomonas campestris pv. campestris str. 8004]
 gi|44888105|sp|Q8PBM1|LEXA1_XANCP RecName: Full=LexA repressor 1
 gi|21112131|gb|AAM40397.1| LexA repressor [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574785|gb|AAY50195.1| LexA repressor [Xanthomonas campestris pv. campestris str. 8004]
          Length = 201

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 45/134 (33%), Gaps = 16/134 (11%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
            G         +P+L    +           P G     +G+         ++A+   D 
Sbjct: 68  PGGAGPDALLALPVLGRVAA---------GVPIGA---DIGLDRQLWLDRSLFAL-RPDY 114

Query: 139 RHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
             + Q  SM      +GD++ +  +     G ++++    G+I  K L  R   +I L+ 
Sbjct: 115 LLQVQGDSMIDDGILEGDLVGVQRSSDARNG-QIVVARVDGEITIKRL-ERSADAIRLLP 172

Query: 198 LNCCYPVDTVEMSD 211
            N  +    V    
Sbjct: 173 RNPAHAPIVVAADA 186


>gi|120601508|ref|YP_965908.1| prophage repressor [Desulfovibrio vulgaris DP4]
 gi|120561737|gb|ABM27481.1| SOS response UmuD protein, Serine peptidase, MEROPS family S24
           [Desulfovibrio vulgaris DP4]
          Length = 202

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  +    SML      GD+L+++ A+    G R++I    G++  K L+   GR 
Sbjct: 111 PAATFYVRASGESMLGAGVHDGDLLVVDRALDPRPG-RVVIAAVDGELTVKRLVREGGRL 169

Query: 193 IDLMSLNCCYPVDTVE-MSDIE 213
           + L   N  YP   +    D+E
Sbjct: 170 L-LAPENAAYPPLDITGREDVE 190


>gi|296116167|ref|ZP_06834785.1| LexA repressor [Gluconacetobacter hansenii ATCC 23769]
 gi|295977273|gb|EFG84033.1| LexA repressor [Gluconacetobacter hansenii ATCC 23769]
          Length = 235

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/145 (14%), Positives = 41/145 (28%), Gaps = 15/145 (10%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
                   +          ++P L    +G        +    +    + VP        
Sbjct: 93  GDFTPALPAVQVADTANAVQVPFLGRIAAGH------AIEAISDASRLIDVPAGLIGVGT 146

Query: 130 IYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            YA++           SM       GD +I+    Q   G+ ++      ++  K L  +
Sbjct: 147 YYALE-------VCGDSMIEAGILDGDTVIVRQDRQAENGEIVVALIEGQEVTLKRLRRK 199

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIE 213
            G +I L   N  Y    +    + 
Sbjct: 200 -GSTIALEPANARYETRIMPADKVA 223


>gi|87124247|ref|ZP_01080096.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. RS9917]
 gi|86167819|gb|EAQ69077.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. RS9917]
          Length = 147

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 49/135 (36%), Gaps = 14/135 (10%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
            L  +     +++   +PL     +          FP+    + V V      +  +   
Sbjct: 7   SLQAALPLRAQRQPLLLPLAGERVA--------AGFPSPAD-DYVEV--GIDLNEQLIRH 55

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  +    SML      GD+L+++ +++   G R+++    G    K L   RG+ 
Sbjct: 56  PLSTFFLRVSGESMLGAGIHDGDLLVVDRSLEPRPG-RVVVAVLDGAFTLKRLARHRGQ- 113

Query: 193 IDLMSLNCCYPVDTV 207
           + L + +  YP   +
Sbjct: 114 LRLEAAHPDYPPLEL 128


>gi|237746397|ref|ZP_04576877.1| repressor protein CI [Oxalobacter formigenes HOxBLS]
 gi|229377748|gb|EEO27839.1| repressor protein CI [Oxalobacter formigenes HOxBLS]
          Length = 245

 Score = 46.9 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 48/131 (36%), Gaps = 10/131 (7%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGV--FPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
                 K  ++PL+ +  +G+   +   +  F  G+    +  P   S H  I  +  + 
Sbjct: 102 SGPPPDKVGQLPLISWVRAGN---WSETIDNFAPGDAEEWIPCPFKHSRHAFILQVVGKS 158

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRRGRSIDLM 196
             +   + S    Y  GD + ++   +   G  ++++         K L+        LM
Sbjct: 159 MYNPGGERS----YNDGDYIAVDPCREAQNGSLVVVRLDDDNTATFKQLLIEPNGERMLM 214

Query: 197 SLNCCYPVDTV 207
           +LN  +P   +
Sbjct: 215 ALNPSWPNRIM 225


>gi|147668729|ref|YP_001213547.1| phage repressor like transcriptional regulator [Dehalococcoides sp.
           BAV1]
 gi|146269677|gb|ABQ16669.1| phage repressor like transcriptional regulator, XRE family
           [Dehalococcoides sp. BAV1]
          Length = 207

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 53/147 (36%), Gaps = 24/147 (16%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKK---------EKEIPLLYFPPSGSGGF 103
           PS E++ KI  A    I +    P      + ++            IP+       +G  
Sbjct: 45  PSYEALSKIARALGVDIKEFKTDPEIVRLESPEEVLRKYQLMAPVSIPVYDHFYVHAG-- 102

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
            D+ + P       +              I+     +K +   M P+  +GDIL+++   
Sbjct: 103 -DAALAP-------IEYIYRARESFAPQNIE----AYKVRGNCMEPVISEGDILLIDRDR 150

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRG 190
               G+ +L+    G+++   LI + G
Sbjct: 151 TPQKGN-ILLCVVDGEVIVGKLIEQNG 176


>gi|94263325|ref|ZP_01287140.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|93456280|gb|EAT06410.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
          Length = 145

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + V        +  + A        +    SM+       DIL+++ +++
Sbjct: 29  SAGFPS-PAEDYVE--GQLDLNQLMVAHPAATFFVRVAGDSMIGAGIHHDDILVVDRSLE 85

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
              G R++I    G++  K L    G +  L++ N  YP 
Sbjct: 86  PTSG-RVVIAVINGELTVKRLFRHNG-TARLLAENPNYPP 123


>gi|86606635|ref|YP_475398.1| S24 family peptidase [Synechococcus sp. JA-3-3Ab]
 gi|86555177|gb|ABD00135.1| peptidase, S24 (LexA) family [Synechococcus sp. JA-3-3Ab]
          Length = 218

 Score = 46.5 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
            + Q  SM P    GD + +    ++  G+ + +  R G++  K L    G  + ++S N
Sbjct: 130 IRVQGDSMSPTLEDGDWIFVERQKEL-GGEGIYVFQRDGELWVKRLQRLSGSRVKVISDN 188

Query: 200 CCYPVDTVEMSD 211
             +P   V+ +D
Sbjct: 189 PRFPSFVVDCAD 200


>gi|218780516|ref|YP_002431834.1| SOS-response transcriptional repressor, LexA [Desulfatibacillum
           alkenivorans AK-01]
 gi|259494471|sp|B8FIX5|LEXA_DESAA RecName: Full=LexA repressor
 gi|218761900|gb|ACL04366.1| SOS-response transcriptional repressor, LexA [Desulfatibacillum
           alkenivorans AK-01]
          Length = 203

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 41/124 (33%), Gaps = 16/124 (12%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
           T      +IPL+    +G+       +    N  +T+ V       +  +++       +
Sbjct: 71  TPPGAGGKIPLVGRIAAGA------PILAVENVMDTLDVDRAFFGSSDAFSV-------R 117

Query: 142 TQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
            +  SM       GD +++        GD ++      ++  K       R I+L   N 
Sbjct: 118 VEGDSMIEAHIEDGDYVVIKPTATPRNGD-IVAALVNDEVTLKYFHRDGSR-IELRPANV 175

Query: 201 CYPV 204
            Y  
Sbjct: 176 RYKP 179


>gi|269121509|ref|YP_003309686.1| phage repressor [Sebaldella termitidis ATCC 33386]
 gi|268615387|gb|ACZ09755.1| putative phage repressor [Sebaldella termitidis ATCC 33386]
          Length = 217

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 46/122 (37%), Gaps = 14/122 (11%)

Query: 92  LLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLY 151
           +  F  +G  G+ D+  +        V +P+      G++ I       K    SM P +
Sbjct: 92  IYGFASAG-NGYLDTTDYEI----MEVSLPKNIRHKKGLFGI-------KVHGESMEPEF 139

Query: 152 RKGDILILNSAIQ--VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              DILIL+ +        +++++     +   K+L         L S N  YP   +  
Sbjct: 140 YNNDILILDPSCPEWEELNNKVIVVDLNNERYVKLLKYYNDGRAYLFSYNEIYPPIQITE 199

Query: 210 SD 211
           +D
Sbjct: 200 ND 201


>gi|78777294|ref|YP_393609.1| putative phage repressor [Sulfurimonas denitrificans DSM 1251]
 gi|78497834|gb|ABB44374.1| putative phage repressor [Sulfurimonas denitrificans DSM 1251]
          Length = 219

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
                   SM P +   DI+ +N     +  G    I+  +G +  K +  R    ID++
Sbjct: 131 EAINVSGDSMEPTFSYNDIVFINRDKKDLQRGGIFTIRTESG-LFIKRVQKRIDGKIDVI 189

Query: 197 SLNCCYPVDTVEMSDIEWIARIL 219
           S N  Y   T+ + +IE I R++
Sbjct: 190 SDNPIYSTQTLNLGEIEVIGRVV 212


>gi|56697019|ref|YP_167381.1| LexA repressor [Ruegeria pomeroyi DSS-3]
 gi|71648704|sp|Q5LRH4|LEXA_SILPO RecName: Full=LexA repressor
 gi|56678756|gb|AAV95422.1| LexA repressor [Ruegeria pomeroyi DSS-3]
          Length = 231

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 35/104 (33%), Gaps = 9/104 (8%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKP 175
            V VP         YA++        +  SM       GD++++      + GD ++   
Sbjct: 130 QVAVPGSMVGKGEHYALE-------VKGDSMIEAGINDGDVVVIRETSTADNGDIVVALV 182

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              +   K    R   SI L + N  Y    +    +    R++
Sbjct: 183 DDSEATLKRFFRRGA-SIALEAANPAYETRVLPSDRVRVQGRLV 225


>gi|116620617|ref|YP_822773.1| LexA repressor [Candidatus Solibacter usitatus Ellin6076]
 gi|116223779|gb|ABJ82488.1| SOS-response transcriptional repressor, LexA [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 207

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 41/142 (28%), Gaps = 16/142 (11%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
           + R T     EIP+L    +           P         V          +A      
Sbjct: 74  EQRRTRPAIAEIPMLGRIAA---------GLPV-EAVEQREVLNFAD-----FAGDGNTF 118

Query: 139 RHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
             + +  SM       GD+++L    Q   GD ++      D   K        +I L  
Sbjct: 119 ALEVRGNSMIDDHICDGDVILLERVTQARDGDIVVALVAGSDTTLKRFYRESADTIRLQP 178

Query: 198 LNCCYPVDTVEMSDIEWIARIL 219
            N       V   D++   R+L
Sbjct: 179 ANAALKPILVPARDVQIQGRLL 200


>gi|296270862|ref|YP_003653494.1| putative phage repressor [Thermobispora bispora DSM 43833]
 gi|296093649|gb|ADG89601.1| putative phage repressor [Thermobispora bispora DSM 43833]
          Length = 107

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 25/68 (36%), Gaps = 1/68 (1%)

Query: 139 RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSL 198
             +    SMLP  R GD L++     +  GD ++ +   G ++ K           L S 
Sbjct: 4   AVRVAGESMLPALRPGDCLLVRRGAPIRPGDLVVARRPHG-LIVKRAFRLMPEGWWLESD 62

Query: 199 NCCYPVDT 206
           N   P   
Sbjct: 63  NQSAPGRQ 70


>gi|288573116|ref|ZP_06391473.1| transcriptional regulator, XRE family [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568857|gb|EFC90414.1| transcriptional regulator, XRE family [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 234

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 78/217 (35%), Gaps = 26/217 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNK--SKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + R+ +   LT + LAR +G+   + ++  + R G+     W   ES+  +L     ++ 
Sbjct: 7   LRRVRKDQGLTQTELARLSGVKQNTVSQVENDRIGLS-IETW---ESLASVL---GCSVG 59

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGN-------KWNTV 118
            L+       R +         L F         D           G          +++
Sbjct: 60  YLVS--GEGDRKSSGHRGSAGKLSFFQWIDVPILDDTAVACAGNGIGGMAEVYADAEDSI 117

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKP-R 176
            +P        + A   +      +  SM       G  +++N   +V  GD  L+   R
Sbjct: 118 MLPGELLGTVSVNA-DRRPFIITVEGDSMEEAGILDGSQVVVNPEEEVYDGDPALVSFGR 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
            GD   K +  +R  ++++ S +  YP  +  + DI+
Sbjct: 177 NGDWAVKWVYWQRNGAVEIRSSSLRYPPRSFSVEDID 213


>gi|257066290|ref|YP_003152546.1| transcriptional regulator, XRE family [Anaerococcus prevotii DSM
           20548]
 gi|256798170|gb|ACV28825.1| transcriptional regulator, XRE family [Anaerococcus prevotii DSM
           20548]
          Length = 206

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/191 (16%), Positives = 68/191 (35%), Gaps = 19/191 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + ++ E   +    LA+  G++  + +  +R       R PSTE + K     N +  
Sbjct: 5   AKLKQLREEQEMKQETLAQILGINRATISMYERN-----QRVPSTEILQKYTKTFNVSSD 59

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            LL            ++  IP+      G+    D  ++            +I       
Sbjct: 60  YLLGNTHYKSNNINNEKYTIPVYASISCGNPFVADENIY---------DFEDID----IA 106

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
              Q +      +  SM P ++ GD+ I+     ++ G    ++    +   K++  +  
Sbjct: 107 LKSQGEHFGLLCRGDSMSPEFKDGDVAIIRKQSDIDSGQVAAVRINGDEATLKIV-KKSE 165

Query: 191 RSIDLMSLNCC 201
           + I L+++N  
Sbjct: 166 QGITLVAINPD 176


>gi|197117030|ref|YP_002137457.1| LexA-like helix-turn-helix transcriptional regulator [Geobacter
           bemidjiensis Bem]
 gi|197086390|gb|ACH37661.1| helix-turn-helix transcriptional regulator, LexA-related protein
           [Geobacter bemidjiensis Bem]
          Length = 209

 Score = 46.5 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 42/128 (32%), Gaps = 23/128 (17%)

Query: 80  GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
               +      PLL   P     F D      G     + VP++     G YAI      
Sbjct: 80  PGAEQPNVSRAPLLEMIP---DSFPDDP----GAISRYISVPDLP---EGCYAI------ 123

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNC-GDRLLIKPRTGDIVAKVLISRRGR--SIDLM 196
                  M P  R GD++I     +    GD +++  R G+    +L   R +   I L 
Sbjct: 124 -VCYGDFMSPTIRDGDVVIFRPESEQKKSGDIIIVHNRWGEP---ILRRYRVKDDEIYLA 179

Query: 197 SLNCCYPV 204
             N  Y  
Sbjct: 180 PDNPAYAP 187


>gi|260433608|ref|ZP_05787579.1| LexA repressor [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417436|gb|EEX10695.1| LexA repressor [Silicibacter lacuscaerulensis ITI-1157]
          Length = 232

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 33/87 (37%), Gaps = 2/87 (2%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           Q      + +  SM+      GDI+++      + GD ++      +   K    R G +
Sbjct: 141 QGDHYALEVRGDSMIDAGINDGDIVVIRETATADNGDIVVALVEDQEATLKRFFRR-GNA 199

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARIL 219
           I L + N  Y    +    ++   R++
Sbjct: 200 IALEAANPAYETRVLPNDKVKVQGRLV 226


>gi|188992642|ref|YP_001904652.1| LexA repressor [Xanthomonas campestris pv. campestris str. B100]
 gi|167734402|emb|CAP52612.1| LexA repressor [Xanthomonas campestris pv. campestris]
          Length = 201

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 45/131 (34%), Gaps = 16/131 (12%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
            G         +P+L    +           P G     +G+         ++A+   D 
Sbjct: 68  PGGAGPDALLALPVLGRVAA---------GVPIGA---DIGLDRQLWLDRSLFAL-RPDY 114

Query: 139 RHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
             + Q  SM      +GD++ +  +     G ++++    G+I  K L  R   +I L+ 
Sbjct: 115 LLQVQGDSMIDDGILEGDLVGVQRSSDARNG-QIVVARVDGEITIKRL-ERSADAIRLLP 172

Query: 198 LNCCYPVDTVE 208
            N  +    V 
Sbjct: 173 RNPAHAPIVVA 183


>gi|46581311|ref|YP_012119.1| umuD protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46450732|gb|AAS97379.1| umuD protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 164

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  +    SML      GD+L+++ A+    G R++I    G++  K L+   GR 
Sbjct: 73  PAATFYVRASGESMLGAGVHDGDLLVVDRALDPRPG-RVVIAAVDGELTVKRLVREGGRL 131

Query: 193 IDLMSLNCCYPVDTVE-MSDIE 213
           + L   N  YP   +    D+E
Sbjct: 132 L-LAPENAAYPPLDITGREDVE 152


>gi|70731061|ref|YP_260802.1| LexA repressor [Pseudomonas fluorescens Pf-5]
 gi|68345360|gb|AAY92966.1| LexA repressor [Pseudomonas fluorescens Pf-5]
          Length = 202

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 60/156 (38%), Gaps = 24/156 (15%)

Query: 57  SIFK--ILAATNETICQL----LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           S+ +  +LA T     ++            +    +  EIP+L    +G+         P
Sbjct: 41  SVARKHVLALTEAGFIEVNPHQARGIRLLNQPRRPELLEIPVLGRVAAGA---------P 91

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP--LYRKGDILILNSAIQVNCG 168
            G       +        G+++ +T D   + Q  SM+   ++  GD++ +  + +V  G
Sbjct: 92  IGV---DADIHGQLLLDPGMFS-RTPDYLLRVQGDSMIDDGIF-DGDLVAVRRSSEVRNG 146

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
             ++ +   G++  K    + G+ I L+  N  Y  
Sbjct: 147 QTVIARL-DGEVTIKRFERK-GQGIRLLPRNPAYQP 180


>gi|224453|prf||1105256A repressor lambda mutant
          Length = 136

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 30/74 (40%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +D SM       P +  G +++++    V  GD  + +    ++  K LI   
Sbjct: 39  SAFWFEVEDNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLEGDELTFKKLIRDS 98

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 99  GQVF-LQPLNPQYP 111


>gi|289166242|ref|YP_003456380.1| peptidase, S24 family [Legionella longbeachae NSW150]
 gi|288859415|emb|CBJ13352.1| putative peptidase, S24 family [Legionella longbeachae NSW150]
          Length = 202

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 79/210 (37%), Gaps = 26/210 (12%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKR----FGIEGRNRWPST-ESIFKILAATNETICQL 72
           + +N++ S LAR   L    +N   R       + R    ST +SI       N ++  L
Sbjct: 2   KENNVSESDLARALNL---PYNTIHRLVSGHTTDPRI---STLKSIASYF---NVSLDTL 52

Query: 73  LDLPF--SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
           L+      +   T    + +P++ +          +      + W  + +  I +     
Sbjct: 53  LNQNQGVPNTLKTHIGPRTVPIVTWEQLSDDELLRTINSLNWDHWLPISLVSIDNLSLNA 112

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDIVAKVLISRR 189
           YA++++         SM P +  G   I++   +   GD +L+K +    +  + LI   
Sbjct: 113 YALESRP--------SMQPRFPIGTFFIIDPDCKPIDGDLILVKIKINNAVSLRELIIDP 164

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             SI L+ +     V     S+ E I  ++
Sbjct: 165 P-SIQLLPIIENSDVLNFNESEHEIIGVVV 193


>gi|257451797|ref|ZP_05617096.1| SOS-response transcriptional repressors [Fusobacterium sp. 3_1_5R]
 gi|317058353|ref|ZP_07922838.1| SOS-response transcriptional repressor [Fusobacterium sp. 3_1_5R]
 gi|313684029|gb|EFS20864.1| SOS-response transcriptional repressor [Fusobacterium sp. 3_1_5R]
          Length = 208

 Score = 46.1 bits (108), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 30/82 (36%), Gaps = 4/82 (4%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI--SRRGR 191
              D        SM P     DIL++     ++ GD  + K    D+  K L        
Sbjct: 113 PACDFATTVSGDSMEPKIFDSDILLIRKTETLDSGDIGIFKI-DEDVFCKKLQLNHLTNE 171

Query: 192 SIDLMSLNCCYPVDTVEMSDIE 213
            I L SLN CY    +   ++E
Sbjct: 172 VI-LKSLNPCYAPRYLSKEELE 192


>gi|94264776|ref|ZP_01288554.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|94264785|ref|ZP_01288563.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|93454765|gb|EAT05020.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
 gi|93454774|gb|EAT05029.1| Peptidase S24, S26A and S26B [delta proteobacterium MLMS-1]
          Length = 145

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 6/100 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           S  FP+    + V        +  + A        +    SM+       DIL+++ +++
Sbjct: 29  SAGFPS-PAEDYVE--GQLDLNQLMVAHPAATFFVRVVGDSMIGAGIHHDDILVVDRSLE 85

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
              G R++I    G++  K L    G +  L++ N  YP 
Sbjct: 86  PVSG-RVVIAVINGELTVKRLFRHNG-TARLLAENPNYPP 123


>gi|317164568|gb|ADV08109.1| putative CI protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 171

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P++  G  L +N+A ++    ++     +G +  K+L       + + S N  Y
Sbjct: 89  DGDSMEPVFPDGATLGINTADKMIKDGKIYAINHSGLLRTKILQKLPDNQVRIKSYNPEY 148

Query: 203 PVDTVEMSDIEWIARILWAS 222
             +T  +  +  I R+ W S
Sbjct: 149 KDETASLDSLTVIGRVFWWS 168


>gi|269838163|ref|YP_003320391.1| transcriptional regulator, XRE family [Sphaerobacter thermophilus
           DSM 20745]
 gi|269787426|gb|ACZ39569.1| transcriptional regulator, XRE family [Sphaerobacter thermophilus
           DSM 20745]
          Length = 367

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 38/105 (36%), Gaps = 5/105 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     ++I  AI R+ +   +T   LA +AG+  +  ++ +R         PS   + K
Sbjct: 1   MQPVQRQRIGPAIRRLRQERGMTLDALAAQAGISASHLSRLERSQT-----LPSFTVLAK 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
           I       I + + L            + + +L   P      FD
Sbjct: 56  IAEVLGVGIDEFVRLERDVTLLDADLGRYLDMLGIGPPVRDELFD 100


>gi|240080373|ref|ZP_04724916.1| putative CI protein [Neisseria gonorrhoeae FA19]
 gi|254494046|ref|ZP_05107217.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226513086|gb|EEH62431.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|319411131|emb|CBY91536.1| Repressor protein CI [Neisseria meningitidis WUE 2594]
          Length = 232

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P++  G  L +N+A ++    ++     +G +  K+L       + + S N  Y
Sbjct: 150 DGDSMEPVFPDGATLGINTADKMIKDGKIYAINHSGLLRTKILQKLPDNQVRIKSYNPEY 209

Query: 203 PVDTVEMSDIEWIARILWAS 222
             +T  +  +  I R+ W S
Sbjct: 210 KDETASLDSLTVIGRVFWWS 229


>gi|84503087|ref|ZP_01001183.1| LexA repressor [Oceanicola batsensis HTCC2597]
 gi|84388631|gb|EAQ01503.1| LexA repressor [Oceanicola batsensis HTCC2597]
          Length = 233

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 72/217 (33%), Gaps = 43/217 (19%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDG--RTTEKKEKEIPLLYFPPS 98
           KR   +G    PS + + + L   +   I +L+      G  R    + + I ++  P S
Sbjct: 15  KRVQRDGVP--PSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHRARAIEIVKLPDS 72

Query: 99  --GSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ---------------------- 134
             G GG F   V   G       +     P    +A++                      
Sbjct: 73  LGGDGGGFVPRVIDGGAGPADPPL-GDTRPVEAAHALELPVMGRIAAGVPIEAINQVSHH 131

Query: 135 -----------TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                       +    + +  SM+      GD++++      + GD ++      +   
Sbjct: 132 VAVPGSMLSGRGEHFALEVRGDSMIDAGINDGDVVVVRETGSADNGDIVVALVDEQEATL 191

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K    R G+ I+L++ N  Y    +  + ++   R++
Sbjct: 192 KRFFRRSGQ-IELVAANPAYETRVLPDNRVKVQGRLV 227


>gi|224825138|ref|ZP_03698244.1| putative phage repressor [Lutiella nitroferrum 2002]
 gi|224602809|gb|EEG08986.1| putative phage repressor [Lutiella nitroferrum 2002]
          Length = 227

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 41/102 (40%), Gaps = 13/102 (12%)

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL----LIKPRTGDIVA 182
            N ++A          +  SM P  +  D+++L+++        +    +++     ++ 
Sbjct: 126 SNYLHAEPANLAIISVEGDSMEPTLKDHDVIMLDTS---RRDPNVEGIYVLRLDD-ALLV 181

Query: 183 KVLISRRGRSIDLMSLNCCYP----VDTVEMSDIEWIARILW 220
           K +    G+ I + S N  YP      +    D+  I +++W
Sbjct: 182 KQVQRIPGK-IRVSSANPAYPPFDVDLSNPAEDVAIIGKVVW 222


>gi|116074633|ref|ZP_01471894.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. RS9916]
 gi|116067855|gb|EAU73608.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. RS9916]
          Length = 127

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 39/99 (39%), Gaps = 6/99 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  FP+    + V V      +  +    +     +    SM+      GD+L+++ ++ 
Sbjct: 11  AAGFPSPAD-DYVDV--GIDLNEQLIRHPSSTFFLRVSGDSMIGAGIHDGDLLVVDRSLN 67

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
              G R+++    G    K L+    R + L + N  YP
Sbjct: 68  PRPG-RIVVAILDGAFTLKRLMR-DQRGLHLEAANPAYP 104


>gi|74317534|ref|YP_315274.1| hypothetical protein Tbd_1516 [Thiobacillus denitrificans ATCC
           25259]
 gi|74057029|gb|AAZ97469.1| hypothetical protein Tbd_1516 [Thiobacillus denitrificans ATCC
           25259]
          Length = 120

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 37/91 (40%), Gaps = 2/91 (2%)

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           I+  +       ++         SM+P + +G+I+++  +  V  G  ++      + + 
Sbjct: 12  IQDINEASKCAGSEPYALMVLGDSMMPEFEEGEIIVVEPSGLVKDGSYVVAYVND-EYIF 70

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           + ++ R    + L  +N  Y    V+  D+ 
Sbjct: 71  RQIVKRDDGWM-LKPVNPLYENIPVDDLDVA 100


>gi|57237226|ref|YP_178238.1| phage repressor protein, putative [Campylobacter jejuni RM1221]
 gi|57166030|gb|AAW34809.1| phage repressor protein, putative [Campylobacter jejuni RM1221]
          Length = 209

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 66/194 (34%), Gaps = 20/194 (10%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G++P +FN  K        +      I   L   N +I  
Sbjct: 12  DILASEGKRDLKTKDIAKELGINPDTFNSMKFRNSIPYPQ------ILNFLNERNISINY 65

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + + +I  LY   +  GG         G   + +   E+        
Sbjct: 66  FFYGVSPKDQLECENKYKILKLYKTNASLGG---------GGINDLIDCSELIVDEKLLN 116

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 117 FFGSKECEFITCYGESMEPLIKDGSICVIDRNKAFKNKSICVINTRDG-LFIKQVLKQDD 175

Query: 191 RSIDLMSLNCCYPV 204
             I L SLN  Y  
Sbjct: 176 GVI-LHSLNPLYED 188


>gi|133873987|gb|ABO40681.1| prophage repressor [Enterobacteria phage HK244]
          Length = 237

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|133873996|gb|ABO40689.1| prophage repressor [Enterobacteria phage HK542]
          Length = 237

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|133873970|gb|ABO40666.1| prophage repressor [Enterobacteria phage HK544]
          Length = 237

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|9626292|ref|NP_040628.1| repressor [Enterobacteria phage lambda]
 gi|238903101|ref|YP_002928897.1| Repressor protein CI [Escherichia coli BW2952]
 gi|133353|sp|P03034|RPC1_LAMBD RecName: Full=Repressor protein CI
 gi|15057|emb|CAA24991.1| unnamed protein product [Enterobacteria phage lambda]
 gi|215147|gb|AAA96581.1| rexb (exclusion;144) [Enterobacteria phage lambda]
 gi|8919960|emb|CAB96428.1| phage lambda repressor protein CI [Escherichia coli]
 gi|60594765|gb|AAX29986.1| lambda repressor CI [Expression vector pINV-110]
 gi|62114612|gb|AAX63486.1| lambda repressor protein [Low threshold vector pLTSUB-302]
 gi|238863451|gb|ACR65449.1| Repressor protein CI [Escherichia coli BW2952]
          Length = 237

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|194099008|ref|YP_002002081.1| putative CI protein [Neisseria gonorrhoeae NCCP11945]
 gi|304386577|ref|ZP_07368865.1| S24 family peptidase [Neisseria meningitidis ATCC 13091]
 gi|193934298|gb|ACF30122.1| putative CI protein [Neisseria gonorrhoeae NCCP11945]
 gi|304339406|gb|EFM05478.1| S24 family peptidase [Neisseria meningitidis ATCC 13091]
          Length = 232

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P++  G  L +N+A ++    ++     +G +  K+L       + + S N  Y
Sbjct: 150 DGDSMEPVFPDGATLGINTADKMIKDGKIYAINHSGLLRTKILQKLPDNQVRIKSYNPEY 209

Query: 203 PVDTVEMSDIEWIARILWAS 222
             +T  +  +  I R+ W S
Sbjct: 210 KDETASLDSLTVIGRVFWWS 229


>gi|328955378|ref|YP_004372711.1| XRE family transcriptional regulator [Coriobacterium glomerans PW2]
 gi|328455702|gb|AEB06896.1| transcriptional regulator, XRE family [Coriobacterium glomerans
           PW2]
          Length = 210

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 49/155 (31%), Gaps = 14/155 (9%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           + K+ +A   TI  LL L  +           IP+     +G+             +   
Sbjct: 46  LIKLSSALGVTISYLLGLENTVAAQ-PAPSFPIPVFGNIAAGT------------PREAL 92

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +    +      +Y          T   SM  L+  G +++++ A+ V  GD  ++    
Sbjct: 93  LQSDIVHDTEESLYRAHKSSFWLITSGNSMNKLFPDGSLVLIDPALPVQNGDVGVVFVNG 152

Query: 178 GDIVAK-VLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            D   K +        +   S +  Y    +   D
Sbjct: 153 EDATLKRIFFDDDAIRLHPESYDPDYRDYVIRQDD 187


>gi|219870788|ref|YP_002475163.1| putative prophage repressor CI, XRE family transcriptional
           regulator/SOS-response transcriptional repressors
           (RecA-mediated autopeptidases)/ LexA family
           repressor/S24 family protease [Haemophilus parasuis
           SH0165]
 gi|219690992|gb|ACL32215.1| putative prophage repressor CI, XRE family transcriptional
           regulator/SOS-response transcriptional repressors
           (RecA-mediated autopeptidases)/ LexA family
           repressor/S24 family protease [Haemophilus parasuis
           SH0165]
          Length = 175

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 62/186 (33%), Gaps = 41/186 (22%)

Query: 53  PSTESIFKILAATNE---------TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG---- 99
           P+   + +++  T           TI            T+ KK +  PL+    +G    
Sbjct: 2   PNVNEVAQMINLTGVNKVILNGDGTIEDFDPNITP---TSVKKSRAYPLVSSIQAGMWTE 58

Query: 100 SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
           +  F DS  +      + +       P              +    SM P + +GD++++
Sbjct: 59  TYDFRDSEGY------DYIDTEIDAGPDAFF---------LRVSGMSMEPKFSEGDLVLI 103

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAK---VLISRRGR---SIDLMSLNCCYPVDTVEMSDIE 213
           +   + + GD +      G+   K    L           +L+ LN  +P  +    DI 
Sbjct: 104 DIRKRPHPGDFVAAVNGNGEATLKRYRELGELSPSGNPHFELVPLNQDFPTLSSMKQDI- 162

Query: 214 WIARIL 219
              RI+
Sbjct: 163 ---RII 165


>gi|268596517|ref|ZP_06130684.1| transcriptional regulator [Neisseria gonorrhoeae FA19]
 gi|268550305|gb|EEZ45324.1| transcriptional regulator [Neisseria gonorrhoeae FA19]
          Length = 223

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P++  G  L +N+A ++    ++     +G +  K+L       + + S N  Y
Sbjct: 141 DGDSMEPVFPDGATLGINTADKMIKDGKIYAINHSGLLRTKILQKLPDNQVRIKSYNPEY 200

Query: 203 PVDTVEMSDIEWIARILWAS 222
             +T  +  +  I R+ W S
Sbjct: 201 KDETASLDSLTVIGRVFWWS 220


>gi|192291732|ref|YP_001992337.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|192285481|gb|ACF01862.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 214

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 58/173 (33%), Gaps = 27/173 (15%)

Query: 58  IFKILAAT---NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           + + L  T        +L DL    G   + +   + +      G+G   D         
Sbjct: 30  VSRWLDGTEPRGPMRDRLRDLAEESGLVPQARANHV-IKIMGRVGAGAIIDP-------- 80

Query: 115 WNTVGVPEIR-SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN----CGD 169
            +    PE         Y I +     +   TSM+P Y  G+IL++     V+     G 
Sbjct: 81  -DYEQTPEDGLEQIELPYPIGSDLIGFEVSGTSMMPKYDPGEILVVQREQPVSFDSMIGQ 139

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             +++   G         R  + +     +  Y +++     I   AR++W S
Sbjct: 140 YAVVRTDDG--------RRLVKRVMPGPKSNLYNLESANAETIV-GARLVWGS 183


>gi|187477795|ref|YP_785819.1| phage repressor [Bordetella avium 197N]
 gi|115422381|emb|CAJ48906.1| Putative phage repressor [Bordetella avium 197N]
          Length = 360

 Score = 46.1 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 35/85 (41%), Gaps = 8/85 (9%)

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGD----RLLIKPRTGDIVAKVL--ISRRGRSIDLMS 197
             SM P+ R G  L++   + +   D     +      G ++ K +      GR +   S
Sbjct: 271 GDSMEPIIRDGAALLVVPDLGLTLRDVAAGGVYAINYDGKMIVKTVARDRLTGRWVA-RS 329

Query: 198 LNCCYPVDTVEMS-DIEWIARILWA 221
            N  +P  T+E    +  + R++WA
Sbjct: 330 FNTQHPDITLEGDVSVRVLGRVVWA 354


>gi|146311560|ref|YP_001176634.1| putative prophage repressor [Enterobacter sp. 638]
 gi|145318436|gb|ABP60583.1| SOS response UmuD protein, Serine peptidase, MEROPS family S24
           [Enterobacter sp. 638]
          Length = 144

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/105 (16%), Positives = 39/105 (37%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     +    SM+      GD+L+++ A+   
Sbjct: 25  GFPS-PAQDYVE--DRIDLNKLVIKHPSATYFIRVSGESMIGAGITDGDLLVVDRALTPE 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD +++    G+   K L  R    + L+  N  +     +  +
Sbjct: 82  HGD-IVVAAVAGEFTVKELRVRPI--LQLVPRNPRFSPIIFDAEE 123


>gi|85860762|ref|YP_462964.1| DNA polymerase V subunit [Syntrophus aciditrophicus SB]
 gi|85723853|gb|ABC78796.1| DNA polymerase V subunit [Syntrophus aciditrophicus SB]
          Length = 195

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 57/170 (33%), Gaps = 33/170 (19%)

Query: 49  RNRWPSTESIFKILAATNETICQLL----------DLPFSDGRTTEKKEKEIPLLYFPPS 98
           R R P+ E +  +L   ++++              +         +++   IP++    +
Sbjct: 21  RKRMPTYEEMVALLGVRSKSVVHFWINKLVEAKILEKDRGGHLAWKERPFSIPMVGEVAA 80

Query: 99  GSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRK 153
                     FP+        + +I S    + A        +    SM     LP    
Sbjct: 81  ---------GFPSP---EEEELRDILSLDEYLVARPDASFLLQVSGDSMTGAGILP---- 124

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           GD++I+    +   GD ++I    G+   K    +    + L + N  YP
Sbjct: 125 GDLVIVEKGREPKNGD-VVIAEVDGEWTMKTF-RKEKGEVYLEAANPKYP 172


>gi|58616539|ref|YP_195669.1| DNA repair protein [Azoarcus sp. EbN1]
 gi|56316002|emb|CAI10645.1| DNA repair protein [Aromatoleum aromaticum EbN1]
          Length = 158

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 47/142 (33%), Gaps = 21/142 (14%)

Query: 91  PLLYFPPSGSGGFFDSG------VFPTGNKWNTVGVPEIRSPHN------GIYAI--QTQ 136
           PL    P+   G             P G    + G P     +         Y +     
Sbjct: 8   PLSDLSPAAVAGLRYPSPTRGCLAIPLGLAPVSAGFPSPAEDYEDKKLDINDYLVRNPVS 67

Query: 137 DTRHKTQDTSM--LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                 +  SM    ++  GDIL+++ ++    G  ++I    G+ + K    R  R I 
Sbjct: 68  TFYFPVKGDSMQGAQVF-DGDILVVDRSVMPAHG-HVVIAFVNGERLVKRFHRRGDR-IA 124

Query: 195 LMSLNCCYPVDTVEMSD--IEW 214
           L++ N  YP   +      + W
Sbjct: 125 LLAENPGYPPLELTEGSELVIW 146


>gi|160899002|ref|YP_001564584.1| LexA repressor [Delftia acidovorans SPH-1]
 gi|229621210|sp|A9BWH9|LEXA_DELAS RecName: Full=LexA repressor
 gi|160364586|gb|ABX36199.1| transcriptional repressor, LexA family [Delftia acidovorans SPH-1]
          Length = 224

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 153 KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD+L + SA +   G  ++ +    ++  K L  R  + ++L+  N  YPV  V   +
Sbjct: 150 DGDLLAVQSAHEARNGQIVVARLGD-EVTVKRL-RRTTQGVELLPENPDYPVIRVAPEE 206


>gi|220935340|ref|YP_002514239.1| hypothetical protein Tgr7_2172 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996650|gb|ACL73252.1| conserved hypothetical protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 126

 Score = 45.7 bits (107), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           V  P++  P  G     ++    +    SM P +  G I+I++ A  V  G  ++ +   
Sbjct: 15  VETPDV-DPGVGSGCATSEPFALRVLGDSMSPEFEHGVIIIVDPAGHVESGSYVVAR-HE 72

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            + + + L+   GR   L++L   +    +E+S ++ IA ++
Sbjct: 73  EEYLFRQLLIEEGRYY-LVALKDDH--RKLEISGVDAIAGVV 111


>gi|149915046|ref|ZP_01903575.1| putative phage repressor [Roseobacter sp. AzwK-3b]
 gi|149811234|gb|EDM71071.1| putative phage repressor [Roseobacter sp. AzwK-3b]
          Length = 220

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 79/211 (37%), Gaps = 16/211 (7%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
           ER N++ + +ARKAG+   +    KR    G+ +  S E   KI  A    +  +     
Sbjct: 15  ERQNVSVAEIARKAGVPYDAVRDIKR----GKVQSTSWERAVKIAQALGIDLEDVSPATS 70

Query: 78  SD----GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                    + K +  + +     S   G       P G+    +  P          A 
Sbjct: 71  KTKQVIEPASSKLQAMVSVYDVYASAGDGAVVIHEEPIGS----LAFPA-NYLRQLTQAN 125

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVAKVLISR-RGR 191
                    +  SMLP     D+++L+ + +    D L +    G+ ++ K +       
Sbjct: 126 WRDLAIISVKGDSMLPTLADDDVVMLDRSKRDLSYDGLFVIRDNGEALLVKRIQRAPTPG 185

Query: 192 SIDLMSLNCC-YPVDTVEMSDIEWIARILWA 221
            + ++S N   Y     ++SDIE I R++WA
Sbjct: 186 HVMIISDNRALYDPVEKKLSDIEVIGRVIWA 216


>gi|87159694|dbj|BAE79430.1| temperature-sensitive lambda-repressor [Cloning vector pPL450]
 gi|87159697|dbj|BAE79432.1| temperature-sensitive lambda-repressor [Cloning vector pPL451]
 gi|87159700|dbj|BAE79434.1| temperature-sensitive lambda-repressor [Cloning vector pPL452]
 gi|87159703|dbj|BAE79436.1| temperature-sensitive lambda-repressor [Cloning vector pCL476]
 gi|87159706|dbj|BAE79438.1| temperature-sensitive lambda-repressor [Cloning vector pCL478]
 gi|87159709|dbj|BAE79440.1| temperature-sensitive lambda-repressor [Cloning vector pND706]
 gi|87159712|dbj|BAE79442.1| temperature-sensitive lambda-repressor [Cloning vector pND707]
          Length = 237

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPKL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 179 DFCIARLGGDEFTFKKLIRDSGQVF-LQPLNPQYP 212


>gi|189346772|ref|YP_001943301.1| XRE family transcriptional regulator [Chlorobium limicola DSM 245]
 gi|189340919|gb|ACD90322.1| transcriptional regulator, XRE family [Chlorobium limicola DSM 245]
          Length = 242

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 50/135 (37%), Gaps = 15/135 (11%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR-SPHNGIYAI 133
           L     R T ++   +PL  +  +   G  D      G     + +P         IYA+
Sbjct: 101 LHGGAERDTGEQLARVPL--YIAAVPAGTPDIAG---GEVEEYLDMPSSWIRGKKNIYAL 155

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  K    SM+ +    GD L++ +  +   G +++I    G++  K L    G +
Sbjct: 156 -------KVNGDSMIDIGIMHGDTLLVEATEKAKHG-QVVIASINGEVTVKTLSISVGGA 207

Query: 193 IDLMSLNCCYPVDTV 207
           + L+  N  Y    +
Sbjct: 208 VSLVPENPIYHPIAI 222


>gi|145636124|ref|ZP_01791794.1| dihydroorotate dehydrogenase 2 [Haemophilus influenzae PittHH]
 gi|145270646|gb|EDK10579.1| dihydroorotate dehydrogenase 2 [Haemophilus influenzae PittHH]
          Length = 218

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 61/179 (34%), Gaps = 31/179 (17%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  E I  I  A N  + ++L    +     E   +  PLL    +G           
Sbjct: 51  RTPDLEDISIISKALNI-LPEVLAFDSNISEIKESICRY-PLLSPIQAGL---------- 98

Query: 111 TGNKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
               W  +    G        +   A +      + +  SMLP + +GD+++++  I   
Sbjct: 99  ----WTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPT 153

Query: 167 CGDRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
            G  +       +      K L ++    I   +L+  N  +P  +    +I    RI+
Sbjct: 154 PGKFVAAINGDNEATFKQYKELGTKTPEGIPHFELVPFNPMFPTLSSLNQEI----RII 208


>gi|2688959|gb|AAC82521.1| MucA [IncL/M plasmid R471a]
 gi|44443459|gb|AAS47041.1| MucA [Enterobacter cloacae]
          Length = 144

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 39/117 (33%), Gaps = 16/117 (13%)

Query: 103 FFDS---GVFP---TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGD 155
           FF       FP    G + N + + +    H             +    SM       GD
Sbjct: 19  FFAEPVAAGFPSPAAGYEANELNLHDYCVRH------PAATYFLRVSGDSMRDARIHDGD 72

Query: 156 ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +L+++ A +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 73  VLVVDRAEEPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|154247615|ref|YP_001418573.1| putative phage repressor [Xanthobacter autotrophicus Py2]
 gi|154161700|gb|ABS68916.1| putative phage repressor [Xanthobacter autotrophicus Py2]
          Length = 227

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 50/144 (34%), Gaps = 20/144 (13%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           D     K ++E+ ++ +  +G+     D      G     V  P           ++   
Sbjct: 82  DRSKKRKPDQEVRVVGYIGAGAEVHTVDDHEKGAGLDLVQVDFP-----------VKHGT 130

Query: 138 TRHKTQDTSMLPLYRKGDIL-ILNSAIQVNC--GDRLLIKPRTGDIVAKVLISRR-GRSI 193
                +  SMLP++  GD++  +  A       G   ++K   G    K L         
Sbjct: 131 VGVIVRGDSMLPMFEDGDLIGYIRDASGPEQLIGKICVVKVVDGPTYIKRLKRGTEPGLY 190

Query: 194 DLMSLNCCYPVDTVEMSDIEWIAR 217
            L+S N       +E  DIEW AR
Sbjct: 191 TLVSANA----RDIEDVDIEWAAR 210


>gi|183448279|pdb|3BDN|A Chain A, Crystal Structure Of The Lambda Repressor
 gi|183448280|pdb|3BDN|B Chain B, Crystal Structure Of The Lambda Repressor
          Length = 236

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 51/155 (32%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL     ++ +                  + + + E E P+     +   G F   +
Sbjct: 65  LAKILK---VSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 118

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +     T  T   P +  G +++++    V  G
Sbjct: 119 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSM-TAPTGSKPSFPDGMLILVDPEQAVEPG 177

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  YP
Sbjct: 178 DFCIARLGGDEFTFKKLIRGSGQVF-LQPLNPQYP 211


>gi|301170203|emb|CBW29807.1| unnamed protein product [Haemophilus influenzae 10810]
 gi|301170317|emb|CBW29923.1| unnamed protein product [Haemophilus influenzae 10810]
          Length = 221

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 43/117 (36%), Gaps = 15/117 (12%)

Query: 113 NKWNTV----GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
             W  +    G        +   A +      + +  SMLP + +GD+++++  I    G
Sbjct: 100 GLWTDIRSLEGFDGYEMIPSTAIASE-NSFYLRIEGKSMLPRFNEGDLVLIDPDIVPTPG 158

Query: 169 DRLLIKPRTGDIVA---KVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARIL 219
             +       +      K L ++    I   +L+ LN  +P  +    +I    RI+
Sbjct: 159 KFVAAINGDNEATFKQYKELGTKTPEGIPHFELVPLNPMFPTLSSLNQEI----RII 211


>gi|313885531|ref|ZP_07819281.1| peptidase S24-like protein [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619261|gb|EFR30700.1| peptidase S24-like protein [Eremococcus coleocola ACS-139-V-Col8]
          Length = 213

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 64/174 (36%), Gaps = 24/174 (13%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKE------KEIPLLYFPPSGSGGFFDS 106
           P+  +I KI +     I  +++       +           K IP++     G+    D 
Sbjct: 47  PNAGNISKIASYFGLKIDAMVEYDLQTQASAPSNLIPIKQTKLIPVIGRIACGAPILADQ 106

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
            +       +++  P    P   I+ ++ +         SM+P  +   ++++     V 
Sbjct: 107 NII------DSIAFPVELLPSGEIFFLECR-------GDSMMPTIQDKALVMVRKQENVE 153

Query: 167 CGD-RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+  +++     +   K +  + G  I L+  N  +P   ++ +D     RI+
Sbjct: 154 DGEIAVVLLNGDEEATLKRIKRQ-GDLIMLLPDNTNHPPIVIQPTD---TIRIV 203


>gi|161525013|ref|YP_001580025.1| putative phage repressor [Burkholderia multivorans ATCC 17616]
 gi|160342442|gb|ABX15528.1| putative phage repressor [Burkholderia multivorans ATCC 17616]
          Length = 270

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 76/219 (34%), Gaps = 28/219 (12%)

Query: 18  ERHNLTPSGLARKAGLDPTSF-------NK-SKRFGIEGR-----NRWPSTESIFKILAA 64
           E  +L+ + LA +AG+  T+        N+ SK      R       W  +ES  K  +A
Sbjct: 37  EEKSLSQAQLATRAGVSQTTIANVESGRNQGSKHLLSIARALGVNPAWLESESGPKDASA 96

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD--SGVFPTGNK---WNTVG 119
                  +  +P   G     +  +      PP  +  + D     F  G     W    
Sbjct: 97  AAAPQPGIYKIPEDQGNVLVWEHPD----DLPPDENRVWLDRYDYRFSAGTGLIQWEVRQ 152

Query: 120 VPEIRSPHNGIYAI---QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKP 175
              +        A+          +    SM P     D++++++A   +  G ++    
Sbjct: 153 KKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTAKNHIRDG-KVYAIY 211

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIE 213
             G+ + K +  + G SI L S+N   YP   V    +E
Sbjct: 212 FEGEPLVKQIFKQAGGSICLHSINAGKYPDKIVTPELME 250


>gi|219883263|ref|YP_002478424.1| peptidase S24 and S26 domain protein [Arthrobacter chlorophenolicus
           A6]
 gi|219862108|gb|ACL42448.1| peptidase S24 and S26 domain protein [Arthrobacter chlorophenolicus
           A6]
          Length = 143

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 35/105 (33%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  FP+               +  +    T     +    SM       GD LI++ A++
Sbjct: 27  AAGFPSPA---QDYFDGRIDLNAHLIKDVTSTYVVRVSGESMEGAGISDGDELIVDRALE 83

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G  ++I    G++  K L       + L + N  YP   V  
Sbjct: 84  PRDGS-VVIAVLDGELTIKRL-RITPTGVILQAENPAYPDIEVPA 126


>gi|86151756|ref|ZP_01069970.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124259|ref|YP_004066263.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841385|gb|EAQ58633.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315017981|gb|ADT66074.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 209

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 70/209 (33%), Gaps = 20/209 (9%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G+ P +FN  K        +      I   L   N +I  
Sbjct: 12  DILASEGKRDLKTKDIAKELGIHPDTFNSMKFRNSIPYPQ------ILNFLNGRNISINY 65

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + +  I  LY   +  GG         G   +++   E+        
Sbjct: 66  FFYGVSPKDQLECENKYRILKLYKTNASLGG---------GGINDSIDCSELIVDEKLLN 116

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 117 FFGGKECEFITCYGESMEPLIKDGSICVIDRNKTFKNKSICVINTRDG-LFIKQVLKQDD 175

Query: 191 RSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             I L SLN  Y     +  D   I  I+
Sbjct: 176 GVI-LHSLNPLYKDVFYKNGDFLLIGAIV 203


>gi|238021321|ref|ZP_04601747.1| hypothetical protein GCWU000324_01220 [Kingella oralis ATCC 51147]
 gi|237868301|gb|EEP69307.1| hypothetical protein GCWU000324_01220 [Kingella oralis ATCC 51147]
          Length = 226

 Score = 45.7 bits (107), Expect = 0.005,   Method: Composition-based stats.
 Identities = 31/169 (18%), Positives = 61/169 (36%), Gaps = 24/169 (14%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEI-----------PLLYFPPSGSGG-- 102
           E   KI   T  ++  L+ L   D +   + +  +           PL     S  GG  
Sbjct: 51  EQCIKIAEQTGVSLDWLI-LGKGDPKPQHQPQSAVQDYDDQDAVWVPLYDVYASAGGGED 109

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
            +   +         +    +      +++     +  K +  SM P    GD++++N+A
Sbjct: 110 VWGEEI------EQYIPFSRVWLNQKNLHS--KNLSCVKVRGDSMEPTLNNGDVILVNTA 161

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            QV  GD + +      +  K L +    S+ + S N  Y  +T+   +
Sbjct: 162 RQV--GDGVFVVRIGSLLRVKRLQTLINGSLKISSDNPIYESETLNPKE 208


>gi|78221357|ref|YP_383104.1| putative prophage repressor [Geobacter metallireducens GS-15]
 gi|78192612|gb|ABB30379.1| putative prophage repressor [Geobacter metallireducens GS-15]
          Length = 216

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 42/148 (28%), Gaps = 29/148 (19%)

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-GVPEIRSPHNGIYAIQT 135
            +    T    + IPL      G         FP     + +     +     G YAI  
Sbjct: 83  RAGQPATSPGGEGIPL--LERIG-------PEFPHRVGEDDIRDRVALPEVSEGCYAI-- 131

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDL 195
                      M P  R GD++I     +   G+ +L+  R G+    +L   R R+ D+
Sbjct: 132 -----VAYGDFMAPTIRDGDLVIFRPGEEPQNGEVVLVTNRWGE---AILRRYRVRNGDI 183

Query: 196 ---------MSLNCCYPVDTVEMSDIEW 214
                               +      W
Sbjct: 184 VYSPDNATYSPFTPAPETRIIGTVAEVW 211


>gi|103485728|ref|YP_615289.1| putative phage repressor [Sphingopyxis alaskensis RB2256]
 gi|98975805|gb|ABF51956.1| putative phage repressor [Sphingopyxis alaskensis RB2256]
          Length = 222

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 70/219 (31%), Gaps = 21/219 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNK------SKRFGIEGRNRWPSTESIFKILAA 64
            A+DR+     +  + L++  G +P    +       +R   + R R      I   L  
Sbjct: 10  AALDRLLSEKGVDYARLSQVIGRNPAYIQQYIKRGSPRRLAEQDRAR------IAAYLGV 63

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
           +   +   +    +  R+       +P L    S   G       P       V      
Sbjct: 64  SEAMLGGPVARVATPARSRGAGMILVPKLAIGASAGAGASVD-GEPV---EGEVAFNPKW 119

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKG-DILILNSAIQVNCGDRLLIKPRTGDIVAK 183
               G        +  + +  SM P    G DIL+  S       D + +      ++ K
Sbjct: 120 LRDLGAD--PRALSIIRVEGDSMAPTLDDGDDILVDGSDAAARLRDGIYVLRMDDVLMVK 177

Query: 184 VLISRR-GRSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
            +        + ++S N  Y   D + +S I  + R++W
Sbjct: 178 RIARAPGPGRVSVISDNPHYRSWDDLPLSAIRLVGRVVW 216


>gi|307610924|emb|CBX00541.1| phage repressor [Legionella pneumophila 130b]
          Length = 229

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 74/203 (36%), Gaps = 27/203 (13%)

Query: 24  PSGLARKAGLDPTSFNKSKRFGIEGR-NRWPS-TES--IFKILAATNETICQLLDLPFSD 79
             GL RKA  + T   K+ R     R +R P  TE   +   L  +   +  L D     
Sbjct: 19  AKGLTRKALAELTGELKTSRINNYERGDRTPGPTEIKLLADALEVSASYLMCLTDNREGK 78

Query: 80  GRTTEKKEKEIPLLYFPPSGS-----GGFFDSGVFPTGNKWNTVGVPEIRSPHNG--IYA 132
              +      IP+L +  +           D       +K   V V +      G   +A
Sbjct: 79  MTKSLGMGALIPVLDYKQAADPVTYIQKIKDD----IDSKVEFVPVSKAVGEKIGKNAFA 134

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVAKVLISRR-- 189
           +Q        +D SM+P +R  D++I++       GD ++ +     +++ +        
Sbjct: 135 LQ-------VRDESMMPEFRVDDVIIVDPDTCPKPGDFVIALVEGENEVIVRKYRQLSLS 187

Query: 190 --GRSIDLMSLNCCYPVDTVEMS 210
              +  +L++LN  +    V+ S
Sbjct: 188 KKEQEFELVALNNDWADLRVDAS 210


>gi|304314715|ref|YP_003849862.1| hypothetical protein MTBMA_c09540 [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588174|gb|ADL58549.1| conserved hypothetical protein [Methanothermobacter marburgensis
           str. Marburg]
          Length = 203

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 24/72 (33%)

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
              + +            SM P  R G  LI+        GD ++ K     ++ K +  
Sbjct: 98  ESQFGVDQLPMPAVVSGDSMYPTLRDGQELIVLKTDDYKVGDIVIAKHPEYGLIVKRVGK 157

Query: 188 RRGRSIDLMSLN 199
                + LMS N
Sbjct: 158 IEPTRVYLMSDN 169


>gi|254460292|ref|ZP_05073708.1| LexA repressor [Rhodobacterales bacterium HTCC2083]
 gi|206676881|gb|EDZ41368.1| LexA repressor [Rhodobacteraceae bacterium HTCC2083]
          Length = 232

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/175 (15%), Positives = 57/175 (32%), Gaps = 27/175 (15%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEK-----------EIPLLYFPPSGSGGFFDS 106
           I K+  +   T    +   F  G+      +           E+P++    +G       
Sbjct: 66  IVKLPDSLGMTPAGFVPRVFEGGKPDVPAPRNAQPVEAIHAMELPVMGQIAAGV------ 119

Query: 107 GVFPTGNKWNTVGVPE-IRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            +    +  + V VP  + S     YA++        +  SM+      GD +++     
Sbjct: 120 PIEAISHASHNVAVPSQMLSGPGEHYALE-------VKGDSMIDAGINDGDTVVIRETNT 172

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            + GD ++      +   K      G +I L + N  Y         ++   R++
Sbjct: 173 ADNGDIVVALVEDQEATLKRFHR-NGTTIALEAANPAYETRFFSHEQVKVQGRLV 226


>gi|83311030|ref|YP_421294.1| hypothetical protein amb1931 [Magnetospirillum magneticum AMB-1]
 gi|82945871|dbj|BAE50735.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 241

 Score = 45.3 bits (106), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/115 (16%), Positives = 33/115 (28%), Gaps = 16/115 (13%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSG--SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
           L               +IP+     +G     F   G  P    W             G+
Sbjct: 98  LQFIHKLMHQPTTPSPQIPIRAVGRAGPAQEAFIGDG--PV--DWTERPAFLRGVDAYGV 153

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
           Y             TSM+P YR G ++ ++       G  +++      ++ K  
Sbjct: 154 Y----------VAGTSMVPRYRPGQLVFVDPHRPPVNGQGVVVVRYDNAVLIKEF 198


>gi|298369854|ref|ZP_06981170.1| peptidase, S24 family [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281314|gb|EFI22803.1| peptidase, S24 family [Neisseria sp. oral taxon 014 str. F0314]
          Length = 233

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC- 201
              SM P++  G  L +N+A +     ++      G +  K+L    G  I + S N   
Sbjct: 150 DGDSMEPVFPDGATLGINTADKTVKDGKIYAVNHGGLLRTKILQKLPGNKIRIRSYNAEA 209

Query: 202 YPVDTVEMSDIEWIARILWAS 222
           YP +  + +DI  I R+ W S
Sbjct: 210 YPDEEADAADINIIGRVFWWS 230


>gi|294010738|ref|YP_003544198.1| LexA-family protein [Sphingobium japonicum UT26S]
 gi|292674068|dbj|BAI95586.1| LexA-family protein [Sphingobium japonicum UT26S]
          Length = 223

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 52/167 (31%), Gaps = 10/167 (5%)

Query: 58  IFKILAATNETICQLLDLPFSDGRTTE-KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           + +      E +           R         +P L    S   G  D      G    
Sbjct: 57  LARYFGVAEEMLGGSAQRGAPPSRVRSLPSVVSVPRLSLGASAGPGSLDEDERAAG---- 112

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC-GDRLLIKP 175
            +        H G+     + +  +    SM P    GD +++N         D + +  
Sbjct: 113 LMAFDANWLRHLGVR--PQKISIIRVDGESMAPTLSDGDEIMVNHDDDAERLRDGVYVLR 170

Query: 176 RTGDIVAKVLISRRGRS-IDLMSLNCCYPV-DTVEMSDIEWIARILW 220
             G ++ K +     R    ++S N  YP    ++ + +  + R++W
Sbjct: 171 LDGVLMVKRVAMGPRRGFFSVLSDNPHYPDWIDIDPALVVIVGRVVW 217


>gi|220936231|ref|YP_002515130.1| Repressor lexA [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997541|gb|ACL74143.1| Repressor lexA [Thioalkalivibrio sp. HL-EbGR7]
          Length = 197

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 38/127 (29%), Gaps = 14/127 (11%)

Query: 94  YFPPSGSGGFFD-------SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTS 146
              P+GS   F        +   P         +P   +     + +       +    S
Sbjct: 63  GLRPTGSDAAFSLPLVGRIAAGRPI------EAIPGEDTLDLADFLLGPGRYALRVVGES 116

Query: 147 MLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVD 205
           M+      GD +++  A     GD ++      +   K +  R    ++L + N      
Sbjct: 117 MVGAGILDGDTVVVQQADSARDGDIVVALIDDEEATLKRIRHRPDGQVELRAENPAMAPL 176

Query: 206 TVEMSDI 212
             + + +
Sbjct: 177 VYDAARV 183


>gi|163736564|ref|ZP_02143983.1| LexA repressor [Phaeobacter gallaeciensis BS107]
 gi|161390434|gb|EDQ14784.1| LexA repressor [Phaeobacter gallaeciensis BS107]
          Length = 224

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 35/92 (38%), Gaps = 2/92 (2%)

Query: 129 GIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
            + + Q Q    + +  SM       GDI+++      + GD ++      +   K +  
Sbjct: 128 SMLSAQGQHFALEVRGDSMIEAGINDGDIVVIRETAVADNGDVVVALVEGQEATLKRIYR 187

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + G +I L + N  Y         ++   R++
Sbjct: 188 K-GSTIALEAANPAYETRRYPQDQVKVQGRLV 218


>gi|296117066|ref|ZP_06835664.1| phage transcriptional regulator and peptidase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976402|gb|EFG83182.1| phage transcriptional regulator and peptidase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 260

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 54/128 (42%), Gaps = 4/128 (3%)

Query: 96  PPSGSGGFFDSGVFPTGNKWNTVG-VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
           P +GSG          G    +V      R+      +  +     +    SM P +  G
Sbjct: 127 PHAGSGAIVGETDSGAGEGHASVAAWHMPRAFVENYVSDPSALVILRVSGNSMEPDFMAG 186

Query: 155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLI---SRRGRSIDLMSLNCCYPVDTVEMSD 211
           + +++++A +V   D + +      +V K L+         I ++S+N  YP+D V+++D
Sbjct: 187 ERVMVDTAHRVPSPDGVYVLWNGLGVVLKQLMLVPHSNPPRIRIISINPTYPMDEVDIAD 246

Query: 212 IEWIARIL 219
           +    R++
Sbjct: 247 LVINGRVV 254


>gi|218510024|ref|ZP_03507902.1| peptidase S24 and S26 domain protein [Rhizobium etli Brasil 5]
          Length = 237

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 71/212 (33%), Gaps = 33/212 (15%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET- 68
           W+ +D        + + LAR+AG+   + NK     + G+   P  E + K+ +A  ++ 
Sbjct: 7   WKRLDSRRIELGWSGAELARRAGIPYANINK----YLNGKIEQPRGEEMQKLASAIGKSA 62

Query: 69  --ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             +   L+L   +    E +   + ++    +G+    D          +   +  + + 
Sbjct: 63  LWLRDGLELSDVEAAPIEGRLLPVAVVGKVEAGTFREVDDM------DQSERELLSLPAD 116

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILI------LNSAIQVNCGDRLLI-K 174
                A   +         SM      P+   GD +I      +     +  G  +++ +
Sbjct: 117 DRFPSA---RLMAFDVSGDSMNDLRPRPIL-PGDRVICVSYEDVAHEAPLRDGMVVVVER 172

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT 206
            R G            + I+L      Y   +
Sbjct: 173 SRDG----GQTREWSVKQIELYQDRTEYHPRS 200


>gi|254457839|ref|ZP_05071266.1| putative phage repressor [Campylobacterales bacterium GD 1]
 gi|207085232|gb|EDZ62517.1| putative phage repressor [Campylobacterales bacterium GD 1]
          Length = 219

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 138 TRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
                   SM P +   DI+ +N A   +  G    I+   G +  K +  R    ID++
Sbjct: 131 EAINVSGDSMEPTFSYNDIVFINRAKTDLQRGGIFTIRTEAG-LFIKRVQKRIDGKIDII 189

Query: 197 SLNCCYPVDTVEMSDIEWIARIL 219
           S N  Y   T+E+++IE I R++
Sbjct: 190 SDNQVYSTQTLELNEIEVIGRVV 212


>gi|126735652|ref|ZP_01751397.1| LexA repressor [Roseobacter sp. CCS2]
 gi|126714839|gb|EBA11705.1| LexA repressor [Roseobacter sp. CCS2]
          Length = 228

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 45/153 (29%), Gaps = 14/153 (9%)

Query: 72  LLDLPFSDGRTTEKKEKEIPL-LYFPPSGSGGFFDSGVFPTGNKWNT---VGVPEIRSPH 127
                    +        IP+          G   +   P          V VP+     
Sbjct: 79  FTPRVIDGDKPDSTPVAAIPVDNGSVDLPMMGRI-AAGVPIEAISEASRNVSVPQSMVGA 137

Query: 128 NGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
              YA++        +  SM+      GD++++      + GD ++      +   K   
Sbjct: 138 GDHYALE-------VKGDSMIDAGINDGDVVVIRETTVADNGDIVVALVEGHEATLKRF- 189

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            R G +I L + N  Y         ++   R++
Sbjct: 190 RRNGSAIALEAANPAYETRVFRDDQVKVQGRLV 222


>gi|301629308|ref|XP_002943785.1| PREDICTED: hypothetical protein LOC100486556 [Xenopus (Silurana)
           tropicalis]
          Length = 752

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 10/99 (10%)

Query: 121 PEIRSPH-NGIYAIQTQ------DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
           P +   H +  Y ++        D   K +  SM       GD+L + +  +   G  ++
Sbjct: 638 PILAQEHVDQAYCVEDSLFQHKPDYLLKVRGMSMRDAGIMDGDLLAVQATREARNGQIIV 697

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            +    D+  K L  R    I+L+  N  YPV TV+  +
Sbjct: 698 ARLGD-DVTVKRL-RRTATGIELLPENPDYPVITVQPGE 734


>gi|222086522|ref|YP_002545056.1| hypothetical protein Arad_3094 [Agrobacterium radiobacter K84]
 gi|221723970|gb|ACM27126.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 262

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 38/121 (31%), Gaps = 12/121 (9%)

Query: 109 FPTGNK-------WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS 161
            P G              +P +    N   A        +    SM P Y  GD +I++ 
Sbjct: 136 LPVGAGNVAGHKIIAEWVIP-VGYLRNEAKASPNHTIIMEVIGDSMQPTYMPGDRVIVDL 194

Query: 162 AIQVNCGDRLLIKPRT-GDIVAKVLISRR---GRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
           +  +   D +        +   K L          I ++S N      TVE+  +  I R
Sbjct: 195 SQNLMVTDTVYAISDGYSEPQIKRLQRIPFTQPSQIKIISDNPALETFTVELERLTIIGR 254

Query: 218 I 218
           I
Sbjct: 255 I 255


>gi|149912077|ref|ZP_01900667.1| putative transcriptional regulator [Moritella sp. PE36]
 gi|149804843|gb|EDM64881.1| putative transcriptional regulator [Moritella sp. PE36]
          Length = 138

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 40/108 (37%), Gaps = 8/108 (7%)

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+Y              SM P  + G ++++N  +  N  D + +     ++
Sbjct: 32  PHWLRNEIGVY--PNNVFLMLVDGDSMQPTLKNGSMIMVNRDVD-NLSDGVYVMRHDNNL 88

Query: 181 VAKVLISRRGRSIDLMSLNCCYPV-----DTVEMSDIEWIARILWASQ 223
           + K L    G  I + S N  Y         ++  ++  I R++W  Q
Sbjct: 89  LVKRLQMLPGGIIRVKSDNTMYDPWEITKSQLDGEELALIGRVVWTGQ 136


>gi|33601254|ref|NP_888814.1| LexA repressor [Bordetella bronchiseptica RB50]
 gi|33575689|emb|CAE32767.1| LexA repressor [Bordetella bronchiseptica RB50]
          Length = 242

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRK-----GDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
           G++A QT D   K +  SM    R      GD+L +  A +   G  ++ +    ++  K
Sbjct: 144 GLFA-QTPDYLLKVRGMSM----RDAGILEGDLLAVKRAAEARNGQIVVARLGD-EVTVK 197

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            L  + GR I+L+  N  +    V  +D
Sbjct: 198 RLQRQNGR-IELLPENPDFAPIVVANTD 224


>gi|83951834|ref|ZP_00960566.1| LexA repressor [Roseovarius nubinhibens ISM]
 gi|83836840|gb|EAP76137.1| LexA repressor [Roseovarius nubinhibens ISM]
          Length = 232

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 62/215 (28%), Gaps = 40/215 (18%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDGRTTEKKEKE----------- 89
           KR   +G    PS + + + L   +   I +L+      G       +            
Sbjct: 15  KRIQRDGVP--PSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHRARALEIVKLPES 72

Query: 90  ---IPLLYFPPSGSGGFFDSGVFPTGNKWNTV---GVPEIRSPHNGI------------- 130
               P   F P    G       P   +   V    +P +     G+             
Sbjct: 73  LGGAPAHGFTPRVIEGDRPEAGQPANARPVEVHALELPVMGRIAAGVPIEAINHVSHNVA 132

Query: 131 -----YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                 + Q      + +  SM       GDI+++      + GD ++      +   K 
Sbjct: 133 VPGAMVSGQGNHYALEVKGDSMIEAGINDGDIVVIRETSTADNGDIVVALVEDQEATLKR 192

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              R G +I L + N  Y    +    ++   R++
Sbjct: 193 FFRR-GGAIALEAANPAYETRVLPDDKVKVQGRLV 226


>gi|254785997|ref|YP_003073426.1| LexA repressor [Teredinibacter turnerae T7901]
 gi|259494479|sp|C5BIH2|LEXA_TERTT RecName: Full=LexA repressor
 gi|237685540|gb|ACR12804.1| LexA repressor [Teredinibacter turnerae T7901]
          Length = 200

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 50/136 (36%), Gaps = 16/136 (11%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           S G    + +  IPL+    +GS       +    +  +   +P         +     D
Sbjct: 63  SRGIRLPEVQSGIPLVGRVAAGS------PILAQEHIEDYCDIPHN-------FFSPKAD 109

Query: 138 TRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS-IDL 195
                   SM  +    GD+L ++   QV  GD +++     ++  K     R R+ ++L
Sbjct: 110 FLLTVHGMSMKDIGILDGDLLAVHKTDQVRNGD-IVVARIDNEVTVKRFKRERNRAQVEL 168

Query: 196 MSLNCCYPVDTVEMSD 211
              N  + V  V++ D
Sbjct: 169 WPENPDFNVIEVDLRD 184


>gi|308389172|gb|ADO31492.1| putative regulatory protein [Neisseria meningitidis alpha710]
          Length = 215

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
              +  SM P +  GD L +++A     G+ + +    G++  K L S     ++++S N
Sbjct: 125 ISVKGDSMSPTFNHGDFLFVDTAADFYNGEGVYVFAAAGELRVKRLQSSVRGGMNVISDN 184

Query: 200 CCYPVDTVEMSDIEWIA 216
             Y  + +   D  W A
Sbjct: 185 RNYNAEYLPPDD--WAA 199


>gi|323941148|gb|EGB37334.1| peptidase S24 [Escherichia coli E482]
          Length = 108

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 11  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 70

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 71  GQVF-LQPLNPQYP 83


>gi|313141175|ref|ZP_07803368.1| lambda repressor [Bifidobacterium bifidum NCIMB 41171]
 gi|313133685|gb|EFR51302.1| lambda repressor [Bifidobacterium bifidum NCIMB 41171]
          Length = 242

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 145 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 204

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 205 GQVF-LQPLNPQYP 217


>gi|261369111|ref|ZP_05981994.1| repressor protein CI [Subdoligranulum variabile DSM 15176]
 gi|282568739|gb|EFB74274.1| repressor protein CI [Subdoligranulum variabile DSM 15176]
          Length = 215

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|255016583|ref|ZP_05288709.1| Repressor protein CI [Bacteroides sp. 2_1_7]
          Length = 246

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|254714851|ref|ZP_05176662.1| Repressor protein CI [Brucella ceti M644/93/1]
 gi|261322650|ref|ZP_05961847.1| lambda repressor [Brucella ceti M644/93/1]
 gi|261295340|gb|EEX98836.1| lambda repressor [Brucella ceti M644/93/1]
          Length = 225

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|237707939|ref|ZP_04538420.1| lambda repressor [Bacteroides sp. 9_1_42FAA]
 gi|229458045|gb|EEO63766.1| lambda repressor [Bacteroides sp. 9_1_42FAA]
          Length = 225

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 128 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 187

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 188 GQVF-LQPLNPQYP 200


>gi|261351066|ref|ZP_05976483.1| repressor protein CI [Methanobrevibacter smithii DSM 2374]
 gi|288860198|gb|EFC92496.1| repressor protein CI [Methanobrevibacter smithii DSM 2374]
          Length = 212

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|224284017|ref|ZP_03647339.1| Repressor protein CI from prophage [Bifidobacterium bifidum NCIMB
           41171]
          Length = 281

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 184 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 243

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 244 GQVF-LQPLNPQYP 256


>gi|218558038|ref|YP_002390951.1| Repressor protein CI from phage origin [Escherichia coli S88]
 gi|218364807|emb|CAR02497.1| Repressor protein CI from phage origin [Escherichia coli S88]
          Length = 233

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 136 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 195

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 196 GQVF-LQPLNPQYP 208


>gi|215479925|ref|YP_002332313.1| c repressor [Pseudomonas phage MP38]
 gi|169409293|gb|ACA57697.1| c repressor [Pseudomonas phage MP38]
          Length = 219

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 38/90 (42%), Gaps = 3/90 (3%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
              +  +    SM PL   GD ++++ +      + + +      + AK +  +    + 
Sbjct: 125 ANMSAVRIGGDSMEPLLSDGDTVMIDHSCGEVRDEAIYVIRLDDHLYAKRIQRQINGGLA 184

Query: 195 LMSLNCCYPVDTV---EMSDIEWIARILWA 221
           ++S N  Y    V   ++  I+ I R++WA
Sbjct: 185 IISANSAYQTMYVSKQDLEAIDIIGRVVWA 214


>gi|209407392|emb|CAQ82008.1| repressor protein CI [Enterobacteria phage 2851]
          Length = 219

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 122 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 181

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 182 GQVF-LQPLNPQYP 194


>gi|300922482|ref|ZP_07138595.1| peptidase S24-like domain protein [Escherichia coli MS 182-1]
 gi|133874004|gb|ABO40696.1| prophage repressor [Enterobacteria phage CL707]
 gi|300421169|gb|EFK04480.1| peptidase S24-like domain protein [Escherichia coli MS 182-1]
          Length = 237

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|117623333|ref|YP_852246.1| putative CI repressor of bacteriophage [Escherichia coli APEC O1]
 gi|168752471|ref|ZP_02777493.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|187776111|ref|ZP_02800576.2| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|189010451|ref|ZP_02807272.2| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|189402456|ref|ZP_02782534.2| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|189404513|ref|ZP_02790006.2| CI protein [Escherichia coli O157:H7 str. EC4501]
 gi|189405171|ref|ZP_02813660.2| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|189405760|ref|ZP_02824140.2| CI protein [Escherichia coli O157:H7 str. EC508]
 gi|208809661|ref|ZP_03251998.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208817192|ref|ZP_03258284.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820684|ref|ZP_03261004.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400501|ref|YP_002271236.1| repressor protein [Escherichia coli O157:H7 str. EC4115]
 gi|209427751|ref|YP_002274162.1| putative bacteriophage CI repressor [Enterobacteria phage YYZ-2008]
 gi|217328107|ref|ZP_03444189.1| repressor protein [Escherichia coli O157:H7 str. TW14588]
 gi|227886483|ref|ZP_04004288.1| repressor protein CI [Escherichia coli 83972]
 gi|237706857|ref|ZP_04537338.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|254793774|ref|YP_003078611.1| repressor protein CI [Escherichia coli O157:H7 str. TW14359]
 gi|300935255|ref|ZP_07150273.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|300975627|ref|ZP_07173106.1| peptidase S24-like domain protein [Escherichia coli MS 45-1]
 gi|300982354|ref|ZP_07176052.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|301046509|ref|ZP_07193662.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|302393138|ref|YP_003828968.1| CI protein [Stx2 converting phage II]
 gi|32128133|dbj|BAC77937.1| CI protein [Stx1 converting phage]
 gi|32128300|dbj|BAC78103.1| CI protein [Stx2 converting phage II]
 gi|115512457|gb|ABJ00532.1| putative CI repressor of bacteriophage [Escherichia coli APEC O1]
 gi|187768994|gb|EDU32838.1| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|188013689|gb|EDU51811.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|189000092|gb|EDU69078.1| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|189355469|gb|EDU73888.1| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|189365099|gb|EDU83515.1| CI protein [Escherichia coli O157:H7 str. EC4501]
 gi|189371589|gb|EDU90005.1| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|189378456|gb|EDU96872.1| CI protein [Escherichia coli O157:H7 str. EC508]
 gi|208729462|gb|EDZ79063.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208730811|gb|EDZ79501.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740807|gb|EDZ88489.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|208970819|gb|ACI32363.1| putative bacteriophage CI repressor [Enterobacteria phage YYZ-2008]
 gi|209161901|gb|ACI39334.1| repressor protein [Escherichia coli O157:H7 str. EC4115]
 gi|217318534|gb|EEC26960.1| repressor protein [Escherichia coli O157:H7 str. TW14588]
 gi|226898067|gb|EEH84326.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227836687|gb|EEJ47153.1| repressor protein CI [Escherichia coli 83972]
 gi|254593174|gb|ACT72535.1| repressor protein CI [Escherichia coli O157:H7 str. TW14359]
 gi|300301529|gb|EFJ57914.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|300307191|gb|EFJ61711.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|300410290|gb|EFJ93828.1| peptidase S24-like domain protein [Escherichia coli MS 45-1]
 gi|300459507|gb|EFK23000.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|315287509|gb|EFU46920.1| peptidase S24-like domain protein [Escherichia coli MS 110-3]
 gi|315293071|gb|EFU52423.1| peptidase S24-like domain protein [Escherichia coli MS 153-1]
 gi|323957980|gb|EGB53692.1| peptidase S24 [Escherichia coli H263]
          Length = 231

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 134 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 193

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 194 GQVF-LQPLNPQYP 206


>gi|210610265|ref|ZP_03288320.1| hypothetical protein CLONEX_00506 [Clostridium nexile DSM 1787]
 gi|228474131|ref|ZP_04058871.1| repressor protein CI [Capnocytophaga gingivalis ATCC 33624]
 gi|239622955|ref|ZP_04665986.1| lambda cI857 repressor [Clostridiales bacterium 1_7_47_FAA]
 gi|254708517|ref|ZP_05170345.1| Repressor protein CI [Brucella pinnipedialis M163/99/10]
 gi|261316018|ref|ZP_05955215.1| repressor protein [Brucella pinnipedialis M163/99/10]
 gi|261343115|ref|ZP_05970973.1| repressor protein CI [Enterobacter cancerogenus ATCC 35316]
 gi|282875750|ref|ZP_06284618.1| peptidase, S24 family [Staphylococcus epidermidis SK135]
 gi|283836773|ref|ZP_06356514.1| repressor protein CI [Citrobacter youngae ATCC 29220]
 gi|208651|gb|AAA99919.1| lambda repressor [Cloning vector pNO3097]
 gi|2961156|gb|AAC27033.1| lambda repressor [site-specific excision vector pFLP2]
 gi|4732119|gb|AAD28615.1| repressor protein [Cloning vector pWD42-09]
 gi|4928118|gb|AAD33415.1| lambda cI857 repressor [Cloning vector pWDYcos1.0.1]
 gi|16209070|gb|AAL09847.1| cI [CRIM helper plasmid pAH57]
 gi|16209082|gb|AAL09855.1| cI [CRIM helper plasmid pAH69]
 gi|16209093|gb|AAL09862.1| cI [CRIM helper plasmid pAH83]
 gi|16209106|gb|AAL09870.1| cI [CRIM helper plasmid pAH121]
 gi|16209112|gb|AAL09874.1| cI [CRIM helper plasmid pAH122]
 gi|16209120|gb|AAL09879.1| cI [CRIM helper plasmid pAH123]
 gi|16209126|gb|AAL09883.1| cI [CRIM helper plasmid pAH129]
 gi|16209132|gb|AAL09888.1| cI [CRIM helper plasmid pAH130]
 gi|16209138|gb|AAL09892.1| cI [CRIM helper plasmid pAH131]
 gi|16209182|gb|AAL09915.1| cI [CRIM helper plasmid pINT-ts]
 gi|47027959|gb|AAT08997.1| lambda repressor [Flp expression vector pFLP3]
 gi|55975982|gb|AAV68247.1| repressor [Broad host range Red recombinase expression vector
           pRKcIRed]
 gi|154814537|gb|ABS87301.1| CI [Cloning vector pCPP5264]
 gi|157955302|gb|ABW06020.1| cI857 [Triparental mating vector pCD13SK-Flp-oriT]
 gi|164470280|gb|ABY57979.1| CI857 [Cloning vector pFlpAB-3]
 gi|164470289|gb|ABY57987.1| CI857 [Cloning vector pFlpAB-4]
 gi|164600695|gb|ABY61785.1| CI857 [Flp expression vector pFlpAB-5]
 gi|197091802|gb|ACH42113.1| CI857 [Vector pCD13SK-Flp-oriT-Easd]
 gi|210152569|gb|EEA83575.1| hypothetical protein CLONEX_00506 [Clostridium nexile DSM 1787]
 gi|215789977|gb|ACJ70060.1| CI857 [Cloning vector pFlp-AB7]
 gi|225423174|gb|ACN91079.1| lambda repressor [Site-specific excision vector pBBR1_FLP2]
 gi|228274403|gb|EEK13256.1| repressor protein CI [Capnocytophaga gingivalis ATCC 33624]
 gi|239522634|gb|EEQ62500.1| lambda cI857 repressor [Clostridiales bacterium 1_7_47FAA]
 gi|261305044|gb|EEY08541.1| repressor protein [Brucella pinnipedialis M163/99/10]
 gi|281295465|gb|EFA87991.1| peptidase, S24 family [Staphylococcus epidermidis SK135]
 gi|288314592|gb|EFC53530.1| repressor protein CI [Enterobacter cancerogenus ATCC 35316]
 gi|291067231|gb|EFE05340.1| repressor protein CI [Citrobacter youngae ATCC 29220]
          Length = 237

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|26247415|ref|NP_753455.1| repressor protein [Escherichia coli CFT073]
 gi|26107816|gb|AAN80015.1|AE016759_289 Repressor protein [Escherichia coli CFT073]
          Length = 140

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 43  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 102

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 103 GQVF-LQPLNPQYP 115


>gi|9633419|ref|NP_050522.1| similar to CI repressor [Enterobacteria phage VT2-Sakai]
 gi|5881615|dbj|BAA84306.1| cI [Enterobacteria phage VT2-Sakai]
          Length = 169

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 72  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 131

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 132 GQVF-LQPLNPQYP 144


>gi|116672382|ref|YP_833315.1| SOS mutagenesis protein UmuD [Arthrobacter sp. FB24]
 gi|116612491|gb|ABK05215.1| SOS response UmuD protein, Serine peptidase, MEROPS family S24
           [Arthrobacter sp. FB24]
          Length = 143

 Score = 45.3 bits (106), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 34/105 (32%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  +P+               +  +    T     +    SM       GD LI+N A+ 
Sbjct: 27  AAGYPSPA---QDYFDGRIDLNEHLIKDITSTYIVRVSGDSMEGAGISDGDELIVNRALD 83

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G  ++I    G++  K L       + L + N  YP   V  
Sbjct: 84  PKDGS-VVIAVLDGELTIKRL-RVTASGVVLQADNPRYPDIRVPA 126


>gi|149911913|ref|ZP_01900512.1| putative transcriptional regulator [Moritella sp. PE36]
 gi|149805006|gb|EDM65034.1| putative transcriptional regulator [Moritella sp. PE36]
          Length = 250

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 36/95 (37%), Gaps = 6/95 (6%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                       SM P  + G ++++N  +  N  D + +     +++ K L    G  I
Sbjct: 155 PNNVFLMLVDGDSMQPTLKNGSMIMVNRDVD-NLSDGVYVMRHDNNLLVKRLQMLPGGII 213

Query: 194 DLMSLNCCYPV-----DTVEMSDIEWIARILWASQ 223
            + S N  Y         ++  ++  I R++W  Q
Sbjct: 214 RVKSDNTMYDPWEITKSQLDGEELALIGRVVWTGQ 248


>gi|223934043|ref|ZP_03625996.1| putative phage repressor [Streptococcus suis 89/1591]
 gi|223897300|gb|EEF63708.1| putative phage repressor [Streptococcus suis 89/1591]
          Length = 251

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 37/109 (33%), Gaps = 18/109 (16%)

Query: 96  PPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGD 155
             +G+G + +           T+ +P               D        SM P Y  GD
Sbjct: 139 ASAGTGQYLNDVKV------ETIELPIEVD----------ADFVVPIYGDSMEPEYHSGD 182

Query: 156 ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
            + +  ++ ++ GD + +    G+   K L     +   L SLN  Y  
Sbjct: 183 YVFVKLSVDLSDGD-IGVFAYNGEAYIKQL-RITDQGAYLHSLNPDYDN 229


>gi|332855796|ref|ZP_08436047.1| DNA-binding helix-turn-helix protein [Acinetobacter baumannii
           6013150]
 gi|332870031|ref|ZP_08439007.1| DNA-binding helix-turn-helix protein [Acinetobacter baumannii
           6013113]
 gi|332727271|gb|EGJ58715.1| DNA-binding helix-turn-helix protein [Acinetobacter baumannii
           6013150]
 gi|332732531|gb|EGJ63782.1| DNA-binding helix-turn-helix protein [Acinetobacter baumannii
           6013113]
          Length = 213

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/165 (13%), Positives = 63/165 (38%), Gaps = 16/165 (9%)

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            ++ + E++ ++L  T + +   ++      +      + +P+L +  +G+     + V 
Sbjct: 43  PKYENLEALCQVLDTTIDYLKYGVNNNEQSVKDLRPITRMLPVLDYVQAGNW----TNVR 98

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ---VN 166
                   + +P         +           Q TS  P ++ GD++ ++  I    V 
Sbjct: 99  SIQPHEIELWLPAPPEAGRNSF-------YMIVQGTSNTPHFKDGDLICIDPDIPLEYVQ 151

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            G  +++         K L+    +++ L +LN  +  + + + +
Sbjct: 152 TG-EMIVAMCDDQATFKALVREN-KNMYLQALNGNFHPNIIPLKE 194


>gi|226328124|ref|ZP_03803642.1| hypothetical protein PROPEN_02015 [Proteus penneri ATCC 35198]
 gi|225203828|gb|EEG86182.1| hypothetical protein PROPEN_02015 [Proteus penneri ATCC 35198]
          Length = 214

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 55/140 (39%), Gaps = 5/140 (3%)

Query: 81  RTTEKKEKEIPLLY-FPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTR 139
            +T+ +   + L+  +  +G GGF +S  FP  +   ++     +               
Sbjct: 64  PSTQNEHTTLKLMDVYAKAGPGGFINSD-FP--DTIKSIEFSPEKVFELFGRKSLKGIEI 120

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
                 SM P     D++ +++  +   GD + I      +  K L   +GR + + S N
Sbjct: 121 INISGDSMSPAINPRDVVFVDTHNEFFDGDGVYIFSFENSLFIKRLQRVKGRKLAVKSDN 180

Query: 200 CCYPVDTVEMSDIEWIARIL 219
             Y    +E S++ +  RI+
Sbjct: 181 PAYETFYIEESEM-YDLRII 199


>gi|254511805|ref|ZP_05123872.1| LexA repressor [Rhodobacteraceae bacterium KLH11]
 gi|221535516|gb|EEE38504.1| LexA repressor [Rhodobacteraceae bacterium KLH11]
          Length = 232

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            +    + +  SM       GD++++      + GD ++      +   K    R G++I
Sbjct: 142 GEHYALEVRGDSMIEAGINDGDVVVIRETSAADNGDIVVALVEDQEATLKRFFRR-GQAI 200

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L + N  Y    +    ++   R++
Sbjct: 201 ALEAANPAYETRVLPEDKVKVQGRLV 226


>gi|6729334|dbj|BAA89781.1| repressor protein [Enterobacteria phage VT2-Sakai]
          Length = 191

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 94  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 153

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 154 GQVF-LQPLNPQYP 166


>gi|6249458|emb|CAB60047.1| hypothetical protein [Legionella pneumophila]
          Length = 244

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 5/80 (6%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRRGR--- 191
                  +D SM P ++  DILI++   Q N GD ++ +     +I+ +           
Sbjct: 147 NAFALAVKDESMAPEFKFDDILIVDPDTQPNPGDYIVARLENEPEIIIRKFKQLSVSKEK 206

Query: 192 -SIDLMSLNCCYPVDTVEMS 210
              +L+++N  +P   +   
Sbjct: 207 PEFELVAINNDWPDVKISKE 226


>gi|52841492|ref|YP_095291.1| phage repressor [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628603|gb|AAU27344.1| phage repressor [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 246

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 33/80 (41%), Gaps = 5/80 (6%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRRGR--- 191
                  +D SM P ++  DILI++   Q N GD ++ +     +I+ +           
Sbjct: 149 NAFALAVKDESMAPEFKFDDILIVDPDTQPNPGDYIVARLENEPEIIIRKFKQLSVSKEK 208

Query: 192 -SIDLMSLNCCYPVDTVEMS 210
              +L+++N  +P   +   
Sbjct: 209 PEFELVAINNDWPDVKISKE 228


>gi|15830439|ref|NP_309212.1| cI repressor protein [Escherichia coli O157:H7 str. Sakai]
 gi|7649844|dbj|BAA94122.1| CI protein [Enterobacteria phage VT2-Sakai]
 gi|13360645|dbj|BAB34608.1| putative cI repressor protein [Escherichia coli O157:H7 str. Sakai]
          Length = 217

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 120 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 180 GQVF-LQPLNPQYP 192


>gi|320659907|gb|EFX27453.1| repressor protein CI [Escherichia coli O55:H7 str. USDA 5905]
          Length = 217

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 120 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 180 GQVF-LQPLNPQYP 192


>gi|114778581|ref|ZP_01453408.1| putative prophage repressor [Mariprofundus ferrooxydans PV-1]
 gi|114551170|gb|EAU53730.1| putative prophage repressor [Mariprofundus ferrooxydans PV-1]
          Length = 194

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 55/154 (35%), Gaps = 9/154 (5%)

Query: 53  PSTESIFKILAA-TNETICQLLD-LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           PS   I ++L   +  ++ QL+  L  +     +   + +P   F      G      FP
Sbjct: 24  PSYAGIAELLGMKSRASVQQLVSRLKENGYLDNKVPRRLVPTSKFLERPLVGS-APAGFP 82

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGD 169
           +        + +  S  + +    +     +    SM+      GDI+I+    +    D
Sbjct: 83  SPA---EEALGDAISIDDYLVEHPSATVLVQVDGDSMIGAGINSGDIMIVRRESRPRV-D 138

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           R+++    GD   K L  +  +   L   N  YP
Sbjct: 139 RIIVAIVDGDFTIKYL-RKDKQGYFLEPANPAYP 171


>gi|91210315|ref|YP_540301.1| putative CI repressor of bacteriophage [Escherichia coli UTI89]
 gi|195939328|ref|ZP_03084710.1| putative CI repressor of bacteriophage [Escherichia coli O157:H7
           str. EC4024]
 gi|209447145|ref|YP_002274230.1| repressor [Stx2-converting phage 1717]
 gi|215486128|ref|YP_002328559.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|261225735|ref|ZP_05940016.1| repressor protein CI [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258459|ref|ZP_05950992.1| repressor protein CI [Escherichia coli O157:H7 str. FRIK966]
 gi|291281724|ref|YP_003498542.1| CI protein [Escherichia coli O55:H7 str. CB9615]
 gi|302861176|ref|YP_003848877.1| CI repressor protein [Stx1 converting phage]
 gi|23343453|emb|CAC95084.1| repressor [Enterobacteria phage Nil2]
 gi|91071889|gb|ABE06770.1| putative CI repressor of bacteriophage [Escherichia coli UTI89]
 gi|209361124|gb|ACI43117.1| repressor [Stx2-converting phage 1717]
 gi|215264200|emb|CAS08544.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|290761597|gb|ADD55558.1| CI protein [Escherichia coli O55:H7 str. CB9615]
 gi|294489683|gb|ADE88439.1| peptidase, S24 (LexA) family [Escherichia coli IHE3034]
 gi|307553159|gb|ADN45934.1| putative CI repressor of bacteriophage [Escherichia coli ABU 83972]
 gi|307627374|gb|ADN71678.1| repressor protein CI [Escherichia coli UM146]
 gi|320637900|gb|EFX07682.1| repressor protein CI [Escherichia coli O157:H7 str. G5101]
 gi|320643308|gb|EFX12497.1| repressor protein CI [Escherichia coli O157:H- str. 493-89]
 gi|320648651|gb|EFX17292.1| repressor protein CI [Escherichia coli O157:H- str. H 2687]
 gi|320654244|gb|EFX22302.1| repressor protein CI [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320664729|gb|EFX31869.1| repressor protein CI [Escherichia coli O157:H7 str. LSU-61]
 gi|323953159|gb|EGB49025.1| peptidase S24 [Escherichia coli H252]
          Length = 217

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 120 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 180 GQVF-LQPLNPQYP 192


>gi|86153305|ref|ZP_01071509.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843031|gb|EAQ60242.1| phage repressor protein, putative [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 209

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 70/209 (33%), Gaps = 20/209 (9%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G+ P +FN  K        +      I   L   N +I  
Sbjct: 12  DILASEGKRDLKTKDIAKELGIHPDTFNSIKFRNSIPYPQ------ILNFLNGRNISINY 65

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + +  I  LY   +  GG         G   +++   E+        
Sbjct: 66  FFYGVSPKDQLECENKYRILKLYKTNASLGG---------GGINDSIDCSELIVDEKLLN 116

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 117 FFGGKECEFITCYGESMEPLIKDGSICVIDRNKTFKNKSICVINTRDG-LFIKQVLKQDD 175

Query: 191 RSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             I L SLN  Y     +  D   I  I+
Sbjct: 176 GVI-LHSLNPLYKDVFYKNGDFLLIGAIV 203


>gi|257455556|ref|ZP_05620786.1| phage repressor [Enhydrobacter aerosaccus SK60]
 gi|257447022|gb|EEV22035.1| phage repressor [Enhydrobacter aerosaccus SK60]
          Length = 222

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 66/173 (38%), Gaps = 47/173 (27%)

Query: 21  NLTPSGLARKAGLDPTSFNKSKRFGIE----GRNRWPSTESIFKILA------------A 64
            LT   LA+K+G        SK+  I     GRN     ES  K++             A
Sbjct: 17  GLTQVELAKKSG--------SKQGAISDLESGRN-----ESSTKLVEMAEAMGVSAKWLA 63

Query: 65  TNET--ICQLLDLPF-SDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTVGV 120
           T E   + Q + +P  S+     +K ++ P+L +  +G     FD       N ++    
Sbjct: 64  TGEGNMLDQDIKVPSISNVDFIPQKIRKAPVLNWVQAGHPADVFD-------NGYDEYEY 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
                    +Y +         +  SM P + +GD +++++  Q   GD ++ 
Sbjct: 117 FYDEGYGLQVYWL-------YVRGDSMNPEFFEGDKILVDAERQARAGDYVIA 162


>gi|253699290|ref|YP_003020479.1| XRE family transcriptional regulator [Geobacter sp. M21]
 gi|251774140|gb|ACT16721.1| transcriptional regulator, XRE family [Geobacter sp. M21]
          Length = 209

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 42/127 (33%), Gaps = 23/127 (18%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
              + K    PLL   P     F D     +      + VP++     G YAI       
Sbjct: 81  AADQPKVSRAPLLDVIP---DSFPDDPGAVS----RYISVPDLP---EGCYAI------- 123

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNC-GDRLLIKPRTGDIVAKVLISRRGR--SIDLMS 197
                 M P  R GD++I          GD +++  R G+    +L   R +   I L  
Sbjct: 124 VCYGDFMSPTIRDGDVVIFRPESGQKKSGDIIIVHNRWGEP---ILRRYRVKDDEIYLAP 180

Query: 198 LNCCYPV 204
            N  Y  
Sbjct: 181 DNPAYAP 187


>gi|87303597|ref|ZP_01086376.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 5701]
 gi|87281821|gb|EAQ73785.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. WH 5701]
          Length = 153

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 44/107 (41%), Gaps = 6/107 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  FP+    + V        +  +    +     +    SM+      GD+LI++ +++
Sbjct: 37  AAGFPSPAD-DYVE--TGIDLNEQLIRHPSSTFFLRVSGDSMIGAGIHHGDLLIVDRSVE 93

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              G R+++    G    K L+  +GR + L + +  YP   +  +D
Sbjct: 94  PRHG-RVVVAAVEGAFTLKRLVRHQGR-LRLEAAHPAYPPLELSDAD 138


>gi|320191842|gb|EFW66490.1| prophage repressor [Escherichia coli O157:H7 str. EC1212]
 gi|326347828|gb|EGD71544.1| prophage repressor [Escherichia coli O157:H7 str. 1044]
          Length = 108

 Score = 45.3 bits (106), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 11  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 70

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 71  GQVF-LQPLNPQYP 83


>gi|152985545|ref|YP_001349953.1| transcriptional regulator [Pseudomonas aeruginosa PA7]
 gi|150960703|gb|ABR82728.1| probable transcriptional regulator [Pseudomonas aeruginosa PA7]
          Length = 237

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 7/95 (7%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                       SM P+   G  + ++++   +  GD +      G +  K+L    G  
Sbjct: 141 PASAACVTVSGNSMEPVLPDGSTVGVDTSARTIRDGD-MYAFDHDGQLRVKLLYRLPGGG 199

Query: 193 IDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           + + S N   +P +  E  +    I  I R+ W S
Sbjct: 200 LRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|225025512|ref|ZP_03714704.1| hypothetical protein EIKCOROL_02412 [Eikenella corrodens ATCC
           23834]
 gi|224941796|gb|EEG23005.1| hypothetical protein EIKCOROL_02412 [Eikenella corrodens ATCC
           23834]
          Length = 251

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 45/121 (37%), Gaps = 12/121 (9%)

Query: 108 VFPTGNKWNTVGVPEIRSP---HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
            FP GN       P         + + A     +  K +  SM P+    D +++     
Sbjct: 130 GFPVGN--EEPLFPMAFRRFWIEHYLNADPKDLSVIKVRGDSMEPVLCNNDNILV--NHA 185

Query: 165 VNC-GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD----IEWIARIL 219
               G+ L +    G++V K      G  + L S N  Y    +++++    +E + R+ 
Sbjct: 186 KRKPGNGLFVVRIGGELVVKYTQIMPGSKLLLKSANEIYEPFELDVAEPDADVEIVGRVE 245

Query: 220 W 220
           W
Sbjct: 246 W 246


>gi|121594652|ref|YP_986548.1| LexA repressor [Acidovorax sp. JS42]
 gi|222110746|ref|YP_002553010.1| lexa repressor [Acidovorax ebreus TPSY]
 gi|171769452|sp|A1W897|LEXA_ACISJ RecName: Full=LexA repressor
 gi|254809095|sp|B9MI78|LEXA_DIAST RecName: Full=LexA repressor
 gi|120606732|gb|ABM42472.1| SOS-response transcriptional repressor, LexA [Acidovorax sp. JS42]
 gi|221730190|gb|ACM33010.1| SOS-response transcriptional repressor, LexA [Acidovorax ebreus
           TPSY]
          Length = 224

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 153 KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD+L + +  +   G  ++ +    D+  K L  R G +I+L+  N  YPV  VE  +
Sbjct: 150 DGDLLAVQATREARNGQIIVARLGD-DVTVKRL-RRTGSAIELLPENPDYPVIRVEPGE 206


>gi|91787695|ref|YP_548647.1| phage lambda repressor protein. Serine peptidase. MEROPS family S24
           [Polaromonas sp. JS666]
 gi|91696920|gb|ABE43749.1| phage repressor protein, Serine peptidase, MEROPS family S24
           [Polaromonas sp. JS666]
          Length = 207

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 59/163 (36%), Gaps = 17/163 (10%)

Query: 60  KILAATNETICQLLDL-PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           K+      ++ +L+                EIPL+    +G+    D+    +G +   V
Sbjct: 50  KVAELLGISVAELVSGDSRMSPGLGIDVRAEIPLISEVHAGNYTAIDNFQPRSGFEMVPV 109

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL----YRKGDILILNSAIQVNCGDRLLIK 174
            VP           ++ Q    +    SM+ +    + +G IL++   +    GD +++ 
Sbjct: 110 TVP-----------VKRQTFALRVHGDSMVGITGDSFPEGSILVVEPELTAEPGDYVIVL 158

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
                   K L+        L  LN  YPV  +  ++I  + R
Sbjct: 159 NSKNQTTFKQLVKDGADYY-LKPLNTRYPVKPLGSAEIIGVVR 200


>gi|159044352|ref|YP_001533146.1| LexA repressor [Dinoroseobacter shibae DFL 12]
 gi|189046535|sp|A8LMK0|LEXA_DINSH RecName: Full=LexA repressor
 gi|157912112|gb|ABV93545.1| lexA repressor [Dinoroseobacter shibae DFL 12]
          Length = 231

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 66/207 (31%), Gaps = 39/207 (18%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDG--RTTEKKEKEIPLLYFPPS 98
           KR   +G    PS + +   L   +   I +L+      G  R    K + I ++  P +
Sbjct: 15  KRLQRDGVP--PSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHKARAIEIVKLPEA 72

Query: 99  ----GSGGFF------DSGVFPTGN----KWNTVGVP-----EIRSPHNGIYAI------ 133
                 GGF       D    P G       + V +P        +P   I  +      
Sbjct: 73  LMGSMQGGFAPQVIDGDRLDPPVGAMPVSGIHAVELPVMGKIAAGTPIEAISEVSHTVAV 132

Query: 134 -------QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
                    +    + +  SM+      GDI+++        GD ++      +   K L
Sbjct: 133 PGQMMRQDAEHYALEVKGDSMINAGINNGDIVVIRETSVAESGDIVVALVDGHEATLKTL 192

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDI 212
             +RG +I L + N  Y         +
Sbjct: 193 -RKRGNAIALEAANPAYETRVYPAEMV 218


>gi|307943610|ref|ZP_07658954.1| transcriptional regulator [Roseibium sp. TrichSKD4]
 gi|307773240|gb|EFO32457.1| transcriptional regulator [Roseibium sp. TrichSKD4]
          Length = 234

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 55/177 (31%), Gaps = 14/177 (7%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP------SGSGGFFDS 106
           PS +   +I  A N ++  L             +      +  P       +G G +   
Sbjct: 56  PSLDKATQIARACNVSLEWLATGQGPKHPRQASEVHAADFIGIPRYDAHLSAGGGTWNAD 115

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
              P     + +             +             SM PL    DI++++   +  
Sbjct: 116 KERPL----DHIPFTREFLAKRLHKSKPRDLVILMVNGDSMEPLINDDDIVMVD-QSKKR 170

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARILW 220
             D +           K   +     +++ S N  YP + +   +++D+  I +++W
Sbjct: 171 LEDGIFAFVFDDLAKVKRFRTLANGDLEIRSDNPLYPPEVLQKEQLNDLNIIGKVVW 227


>gi|18158895|pdb|1KCA|A Chain A, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158896|pdb|1KCA|B Chain B, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158897|pdb|1KCA|C Chain C, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158898|pdb|1KCA|D Chain D, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158899|pdb|1KCA|E Chain E, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158900|pdb|1KCA|F Chain F, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158901|pdb|1KCA|G Chain G, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
 gi|18158902|pdb|1KCA|H Chain H, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain Octamer
          Length = 109

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 12  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 71

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 72  GQVF-LQPLNPQYP 84


>gi|256160568|ref|ZP_05458243.1| Repressor protein CI from prophage [Brucella ceti M490/95/1]
          Length = 153

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 56  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 115

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 116 GQVF-LQPLNPQYP 128


>gi|189350245|ref|YP_001945873.1| putative bacteriophage repressor protein CI [Burkholderia
           multivorans ATCC 17616]
 gi|189334267|dbj|BAG43337.1| putative bacteriophage repressor protein CI [Burkholderia
           multivorans ATCC 17616]
          Length = 246

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 76/219 (34%), Gaps = 28/219 (12%)

Query: 18  ERHNLTPSGLARKAGLDPTSF-------NK-SKRFGIEGR-----NRWPSTESIFKILAA 64
           E  +L+ + LA +AG+  T+        N+ SK      R       W  +ES  K  +A
Sbjct: 13  EEKSLSQAQLATRAGVSQTTIANVESGRNQGSKHLLSIARALGVNPAWLESESGPKDASA 72

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD--SGVFPTGNK---WNTVG 119
                  +  +P   G     +  +      PP  +  + D     F  G     W    
Sbjct: 73  AAAPQPGIYKIPEDQGNVLVWEHPD----DLPPDENRVWLDRYDYRFSAGTGLIQWEVRQ 128

Query: 120 VPEIRSPHNGIYAI---QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKP 175
              +        A+          +    SM P     D++++++A   +  G ++    
Sbjct: 129 KKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTAKNHIRDG-KVYAIY 187

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIE 213
             G+ + K +  + G SI L S+N   YP   V    +E
Sbjct: 188 FEGEPLVKQIFKQAGGSICLHSINAGKYPDKIVTPELME 226


>gi|148653141|ref|YP_001280234.1| putative prophage repressor [Psychrobacter sp. PRwf-1]
 gi|148572225|gb|ABQ94284.1| putative prophage repressor [Psychrobacter sp. PRwf-1]
          Length = 219

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 26/161 (16%), Positives = 60/161 (37%), Gaps = 33/161 (20%)

Query: 58  IFKILAATNETICQLLDLPFSDGRT-------TEKKEKEIPLLYFPPSGS-GGFFDSGVF 109
           + K L     ++  L+    S+  +        + + +  P+L +  +G    +FD  + 
Sbjct: 54  LAKAL---GVSVDWLVTGRESNNHSFSNVRPVDKHEIRMAPVLNYVQAGEFCEYFDDAIA 110

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
                 +    P         Y ++           SM+P +   +++++N  +Q + GD
Sbjct: 111 ------DRFE-PVSTKHPKNSYWVELN-------GLSMIPDFYPEELVLINPDMQPSPGD 156

Query: 170 RLLIKPRTGD--IVAKVLISR-----RGRSIDLMSLNCCYP 203
            ++ K + G+  +  K    R          +L+ LN  +P
Sbjct: 157 YVVAK-KAGENAVTFKKWRPRGFDDDGVEYCELVPLNPDFP 196


>gi|33592856|ref|NP_880500.1| LexA repressor [Bordetella pertussis Tohama I]
 gi|44888097|sp|Q7VRY0|LEXA_BORPE RecName: Full=LexA repressor
 gi|44888099|sp|Q7WCK0|LEXA_BORBR RecName: Full=LexA repressor
 gi|33572504|emb|CAE42080.1| LexA repressor [Bordetella pertussis Tohama I]
 gi|332382269|gb|AEE67116.1| LexA repressor [Bordetella pertussis CS]
          Length = 216

 Score = 44.9 bits (105), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 129 GIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
           G++A QT D   K +  SM      +GD+L +  A +   G  ++ +    ++  K L  
Sbjct: 118 GLFA-QTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVARLGD-EVTVKRLQR 175

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSD 211
           + GR I+L+  N  +    V  +D
Sbjct: 176 QNGR-IELLPENPDFAPIVVANTD 198


>gi|265998933|ref|ZP_06111490.1| repressor protein [Brucella ceti M490/95/1]
 gi|262553669|gb|EEZ09391.1| repressor protein [Brucella ceti M490/95/1]
          Length = 153

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 56  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 115

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 116 GQVF-LQPLNPQYP 128


>gi|256855230|ref|ZP_05560588.1| temperature-sensitive lambda-repressor [Enterococcus faecalis T8]
 gi|256709444|gb|EEU24494.1| temperature-sensitive lambda-repressor [Enterococcus faecalis T8]
          Length = 169

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 72  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 131

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 132 GQVF-LQPLNPQYP 144


>gi|218529602|ref|YP_002420418.1| phage repressor [Methylobacterium chloromethanicum CM4]
 gi|218521905|gb|ACK82490.1| putative phage repressor [Methylobacterium chloromethanicum CM4]
          Length = 244

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT------GDIVAKVLISRRGRSIDLMS 197
             S+ P Y  G  + ++   +    D ++++ R       G    K L++R    + L  
Sbjct: 155 GDSISPAYEDGTPIYVDPHRRPQPRDYVVVELRGERDGEPGPAFVKRLVARGAGKLRLEQ 214

Query: 198 LNCCYPVDTVEMSDIEWIARIL 219
            N    +D ++ +++  + R++
Sbjct: 215 HNPSGQLDPIDETEVVRVHRVI 236


>gi|291295793|ref|YP_003507191.1| putative phage repressor [Meiothermus ruber DSM 1279]
 gi|290470752|gb|ADD28171.1| putative phage repressor [Meiothermus ruber DSM 1279]
          Length = 210

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 72/209 (34%), Gaps = 31/209 (14%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST-ESIFKILAATNETICQLLDLP 76
           +   L+   +A  AG+  T      R     +    ST E +   L      +  L+ L 
Sbjct: 15  KELGLSVRKVASMAGISHTHLGNLIRGISSWKEVQFSTLERLAYALD---IPVNDLVYLV 71

Query: 77  FSDGRTTEKKEKEIPLLYFPP-----SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
                + + +E+  P+ +        + +G   D    P         + ++    + +Y
Sbjct: 72  RGKVPSLDHRERVTPVRFLIQPVRGLASAGQPVDPEGVPV--------LADVWRRGSLLY 123

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDIV-AKVLISRR 189
            ++           SM P    GD + ++ +  ++  G R+ I    GD    K +    
Sbjct: 124 RVE---------GDSMAPTLHDGDRVYVDPSETELREG-RIYICEIPGDGHTIKRVRRLD 173

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              + L+S N  Y       S++  + R+
Sbjct: 174 DGQLWLVSDNPAY--RPWRPSEMRIVGRV 200


>gi|328725290|ref|XP_003248415.1| PREDICTED: protein umuD-like [Acyrthosiphon pisum]
          Length = 140

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 19/104 (18%), Positives = 41/104 (39%), Gaps = 7/104 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V   +    ++      +     K    SM       GD+LI++SA++
Sbjct: 23  PCGFPS-PAQDYVE--QRIDLNDLCVTHPSATYFIKVSGDSMIEGGISDGDMLIVDSAVE 79

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
              GD +++    G+   K L+ +    + L  +N  + +  + 
Sbjct: 80  PEQGD-VVVAAIAGEFTVKQLMLKPC--LHLKPMNAAHAIIPIP 120


>gi|117924798|ref|YP_865415.1| phage lambda repressor protein. serine peptidase. MEROPS family S24
           [Magnetococcus sp. MC-1]
 gi|117608554|gb|ABK44009.1| phage repressor protein, Serine peptidase, MEROPS family S24
           [Magnetococcus sp. MC-1]
          Length = 220

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDIVAKVLISRRGRSIDL 195
               K Q  SM   + +GDI++++  ++      +++      D+  K L    GR   L
Sbjct: 132 SFALKVQGDSMSTEFSEGDIIVVDPEMEPKNNHYVVVFLPMENDVTFKQLAVDGGRRY-L 190

Query: 196 MSLNCCYP 203
             +N  YP
Sbjct: 191 KPVNPRYP 198


>gi|224825376|ref|ZP_03698481.1| peptidase S24 and S26 domain protein [Lutiella nitroferrum 2002]
 gi|224602297|gb|EEG08475.1| peptidase S24 and S26 domain protein [Lutiella nitroferrum 2002]
          Length = 192

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 31/79 (39%), Gaps = 3/79 (3%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                    +  SM+      GD+L+++ +++   G ++++    G++  K L  +    
Sbjct: 100 PASSFLVTVKGDSMINAGIHDGDMLVVDKSLEARHG-KVVVAVINGELTVKRL-EKTATG 157

Query: 193 IDLMSLNCCYPVDTVEMSD 211
           + L+  N  +    V    
Sbjct: 158 LRLLPENPDFAPIEVPEEA 176


>gi|228909524|ref|ZP_04073348.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 200]
 gi|228850115|gb|EEM94945.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 200]
          Length = 223

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 78/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 13  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLER 68

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L   +  T              +     IP++    +G+  F +  +           +P
Sbjct: 69  LATQEDNTVKEEVSIYETIQKDQSNIIHIPIIGSVAAGTPIFAEENI--------EGYLP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 121 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 176

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L  +  +   T  +   D++ I R++ A
Sbjct: 177 VKKIS-KSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|229151903|ref|ZP_04280100.1| Phage transcriptional repressor [Bacillus cereus m1550]
 gi|229191824|ref|ZP_04318797.1| Phage transcriptional repressor [Bacillus cereus ATCC 10876]
 gi|228591648|gb|EEK49494.1| Phage transcriptional repressor [Bacillus cereus ATCC 10876]
 gi|228631559|gb|EEK88191.1| Phage transcriptional repressor [Bacillus cereus m1550]
          Length = 223

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 78/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 13  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLER 68

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L   +  T              +     IP++    +G+  F +  +           +P
Sbjct: 69  LATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENI--------EGYLP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 121 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 176

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L  +  +   T  +   D++ I R++ A
Sbjct: 177 VKKIS-KSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|329122774|ref|ZP_08251346.1| transcriptional regulatory protein [Haemophilus aegyptius ATCC
           11116]
 gi|327472038|gb|EGF17476.1| transcriptional regulatory protein [Haemophilus aegyptius ATCC
           11116]
          Length = 234

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 63/188 (33%), Gaps = 40/188 (21%)

Query: 51  RW------PSTESIFKILAATNETICQLL-DLPFSDGRTTEKKEKEIPLLYFPP------ 97
           RW      PS  ++ KI  A   ++  L   +   DG   + K+ E+ L+          
Sbjct: 43  RWVKGEADPSRTNLIKITEAGGVSLDWLALGVGNMDGVEPQAKKSEVNLIASNDETFSVI 102

Query: 98  ---------SGSGGFFDSGVFP-----TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
                    +G GGF D    P         W  +    +++    ++            
Sbjct: 103 EDCREVRISAGGGGFNDEY-KPYQTTKVEKAW--LDSRRLKAEDCAMF---------LVS 150

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM P  + G+ +I++ + +     ++ +    G ++ K +       I L+S N  Y 
Sbjct: 151 GDSMYPTLKDGEEIIVDRSKKELKDGKIFVLNNEGAMLVKKVQ-ITYNGITLISQNTEYA 209

Query: 204 VDTVEMSD 211
              +    
Sbjct: 210 PIELNAEQ 217


>gi|46201984|ref|ZP_00054008.2| COG2932: Predicted transcriptional regulator [Magnetospirillum
           magnetotacticum MS-1]
          Length = 230

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/108 (18%), Positives = 41/108 (37%), Gaps = 4/108 (3%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           T   P+    +    A  +          SM PL   GD ++++++ +V     + +   
Sbjct: 120 TWLFPDAVVRYE-FRAQPSDLRMITITGDSMEPLLSSGDRILIDTSQKVPVPPGIFVIWD 178

Query: 177 TGDIVAKVLISRR---GRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
              +V K +         ++ + S+N  Y        +I  I R++WA
Sbjct: 179 GMGLVTKRIEHIPHSDPPTVVIRSINPEYQTYERTADEINIIGRVIWA 226


>gi|257463340|ref|ZP_05627736.1| putative prophage repressor [Fusobacterium sp. D12]
 gi|317060917|ref|ZP_07925402.1| SOS-response transcriptional repressor [Fusobacterium sp. D12]
 gi|313686593|gb|EFS23428.1| SOS-response transcriptional repressor [Fusobacterium sp. D12]
          Length = 198

 Score = 44.9 bits (105), Expect = 0.008,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 65/166 (39%), Gaps = 22/166 (13%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           E + +IL A N +  +   L          ++ +IP++    +G+G   +  +       
Sbjct: 46  EKLAEILEALNSSFNEFFSLKE-----LCTEDIKIPIVSKVSAGTGLLVEENIV------ 94

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + + +P+  S           D     +  SM P  + GDI ++    ++  G+ ++I  
Sbjct: 95  DYLPIPKELSNKC--------DFATFVEGNSMFPDVKNGDIALVKMDCEIESGN-IVIFS 145

Query: 176 RTGDIVAKVLISRR-GRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
             G+   K          I  +S N  Y   +V E  +++ I R++
Sbjct: 146 LNGNSYIKKYHYNPFSNKITFISSNKEYENISVMEGDELKVIGRVI 191


>gi|227111912|ref|ZP_03825568.1| DNA polymerase V subunit UmuD [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 139

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 38/100 (38%), Gaps = 7/100 (7%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V   +    +       +     +    SM       GD+++++SA+Q
Sbjct: 23  PAGFPSPAN-DYVE--QRIDLNTLCVRHPSATYFVRVSGQSMVEGGIHDGDLVVVDSALQ 79

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
              GD ++I    G+   K L     R+  L+ +N  Y  
Sbjct: 80  ARHGD-IIIAALDGEFTIKQLQLTPTRA--LVPMNAAYAP 116


>gi|193066523|ref|ZP_03047566.1| CI protein [Escherichia coli E22]
 gi|192925845|gb|EDV80496.1| CI protein [Escherichia coli E22]
          Length = 217

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 120 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVELGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 180 GQVF-LQPLNPQYP 192


>gi|325961650|ref|YP_004239556.1| SOS response UmuD protein [Arthrobacter phenanthrenivorans Sphe3]
 gi|323467737|gb|ADX71422.1| SOS response UmuD protein [Arthrobacter phenanthrenivorans Sphe3]
          Length = 128

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 35/105 (33%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  FP+               +  +    T     +    SM       GD LI+N A++
Sbjct: 12  AAGFPSPA---QDYFDGRIDLNAHLIKDITSTFVVRVTGDSMEGAGISDGDELIVNRALE 68

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G  ++I    G++  K L       + L + N  YP   V  
Sbjct: 69  PKDGS-VVIAVLDGELTVKRL-RLTAAGVVLQAENPKYPDIRVPA 111


>gi|289165190|ref|YP_003455328.1| phage repressor [Legionella longbeachae NSW150]
 gi|288858363|emb|CBJ12231.1| phage repressor [Legionella longbeachae NSW150]
          Length = 223

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 63/165 (38%), Gaps = 7/165 (4%)

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKE-KEIPLLYFPPSGSGGFFDSGVF 109
           R P  E I ++  A + +   L+ L        ++     IPLL F  +     F   + 
Sbjct: 45  RTPGPEEIKQLAQALDVSPAYLMCLTDEKQPKKKQGLNALIPLLNFQQACEAKLF---IQ 101

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
              N  N   V  I         ++      K  D SM P  R  DILI+N   +++ G+
Sbjct: 102 RLKNNQNEQEVRYIPVTAEFNAKLEEYSFALKMNDESMHPELRLNDILIINPIAKLHPGN 161

Query: 170 RLLIKPRTGDIV--AKVLI-SRRGRSIDLMSLNCCYPVDTVEMSD 211
            + ++     I+   K L  S+   S +L + N  +    ++ + 
Sbjct: 162 LVAVQLEDQVIIRRYKQLTFSKNNNSFELKAENDHWGNIIIDKTS 206


>gi|253730853|ref|ZP_04865018.1| possible heat-sensitive lambda citS857 repressor protein/VP16
           fusion protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253725410|gb|EES94139.1| possible heat-sensitive lambda citS857 repressor protein/VP16
           fusion protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 150

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 53  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 112

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 113 GQVF-LQPLNPQYP 125


>gi|187925688|ref|YP_001897330.1| LexA repressor [Burkholderia phytofirmans PsJN]
 gi|187716882|gb|ACD18106.1| LexA repressor [Burkholderia phytofirmans PsJN]
          Length = 199

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 47/134 (35%), Gaps = 17/134 (12%)

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           ST SIF ++     +    L+        T +     P+L    +G          P G 
Sbjct: 42  STSSIFALIK--RLSEAGFLERVEGRIAPTRRFFGR-PVLGAVRAGQPQ-------PEGQ 91

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                  PE+ +  + +     +    + +  SM  +    GD++++        GD ++
Sbjct: 92  -----EPPELLTIDDYLVDDPNRTVLCRVRGESMRDVGLLDGDLVVVEKNRPTRPGD-IV 145

Query: 173 IKPRTGDIVAKVLI 186
           +    G++  K L 
Sbjct: 146 VAVVDGEMTVKTLR 159


>gi|323967257|gb|EGB62681.1| peptidase S24 [Escherichia coli M863]
          Length = 217

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 121 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 180

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 181 QVF-LQPLNPQYP 192


>gi|331669090|ref|ZP_08369938.1| repressor protein CI [Escherichia coli TA271]
 gi|331064284|gb|EGI36195.1| repressor protein CI [Escherichia coli TA271]
          Length = 244

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 148 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 207

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 208 QVF-LQPLNPQYP 219


>gi|281599669|gb|ADA72653.1| CI protein [Shigella flexneri 2002017]
          Length = 231

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 135 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 194

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 195 QVF-LQPLNPQYP 206


>gi|260868710|ref|YP_003235112.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
 gi|257765066|dbj|BAI36561.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
          Length = 207

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 111 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 170

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 171 QVF-LQPLNPQYP 182


>gi|226940913|ref|YP_002795987.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
 gi|226715840|gb|ACO74978.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
          Length = 262

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
              +  SM  +    D++++N A      D L +    GD+V K L  + G  I ++S N
Sbjct: 174 LSVKGDSMEGVLNDRDVILINHADNAPK-DGLYVLRIDGDLVVKRLQRKPGGKIGIISAN 232

Query: 200 CCYPVDTVEMSDI----EWIARILW 220
             Y    ++++D+      + R++W
Sbjct: 233 EAYAPYDIDLNDLPNDFAIVGRVVW 257


>gi|95930066|ref|ZP_01312805.1| putative phage repressor [Desulfuromonas acetoxidans DSM 684]
 gi|95133760|gb|EAT15420.1| putative phage repressor [Desulfuromonas acetoxidans DSM 684]
          Length = 230

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 32/84 (38%), Gaps = 3/84 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC 200
           +    SM P +  G +++++        D +    +   ++ + L       + + + N 
Sbjct: 143 RVTGDSMAPTFAAGSLVLVDMNQPDLSADAIFALRQDEKVIVRRLQKMVNGDVHVKTDNP 202

Query: 201 CYPVDTVEMSD---IEWIARILWA 221
            Y    V       ++ + R++WA
Sbjct: 203 RYEDQIVRSESLPILDIVGRVVWA 226


>gi|2688954|gb|AAC82517.1| MucA [IncL/M plasmid R446b]
          Length = 144

 Score = 44.9 bits (105), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 38/115 (33%), Gaps = 12/115 (10%)

Query: 103 FFDS---GVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDIL 157
           FF       FP+    +    +    + H+            +    SM       GD+L
Sbjct: 19  FFAEPVAAGFPSPAAGYEANEL----NLHDYCVRRPAATYFLRVSGDSMRDARIHDGDVL 74

Query: 158 ILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +++ A +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 75  VVDRAEEPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|315499847|ref|YP_004088650.1| transcriptional repressor, lexa family [Asticcacaulis excentricus
           CB 48]
 gi|315417859|gb|ADU14499.1| transcriptional repressor, LexA family [Asticcacaulis excentricus
           CB 48]
          Length = 235

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 51/141 (36%), Gaps = 15/141 (10%)

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
             P    +    + +E+PLL    +G        +   G + + + VPEI       Y +
Sbjct: 96  AAPVPASKPANDEGRELPLLGKIAAGV------PIEALGAERDRIRVPEIFVGSGEHYLL 149

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           +        +  SM+      GD +I+  +     G  +++    GD      + ++G S
Sbjct: 150 E-------IEGDSMINAGILDGDYVIIKKSDSAQSG-EIVVALVDGDTATLKRLRKKGAS 201

Query: 193 IDLMSLNCCYPVDTVEMSDIE 213
           I L + N  Y        ++ 
Sbjct: 202 IALEAANPAYKTRIYNADEVA 222


>gi|148261865|ref|YP_001235992.1| LexA repressor [Acidiphilium cryptum JF-5]
 gi|326405370|ref|YP_004285452.1| LexA repressor [Acidiphilium multivorum AIU301]
 gi|166224548|sp|A5G2J1|LEXA_ACICJ RecName: Full=LexA repressor
 gi|146403546|gb|ABQ32073.1| SOS-response transcriptional repressor, LexA [Acidiphilium cryptum
           JF-5]
 gi|325052232|dbj|BAJ82570.1| LexA repressor [Acidiphilium multivorum AIU301]
          Length = 231

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 39/151 (25%), Gaps = 15/151 (9%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
                               +PL     +G        +         + +P        
Sbjct: 89  GDFTARLQGARAADPAAAITLPLYGRIAAGQ------PIEALREHQAEIEIPASLVGPGE 142

Query: 130 IYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            YA++           SM+      GD  I+        G  ++      ++  K L  R
Sbjct: 143 HYALE-------VAGDSMVDAGILDGDTAIIRRGETAETGQIVVALIDDVEVTLKRLRRR 195

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G S  L   N  Y +       ++   R++
Sbjct: 196 -GNSTALEPANPRYEIRIFPAERVKVQGRLV 225


>gi|229844288|ref|ZP_04464428.1| putative phage repressor [Haemophilus influenzae 6P18H1]
 gi|229812537|gb|EEP48226.1| putative phage repressor [Haemophilus influenzae 6P18H1]
          Length = 234

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 64/188 (34%), Gaps = 40/188 (21%)

Query: 51  RW------PSTESIFKILAATNETICQLL-DLPFSDGRTTEKKEKEIPLLYFPP------ 97
           RW      PS  ++ KI  A   ++  L   +   DG   + K+ E+ L+          
Sbjct: 43  RWVKGEADPSRTNLIKITEAGGVSLDWLALGVGNMDGVEPQAKKSEVNLIASNDETFSVI 102

Query: 98  ---------SGSGGFFDSGVFP-----TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
                    +G GGF D    P         W  +    +++    ++            
Sbjct: 103 EDCREVRISAGGGGFNDEY-KPYQTTKVEKAW--LDSRRLKAEDCAMF---------LVS 150

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM P  + G+ +I++ + +     ++ +    G ++ K +       I L+S N  Y 
Sbjct: 151 GDSMYPTLKDGEEIIVDRSKKELKDGKIFVLNNEGAMLVKKVQ-ITYNGITLISQNTEYT 209

Query: 204 VDTVEMSD 211
              ++   
Sbjct: 210 PIELDAEQ 217


>gi|134295441|ref|YP_001119176.1| putative phage repressor [Burkholderia vietnamiensis G4]
 gi|134138598|gb|ABO54341.1| putative phage repressor [Burkholderia vietnamiensis G4]
          Length = 254

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 30/197 (15%), Positives = 63/197 (31%), Gaps = 33/197 (16%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT- 111
           P  E I  +  A    +   +    +   T+      +P      + +    D+   P  
Sbjct: 59  PPFEVIANLARAAGAGLD-WVAFGDTVPPTSGGNASTLP---GAAAQAVEVRDTLGNPVD 114

Query: 112 ----------------GNKW---NTVGVPEIRSP----HNGIYAIQTQDTRHKTQDTSML 148
                           G+     +      +        N ++A  T  +    +  S+ 
Sbjct: 115 VSEFVFIPRYNVKAAAGHGQAVTDEAPKHTMAFRRYWIENYLHACPTDLSVLSVKGDSLQ 174

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV- 207
            +    D+++++ +         +++   GD++ K L    G  + + S N  Y    V 
Sbjct: 175 GILNDRDVILIDRSQTTGSAGLYVLRI-DGDVIVKTLQRLPGGILKVSSANTAYEPFEVN 233

Query: 208 ---EMSDIEWIARILWA 221
                SD E I R++WA
Sbjct: 234 MAQPPSDFEIIGRVVWA 250


>gi|319763314|ref|YP_004127251.1| lexa repressor [Alicycliphilus denitrificans BC]
 gi|330825509|ref|YP_004388812.1| SOS-response transcriptional repressor, LexA [Alicycliphilus
           denitrificans K601]
 gi|317117875|gb|ADV00364.1| LexA repressor [Alicycliphilus denitrificans BC]
 gi|329310881|gb|AEB85296.1| SOS-response transcriptional repressor, LexA [Alicycliphilus
           denitrificans K601]
          Length = 224

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 153 KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD+L + +  +   G  ++ +    D+  K L  R G +I+L+  N  YPV  VE  +
Sbjct: 150 DGDLLAVQATREARSGQIIVARLGD-DVTVKRL-RRTGSAIELLPENPDYPVIRVEPGE 206


>gi|323177107|gb|EFZ62697.1| repressor protein CI [Escherichia coli 1180]
          Length = 217

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 121 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 180

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 181 QVF-LQPLNPQYP 192


>gi|257874654|ref|ZP_05654307.1| lambda repressor [Enterococcus casseliflavus EC10]
 gi|257808818|gb|EEV37640.1| lambda repressor [Enterococcus casseliflavus EC10]
          Length = 149

 Score = 44.5 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 52  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 111

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 112 GQVF-LQPLNPQYP 124


>gi|260557490|ref|ZP_05829705.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
 gi|260409116|gb|EEX02419.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
          Length = 225

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 51/133 (38%), Gaps = 19/133 (14%)

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
           + + +P++ +  +GS   F        +      +P  R      YA+       K    
Sbjct: 89  EGRRVPVISWVAAGS---FTPIETVLKDTEIEEYLPPNRRCGKNGYAL-------KVVGY 138

Query: 146 SMLPLYRKGDILILNSAIQ---VNCGDRLLI-KPRTGDIVAKVLI---SRRGRSIDLMSL 198
           SM P +  GD + +N  IQ   +   D +++      +   K LI       + ++   L
Sbjct: 139 SMAPTFLPGDRIYVNPDIQTFDLKTDDLVIVACAGDSEATFKKLIIEGEGTSKFLE--PL 196

Query: 199 NCCYPVDTVEMSD 211
           N  +P   +++S+
Sbjct: 197 NPDWPDKIIKLSE 209


>gi|9955121|pdb|1F39|A Chain A, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain
 gi|9955122|pdb|1F39|B Chain B, Crystal Structure Of The Lambda Repressor C-Terminal
           Domain
          Length = 101

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 28/75 (37%), Gaps = 7/75 (9%)

Query: 135 TQDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                 + +  SM       P +  G +++++    V  GD  + +    +   K LI  
Sbjct: 3   ASAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRD 62

Query: 189 RGRSIDLMSLNCCYP 203
            G+   L  LN  YP
Sbjct: 63  SGQVF-LQPLNPQYP 76


>gi|292488579|ref|YP_003531463.1| Error-prone repair, SOS-response transcriptional repressor [Erwinia
           amylovora CFBP1430]
 gi|292899749|ref|YP_003539118.1| protein UmuD [Erwinia amylovora ATCC 49946]
 gi|291199597|emb|CBJ46714.1| protein UmuD [Erwinia amylovora ATCC 49946]
 gi|291554010|emb|CBA21063.1| Error-prone repair, SOS-response transcriptional repressor [Erwinia
           amylovora CFBP1430]
 gi|312172726|emb|CBX80982.1| Error-prone repair, SOS-response transcriptional repressor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 139

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 37/107 (34%), Gaps = 7/107 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
              FP+    + V   +    +       +     K    SM       GD+LI++ ++ 
Sbjct: 23  PCGFPS-PAQDYVE--DRIDLNKLAIKHPSATYFIKVSGDSMCEAGIGDGDLLIVDRSLN 79

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              GD +++    G+   K L  R    + L+  N  Y   +    +
Sbjct: 80  AVHGD-IVVAAIAGEFTVKEL--RTHPFLQLVPHNPHYSPISFRNEE 123


>gi|238801225|gb|ACR56332.1| MucA [Enterobacter cloacae]
          Length = 136

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 38/115 (33%), Gaps = 12/115 (10%)

Query: 103 FFDS---GVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDIL 157
           FF       FP+    +    +    + H+            +    SM       GD+L
Sbjct: 19  FFAEPVAAGFPSPAAGYEANEL----NLHDYCVRRPAATYFLRVSGDSMRDARIHDGDVL 74

Query: 158 ILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +++ A +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 75  VVDRAEEPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|27261132|gb|AAN86071.1| heat-sensitive lambda citS857 repressor protein/VP16 fusion protein
           [synthetic construct]
          Length = 367

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 140 SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 199

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 200 GQVF-LQPLNPQYP 212


>gi|89054365|ref|YP_509816.1| LexA repressor [Jannaschia sp. CCS1]
 gi|122999507|sp|Q28R71|LEXA_JANSC RecName: Full=LexA repressor
 gi|88863914|gb|ABD54791.1| SOS-response transcriptional repressor, LexA [Jannaschia sp. CCS1]
          Length = 228

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 47/139 (33%), Gaps = 16/139 (11%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE-IRSPHNGIYAIQ 134
           P +         +E+P++    +G        +       + V VPE +       YA++
Sbjct: 91  PANAMAVRAAPAREVPVMGQIAAGV------PIEAISQVASHVAVPEQMLGAGGNHYALE 144

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                   +  SM+      GDI+++      + GD ++      +   K L  + G  I
Sbjct: 145 -------VKGDSMIDAGINDGDIVVIEEGNTADNGDIVVALVEDHEATLKRLRRK-GGMI 196

Query: 194 DLMSLNCCYPVDTVEMSDI 212
            L + N  Y         +
Sbjct: 197 ALEAANPAYETRVFRDDQV 215


>gi|27383436|ref|NP_774966.1| MucA [Citrobacter freundii]
 gi|216967817|ref|YP_002333325.1| MucA [Klebsiella pneumoniae]
 gi|27261289|gb|AAN87630.1| MucA [Citrobacter freundii]
 gi|215397989|gb|ACJ65266.1| MucA [Klebsiella pneumoniae]
 gi|323700911|gb|ADY00064.1| translesion synthesis protein A [Escherichia coli]
          Length = 144

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 38/115 (33%), Gaps = 12/115 (10%)

Query: 103 FFDS---GVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDIL 157
           FF       FP+    +    +    + H+            +    SM       GD+L
Sbjct: 19  FFAEPVAAGFPSPAAGYEANEL----NLHDYCVRRPAATYFLRVSGDSMRDARIHDGDVL 74

Query: 158 ILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +++ A +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 75  VVDRAEEPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|288575295|ref|ZP_05976691.2| putative phage repressor [Neisseria mucosa ATCC 25996]
 gi|288568389|gb|EFC89949.1| putative phage repressor [Neisseria mucosa ATCC 25996]
          Length = 239

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 58/166 (34%), Gaps = 25/166 (15%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           E   K L      +  L++               IPLL    +     F+         W
Sbjct: 73  ELYAKALRCRPADL--LVEETQVSEPPLPLGFIRIPLLDAIQA-----FN---------W 116

Query: 116 NTVGVP----EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           + +       +I         I T     K  D SM+P +++G+++I++  +    GD +
Sbjct: 117 DKLKSHTGELDISDWLISSADISTDSFGFKIMDFSMMPEFKQGELVIIDPELTPEAGDIV 176

Query: 172 LIKPRTGDIVAKVLISRRGR-----SIDLMSLNCCYPVDTVEMSDI 212
           L+     D++ +    R          +L  LN  + + +   S++
Sbjct: 177 LVATVNRDVLLRKYKQRGISDDGSFIYELHPLNDDFEILSSTSSEL 222


>gi|119383726|ref|YP_914782.1| putative phage repressor [Paracoccus denitrificans PD1222]
 gi|119373493|gb|ABL69086.1| putative phage repressor [Paracoccus denitrificans PD1222]
          Length = 203

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 45/126 (35%), Gaps = 26/126 (20%)

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDT-------RHKTQDTSMLPLYRKGDILI----- 158
            G     V + +  +   G+Y +   D          +    SM PL   GDI+      
Sbjct: 72  VGAGNTVVELVDAYAKGGGLYHVAAPDDLPSSGIVAVEVAGDSMSPLIEPGDIVFFTRHF 131

Query: 159 --LNSAIQVNCGDRLLIKPRTGDIVAKVLIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
             ++ A     G   + +   G  + K +   R   + DL S+N  +P         E+ 
Sbjct: 132 VGIDPAA---IGHVSICQTDDGRALIKQIRRGREEGTFDLYSVNSAHPP--------EYG 180

Query: 216 ARILWA 221
            R++WA
Sbjct: 181 VRLVWA 186


>gi|296136472|ref|YP_003643714.1| putative phage repressor [Thiomonas intermedia K12]
 gi|295796594|gb|ADG31384.1| putative phage repressor [Thiomonas intermedia K12]
          Length = 224

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 73/234 (31%), Gaps = 31/234 (13%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             + K++  AI+    +  ++   LAR   + P S    + +   GR        + K  
Sbjct: 1   MLTGKELGAAIEAARLKKGVSKVTLARAMEIKPPSV---QDWIHHGR--------VAK-- 47

Query: 63  AATNETICQLLDLPFS------------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           +          D+                          +P      +   G +      
Sbjct: 48  SRLGALFQYFSDVVGPEHWGVREEWGYNPSLRIVDGMVTLPQYDLKAAAGPGRYLEAQLR 107

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G       +      ++G+ A+ T          SM P    GDI++++ +++    D 
Sbjct: 108 VGAVQVCQDIVARILRNSGV-AL-TSLALVTVAGDSMEPTINDGDIVVIDRSVETIDRDG 165

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RILWA 221
           + +     +   K +     +S+ + S N  Y    +   +   +    R++WA
Sbjct: 166 VYLFTFGDETFIKRIQRM-PKSLSVNSDNGLYKGWEISSEETSSLHVHGRVIWA 218


>gi|224438775|ref|ZP_03659638.1| Repressor protein CI from prophage [Helicobacter cinaedi CCUG
           18818]
          Length = 108

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%), Gaps = 7/74 (9%)

Query: 136 QDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                + +  SM       P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 11  SAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 70

Query: 190 GRSIDLMSLNCCYP 203
           G+   L  LN  YP
Sbjct: 71  GQVF-LQPLNPQYP 83


>gi|212710117|ref|ZP_03318245.1| hypothetical protein PROVALCAL_01170 [Providencia alcalifaciens DSM
           30120]
 gi|212687324|gb|EEB46852.1| hypothetical protein PROVALCAL_01170 [Providencia alcalifaciens DSM
           30120]
          Length = 214

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 62/184 (33%), Gaps = 14/184 (7%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGI-EGRNRWPSTESIFKILAATNETICQLLDLP 76
           E   L+ + LA+  G    S     R G  E   R  S +    I  A   +  +   L 
Sbjct: 17  ESRGLSQAQLAKLCGYSAAS-----RIGNYELGERKISADDALVISEALGVSPAE---LM 68

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
           F           E PLL    +G+   F         K     +P  +      + ++ +
Sbjct: 69  FGTQSDQVISNYEYPLLTKIQAGA---FTENSNSYTEKDAIAWIPTAKKASERAFWLEVE 125

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
                       P + +G +++++    VN GD  + +    +   K LI   G++  L 
Sbjct: 126 GHSMTAAQGG-KPSFPEGMLILIDPKEPVNVGDFCIARLNGNEFTFKKLIRESGQTF-LE 183

Query: 197 SLNC 200
            LN 
Sbjct: 184 PLNP 187


>gi|168260980|ref|ZP_02682953.1| CI protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|307311055|ref|ZP_07590699.1| transcriptional regulator, XRE family [Escherichia coli W]
 gi|205349860|gb|EDZ36491.1| CI protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|306908561|gb|EFN39058.1| transcriptional regulator, XRE family [Escherichia coli W]
 gi|315061677|gb|ADT76004.1| putative CI repressor [Escherichia coli W]
 gi|323377741|gb|ADX50009.1| phage repressor like transcriptional regulator, XRE family
           [Escherichia coli KO11]
          Length = 217

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 28/73 (38%), Gaps = 7/73 (9%)

Query: 137 DTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
               + +  SM       P +  G +++++    V  GD  + +    +   K LI   G
Sbjct: 121 AFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSG 180

Query: 191 RSIDLMSLNCCYP 203
           +   L  LN  YP
Sbjct: 181 QVF-LQPLNPQYP 192


>gi|254486471|ref|ZP_05099676.1| LexA repressor [Roseobacter sp. GAI101]
 gi|214043340|gb|EEB83978.1| LexA repressor [Roseobacter sp. GAI101]
          Length = 239

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            +    + +  SM+      GD++++      + GD ++      +   K      G SI
Sbjct: 149 GEHYALEVKGDSMIDAGINDGDVVVIRETSVADNGDIVVALVEDHEATLKTFKRH-GSSI 207

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L + N  Y    +    ++   R++
Sbjct: 208 ALEAANPAYETRVLPADKVKVQGRLV 233


>gi|75761233|ref|ZP_00741217.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218898797|ref|YP_002447208.1| LexA repressor [Bacillus cereus G9842]
 gi|228902202|ref|ZP_04066364.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 4222]
 gi|74491268|gb|EAO54500.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218540796|gb|ACK93190.1| LexA repressor [Bacillus cereus G9842]
 gi|228857437|gb|EEN01935.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 4222]
          Length = 239

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 78/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 29  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLEK 84

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L   +  T              +     IP++    +G+  F +  +           +P
Sbjct: 85  LATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENI--------EGYLP 136

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 137 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 192

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L  +  +   T  +   D++ I R++ A
Sbjct: 193 VKKIS-KSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 235


>gi|283769265|ref|ZP_06342169.1| peptidase S24-like domain protein [Bulleidia extructa W1219]
 gi|283104241|gb|EFC05620.1| peptidase S24-like domain protein [Bulleidia extructa W1219]
          Length = 275

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 49/149 (32%), Gaps = 30/149 (20%)

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG----VPEI 123
           +I   L        +T     +IP+L   P G          P     + +     VP  
Sbjct: 135 SIDVFLK------NSTNNFIHQIPVLGVVPCGE---------PIEAIEDIIEWVDVVPSQ 179

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H G+ A          +  SM P    GDILI+    +VN G   ++K    D   K
Sbjct: 180 TKDHFGLIA----------KGNSMSPYILDGDILIVKYTPEVNSGKIAIVKVNGDDATCK 229

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
            L+      I L+  N  Y        ++
Sbjct: 230 RLMINDAG-ITLIPNNPLYKTKIFTPQEV 257


>gi|302127790|emb|CBO78204.1| MucA protein [Salmonella enterica subsp. enterica serovar
           Enteritidis]
          Length = 144

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 37/109 (33%), Gaps = 9/109 (8%)

Query: 106 SGVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAI 163
           +  FP+    +    +    + H+            +    SM       GD+L+++ A 
Sbjct: 25  AAGFPSPAAGYEANEL----NLHDYCVRRPAATYFLRVSGDSMRDARIHDGDVLVVDRAE 80

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 81  EPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|212219013|ref|YP_002305800.1| repressor protein C2 [Coxiella burnetii CbuK_Q154]
 gi|212013275|gb|ACJ20655.1| repressor protein C2 [Coxiella burnetii CbuK_Q154]
          Length = 238

 Score = 44.5 bits (104), Expect = 0.010,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 37/103 (35%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 120 WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 178

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V +
Sbjct: 179 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAL 218


>gi|209363835|ref|YP_001423989.2| repressor protein C2 [Coxiella burnetii Dugway 5J108-111]
 gi|207081768|gb|ABS77587.2| repressor protein C2 [Coxiella burnetii Dugway 5J108-111]
          Length = 238

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 36/103 (34%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 120 WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 178

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V  
Sbjct: 179 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAR 218


>gi|163746569|ref|ZP_02153927.1| LexA repressor [Oceanibulbus indolifex HEL-45]
 gi|161380454|gb|EDQ04865.1| LexA repressor [Oceanibulbus indolifex HEL-45]
          Length = 231

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 35/94 (37%), Gaps = 2/94 (2%)

Query: 127 HNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
             G+ A Q +    + +  SM       GDI+++      + GD ++      +   K  
Sbjct: 133 PGGMIAGQGEHYALEVRGDSMIEAGINDGDIVVIRETSVADNGDIVVALVEDQEATLKRF 192

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   S+ L + N  Y    +    ++   R++
Sbjct: 193 RRQGA-SVALEAANAAYETRVLPSDKVKVQGRLV 225


>gi|254224901|ref|ZP_04918516.1| transciptional regulator [Vibrio cholerae V51]
 gi|125622589|gb|EAZ50908.1| transciptional regulator [Vibrio cholerae V51]
          Length = 264

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 68/227 (29%), Gaps = 44/227 (19%)

Query: 27  LARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT--------NETICQLLDLPFS 78
           +A+K G+ P +   SK    E   R    E I   L  +         E+  ++ + P +
Sbjct: 48  IAKKIGVTPKAV--SKWLNAESMPRQNKMEEIANFLGVSLFWLQYGKQESFSEVKEKPNA 105

Query: 79  ----------DGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEIRSPH 127
                             E  +P L      +G GF +      G     +   +     
Sbjct: 106 YMLGEMQEWDSSTPLGDDEVMVPFLSDVRLSAGNGFLNEEELDNGF---KLRFAKSTLRR 162

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL------IKPRTGDIV 181
            G+ A             SM P+   G  +       +N  DR L           G++ 
Sbjct: 163 YGVCA--KDAVCVSVSGNSMEPVLPDGSTV------GINRADRTLSDGKIYAINHNGELF 214

Query: 182 AKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIE-----WIARILWAS 222
            K L    G  + + S N   YP      + +       I R+ W S
Sbjct: 215 IKRLYKLPGGGVRIYSFNEIEYPPREYTEAQVVEQKISIIGRVFWYS 261


>gi|296535264|ref|ZP_06897472.1| repressor lexA [Roseomonas cervicalis ATCC 49957]
 gi|296264404|gb|EFH10821.1| repressor lexA [Roseomonas cervicalis ATCC 49957]
          Length = 245

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 39/118 (33%), Gaps = 12/118 (10%)

Query: 106 SGVFPTGNKWNT---VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNS 161
           +   P     +    V VP         YA++           SM+ +    GD +I+  
Sbjct: 130 AAGLPIEALRDQGASVEVPMALLGQGDHYALE-------VAGDSMIGMGILDGDTVIIRR 182

Query: 162 AIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 G  ++      ++  K L  + G SI L + N  Y         ++   R++
Sbjct: 183 GDTAENGSVVVALVDENEVTLKRLRRK-GNSIALEAANPQYETRIFGPDRVKVQGRLV 239


>gi|145632024|ref|ZP_01787771.1| putative phage repressor [Haemophilus influenzae R3021]
 gi|144982313|gb|EDJ89907.1| putative phage repressor [Haemophilus influenzae R3021]
          Length = 184

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 52/147 (35%), Gaps = 20/147 (13%)

Query: 82  TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHK 141
                  +IPL+ +  +G      S     G+ ++ V   ++       +A+        
Sbjct: 43  PASIGGNKIPLISYIQAGKWSGISSLKESCGD-FDYV-FTDL-DVSENAFAL-------S 92

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK-----VLISRRGRSIDLM 196
               SM P +++ D++I++  +Q   G+ ++      +   K      +        +L+
Sbjct: 93  IIGDSMEPEFKEEDVIIIDPQVQPVAGEFVVAINGDYEATFKKYRPLEIDEYGRTQFELI 152

Query: 197 SLNCCYPVDTVEMSDIEWI-----ARI 218
            LN  YP  +     I  I      RI
Sbjct: 153 PLNSDYPKMSSLKQQISIIGTMVEHRI 179


>gi|38638093|ref|NP_943203.1| translesion synthesis protein [Erwinia amylovora]
 gi|37681991|gb|AAQ97878.1| MucA [Erwinia amylovora]
          Length = 144

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 37/109 (33%), Gaps = 9/109 (8%)

Query: 106 SGVFPT-GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAI 163
           +  FP+    +    +    + H+            +    SM       GD+L+++ A 
Sbjct: 25  AAGFPSPAAGYEANEL----NLHDYCVRRPAATYFLRVSGDSMRDARIHDGDVLVVDRAE 80

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
           +   G  ++I     +   K L  R      LM LN  +P    +   +
Sbjct: 81  EPRHGS-IVIASIDNEFTVKQLQLRPYPC--LMPLNPAFPPIRFDPEAL 126


>gi|212212220|ref|YP_002303156.1| repressor protein C2 [Coxiella burnetii CbuG_Q212]
 gi|212010630|gb|ACJ18011.1| repressor protein C2 [Coxiella burnetii CbuG_Q212]
          Length = 237

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 36/103 (34%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 119 WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 177

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V  
Sbjct: 178 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAR 217


>gi|215919180|ref|NP_820400.2| S24 family peptidase [Coxiella burnetii RSA 493]
 gi|206584064|gb|AAO90914.2| repressor protein C2 [Coxiella burnetii RSA 493]
          Length = 238

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 36/103 (34%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 120 WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 178

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V  
Sbjct: 179 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAR 218


>gi|291326325|ref|ZP_06124059.2| peptidase, S24 family [Providencia rettgeri DSM 1131]
 gi|291314825|gb|EFE55278.1| peptidase, S24 family [Providencia rettgeri DSM 1131]
          Length = 229

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 46/252 (18%), Positives = 84/252 (33%), Gaps = 74/252 (29%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTE-------S 57
           H++I +A  R+A++  +T + LA++ G              +   +W  STE        
Sbjct: 5   HERIKQA--RLAKK--MTQAELAQQLG-----------VTPQSVQQWETSTEPRKNRVMK 49

Query: 58  IFKILAAT------------NETICQLLDL---------PFSDGRTTEKKEKEIPLLYFP 96
           I +IL+                                 P +D        K I L    
Sbjct: 50  IAEILSVDAEWLLFGTAKKDGVPAKDFKSREVDTWDSKTPLNDDEVEIPYYKSIELA--A 107

Query: 97  PSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDI 156
            +GS G  D+  +        +   +      GI A             SM P+   G  
Sbjct: 108 GNGSNGGSDNNGY-------KLRFSKSTLKRYGISA--KDVASFPVHGDSMEPVIPSGTT 158

Query: 157 LILNSAIQVNCGDRLLIKPRTGDIV---------AKVLISRRGRSIDLMSLNC-CYPVDT 206
           + +N       GD+ ++    G I           K+L+ + G  + + S N   YP +T
Sbjct: 159 VFVN------MGDKTIV---DGGIYFIEQEDLLRVKILLRQPGGKLTIRSYNSIDYPDET 209

Query: 207 VEMSDIEWIARI 218
           +++  +  + R+
Sbjct: 210 IDIEKVRVVGRV 221


>gi|15887791|ref|NP_353472.1| putative phage repressor [Agrobacterium tumefaciens str. C58]
 gi|15155365|gb|AAK86257.1| putative phage repressor [Agrobacterium tumefaciens str. C58]
          Length = 231

 Score = 44.5 bits (104), Expect = 0.011,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 51/148 (34%), Gaps = 19/148 (12%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
           +D         ++ +L     G  G F      +G     V  P   +    ++A+    
Sbjct: 89  TDFGPAPTGPMDVEVLGVAVGGDDGDFTLNGEVSG----YVRRPPGIAHLRKVFAL---- 140

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK--PRTGDIV----AKVLISRRGR 191
                   SM+P Y  G+++ +     V  GD ++I+  P  G  V     K L  R   
Sbjct: 141 ---HVLSDSMIPRYDPGELIYVGGREAV-AGDHVVIEMFPDEGATVGKAYVKKLKGRTKG 196

Query: 192 SIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +I     N        +   I+ + RI+
Sbjct: 197 AIVCEQYNPPKE-LQFDQYAIKNMWRII 223


>gi|307319507|ref|ZP_07598934.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306894879|gb|EFN25638.1| putative phage repressor [Sinorhizobium meliloti AK83]
          Length = 263

 Score = 44.5 bits (104), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 42/111 (37%), Gaps = 15/111 (13%)

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP- 175
              +P+    +  + A  +     +    SM P Y  GD ++++ +      DRL+    
Sbjct: 152 EWFIPDAYLRNE-VRASPSHTLIMEVVGDSMFPTYSPGDRVLVDLSQ-----DRLVTDTV 205

Query: 176 ---RTG--DIVAKVLISRR---GRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
                G  +   K L          + ++S N      TVE+S ++ I RI
Sbjct: 206 YAISDGYSEPQIKRLQRVPFSEPTEVRIISDNPNLETFTVELSRVKIIGRI 256


>gi|256825655|ref|YP_003149615.1| Peptidase S24-like protein [Kytococcus sedentarius DSM 20547]
 gi|256689048|gb|ACV06850.1| Peptidase S24-like protein [Kytococcus sedentarius DSM 20547]
          Length = 115

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG--RSID 194
           +    SM P  R GD++++     V  G  ++ +   G + A+ L  +R   R ID
Sbjct: 7   RVAGRSMEPTLRPGDLVVVLHGAPVRPGRLVVCRLPDGPMGARPLGIKRAVCRRID 62


>gi|253991400|ref|YP_003042756.1| LexA repressor [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253782850|emb|CAQ86015.1| LexA repressor [Photorhabdus asymbiotica]
          Length = 201

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 52/158 (32%), Gaps = 13/158 (8%)

Query: 65  TNETICQLLDLPFSDGRTTE----KKEKEIPLLYFPPSGSGGFFDSGVFP----TGNKWN 116
           T   I   L     +          ++  I ++     G     +    P          
Sbjct: 27  TRAEIASHLGFRSPNAAEEHLKALARKGVIEIVAGASRGIRLLLEESGLPLIGRVAAGEP 86

Query: 117 TVGVPEIRSPHNGIYAI--QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLI 173
            +    I S +    A+   + D   +    SM  +    GD+L ++    V  G ++++
Sbjct: 87  LLAQEHIESHYQVDPALFKPSADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNG-QVIV 145

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
                ++  K    + G  ++L++ N  +    +++ +
Sbjct: 146 ARIEDEVTVKRF-KQTGNKVELLAENPEFKPIVIDLRE 182


>gi|120610433|ref|YP_970111.1| putative prophage repressor [Acidovorax citrulli AAC00-1]
 gi|120588897|gb|ABM32337.1| phage repressor protein [Acidovorax citrulli AAC00-1]
          Length = 230

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 68/210 (32%), Gaps = 19/210 (9%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
           ER  LT   LA++A +   +           R R     +I   L  +   +     L  
Sbjct: 22  ERAGLTQPALAQRANVSQGTIGN---IESGLRKRPRDLLAIAAALHVSPLWLETGQGLMH 78

Query: 78  SD-------GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            D             + +  P++    +G          P G+  +    P    P+  +
Sbjct: 79  GDHDQANVSTAPASMRPRRYPVISSVQAGEWEEIVDQFSP-GDAEDWQDSPVDLGPNGFV 137

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP-RTGDIVAKVLISRR 189
             ++     +        P   +G  + ++  ++   GD ++ K         K L+   
Sbjct: 138 LKLEGSSMTNPAGGRDNFP---EGMYVHIHPGVEAQPGDYVVAKREADNKATFKKLVRVD 194

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           G    L ++N  +P   +++   +   RI+
Sbjct: 195 GEQF-LHAINPAWPKPYIKLEPGD---RII 220


>gi|118578715|ref|YP_899965.1| putative phage repressor [Pelobacter propionicus DSM 2379]
 gi|118501425|gb|ABK97907.1| putative phage repressor [Pelobacter propionicus DSM 2379]
          Length = 235

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVAKVLISRRGRSIDLMSL 198
              Q  SM P    GD++++++       D  +   + GD ++ K L  +   S+ + S 
Sbjct: 147 ISVQGDSMEPTLSNGDLILVDTRTS-RVEDGAIYVVQYGDALLVKRLQKKYDGSVVIRSD 205

Query: 199 NCCYPVDTVEMSD---IEWIARILWA 221
           N  Y  + +   D   +  + R++WA
Sbjct: 206 NPLYEAEIIHGEDALNLIIVGRVVWA 231


>gi|87120241|ref|ZP_01076136.1| prophage MuSo1, transcriptional regulator, Cro/CI family protein
           [Marinomonas sp. MED121]
 gi|86164344|gb|EAQ65614.1| prophage MuSo1, transcriptional regulator, Cro/CI family protein
           [Marinomonas sp. MED121]
          Length = 102

 Score = 44.2 bits (103), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGRS 192
            ++D     +  SM P    GD L+++  +     D  + +    G++  + +  +   +
Sbjct: 6   NSRDIAMYARGDSMEPTIYSGDSLVIDKTMSSVTSDGGIYVINYDGELFVQRVQKQFHGT 65

Query: 193 IDLMSLNCCYPVDTVEMSD---IEWIARILWA 221
           +++ S N  Y    +  SD   +  I R++W+
Sbjct: 66  VEITSDNKNYGDIVIPSSDLNTLRIIGRVVWS 97


>gi|293446716|ref|ZP_06663138.1| repressor protein CI prophage [Escherichia coli B088]
 gi|291323546|gb|EFE62974.1| repressor protein CI prophage [Escherichia coli B088]
 gi|332344176|gb|AEE57510.1| phage repressor protein [Escherichia coli UMNK88]
          Length = 237

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 52/155 (33%), Gaps = 17/155 (10%)

Query: 58  IFKILAATNETICQLLD---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
           + KIL   N ++ +                  + + + E E P+     +   G F   +
Sbjct: 66  LAKIL---NVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQA---GMFSPEL 119

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                      V   +   +  + ++ +         S  P +  G +++++    V+ G
Sbjct: 120 RTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPAGS-KPSFPDGMLILVDPEQPVDPG 178

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           D  + +    +   K LI   G+   L  LN  +P
Sbjct: 179 DFCIARLGGDEFTFKKLIKDSGQVF-LQPLNPQFP 212


>gi|152991709|ref|YP_001357430.1| phage repressor protein [Sulfurovum sp. NBC37-1]
 gi|151423570|dbj|BAF71073.1| phage repressor protein [Sulfurovum sp. NBC37-1]
          Length = 217

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 34/86 (39%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            T+         SM P  + G I+ ++        D + I   T  +  K +  R    +
Sbjct: 126 NTELEAIHVDGESMEPTLQDGSIVFVDRNQTNINKDGIFIASTTAGLFIKRIRQRADGMV 185

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
           +L+S N  Y  + +   ++  + +++
Sbjct: 186 ELISDNKAYSPEVLAPDEVSIVGKVV 211


>gi|161789249|ref|YP_001595597.1| hypothetical protein BMSA_0010 [Vibrio sp. 23023]
 gi|161761374|gb|ABX77020.1| H-T-H motif hypothetical protein [Vibrio sp. 23023]
          Length = 207

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 41/213 (19%), Positives = 72/213 (33%), Gaps = 31/213 (14%)

Query: 19  RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS 78
              LT   LA   G+   +   SK    + + R    E + +IL            +   
Sbjct: 13  EKGLTQQDLADAIGVSAVAV--SKWELGQSKPRKKFHEKLSEILGVNE-------KVISG 63

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP----HNGIYAIQ 134
             + T+    EIP      +             G+ +    + +            YA +
Sbjct: 64  SEKITKSDYVEIPYYNVKAA------------AGHGYENDELYDREVELVPIEALKYAQK 111

Query: 135 TQDTRHKTQDTSMLPLYRKGDIL-ILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +     K    SM+P++  G  L I +S   V  GD  ++    G +  KVL  +    I
Sbjct: 112 SSVFCIKASGDSMVPVFFDGAKLAIDSSKTIVKDGDLYVV-SYDGCLRVKVLF-KTLNGI 169

Query: 194 DLMSLNCCYPVDTVEMSDIEW---IARILWASQ 223
            L S N  +  +     ++     I +++W SQ
Sbjct: 170 RLCSYNSMFKDEEYTHEELTTFRVIGKVIWYSQ 202


>gi|193076849|gb|ABO11574.2| merops peptidase family S24 [Acinetobacter baumannii ATCC 17978]
          Length = 263

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 51/133 (38%), Gaps = 19/133 (14%)

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
           + + +P++ +  +GS   F        +      +P  +      YA+       K    
Sbjct: 127 EGRRVPVISWVAAGS---FTPIETVLKDTEIEEYLPPNKRCGKNGYAL-------KVVGY 176

Query: 146 SMLPLYRKGDILILNSAIQ---VNCGDRLLI-KPRTGDIVAKVLI---SRRGRSIDLMSL 198
           SM P +  GD + +N  IQ   +   D +++      +   K LI       + ++   L
Sbjct: 177 SMAPTFLPGDRIYVNPDIQTFDLKTDDLVIVACAGDSEATFKRLIIEGEGTSKFLE--PL 234

Query: 199 NCCYPVDTVEMSD 211
           N  +P   +++S+
Sbjct: 235 NPDWPDKIIKLSE 247


>gi|126641192|ref|YP_001084176.1| S24 family peptidase [Acinetobacter baumannii ATCC 17978]
          Length = 225

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 51/133 (38%), Gaps = 19/133 (14%)

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDT 145
           + + +P++ +  +GS   F        +      +P  +      YA+       K    
Sbjct: 89  EGRRVPVISWVAAGS---FTPIETVLKDTEIEEYLPPNKRCGKNGYAL-------KVVGY 138

Query: 146 SMLPLYRKGDILILNSAIQ---VNCGDRLLI-KPRTGDIVAKVLI---SRRGRSIDLMSL 198
           SM P +  GD + +N  IQ   +   D +++      +   K LI       + ++   L
Sbjct: 139 SMAPTFLPGDRIYVNPDIQTFDLKTDDLVIVACAGDSEATFKRLIIEGEGTSKFLE--PL 196

Query: 199 NCCYPVDTVEMSD 211
           N  +P   +++S+
Sbjct: 197 NPDWPDKIIKLSE 209


>gi|33596638|ref|NP_884281.1| LexA repressor [Bordetella parapertussis 12822]
 gi|33573339|emb|CAE37323.1| LexA repressor [Bordetella parapertussis]
          Length = 242

 Score = 44.2 bits (103), Expect = 0.013,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 11/83 (13%)

Query: 134 QTQDTRHKTQDTSMLPLYRK-----GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           QT D   K +  SM    R      GD+L +  A +   G  ++ +    ++  K L  +
Sbjct: 148 QTPDYLLKVRGMSM----RDAGILEGDLLAVKRAAEARNGQIVVARLGD-EVTVKRLQRQ 202

Query: 189 RGRSIDLMSLNCCYPVDTVEMSD 211
            GR I+L+  N  +    V  +D
Sbjct: 203 NGR-IELLPENPDFSPIVVANTD 224


>gi|294101955|ref|YP_003553813.1| transcriptional regulator, XRE family [Aminobacterium colombiense
           DSM 12261]
 gi|293616935|gb|ADE57089.1| transcriptional regulator, XRE family [Aminobacterium colombiense
           DSM 12261]
          Length = 235

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 4/79 (5%)

Query: 138 TRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSIDL 195
              K +  SM       G  + +N    +  GD +L+K  R GD+  K       R ++L
Sbjct: 130 YAIKVEGDSMQEAGIPDGARISVNPEEPIYNGDAVLVKWGRRGDLAVKWYYEYNDR-VEL 188

Query: 196 MSLNCC-YPVDTVEMSDIE 213
            S N   YP   +   +IE
Sbjct: 189 RSSNPAKYPPIIITKEEIE 207


>gi|133873978|gb|ABO40673.1| prophage repressor [Enterobacteria phage mEp332]
          Length = 237

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 28/75 (37%), Gaps = 7/75 (9%)

Query: 135 TQDTRHKTQDTSM------LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                 + +  SM       P +  G +++++    V  GD  + +    +   K LI  
Sbjct: 139 GSAFWLEVEGNSMTAPTGYKPSFPDGMLILVDPEQTVEPGDFCIARLGGDEFTFKKLIRD 198

Query: 189 RGRSIDLMSLNCCYP 203
            G+   L  LN  YP
Sbjct: 199 SGQVF-LQPLNPQYP 212


>gi|12084966|ref|NP_073259.1| SamA [Salmonella enterica subsp. enterica serovar Choleraesuis]
 gi|17233502|ref|NP_490545.1| SamA [Salmonella typhimurium LT2]
 gi|60115500|ref|YP_209292.1| SamA protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161867914|ref|YP_001598095.1| SamA [Salmonella enterica subsp. enterica serovar Choleraesuis]
 gi|167995153|ref|ZP_02576243.1| protein SamA [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|224504282|ref|YP_002635622.1| SamA [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261888739|ref|YP_003264428.1| mutagenesis by UV and mutagens; related to umuDC operon [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|305696890|ref|YP_003864205.1| mutagenesis by UV and mutagens related to umuDC operon [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|134195|sp|P23831|SAMA_SALTY RecName: Full=Protein samA; Contains: RecName: Full=Protein samA'
 gi|217088|dbj|BAA14225.1| UmuD [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|12060336|dbj|BAB20542.1| SamA [Salmonella enterica subsp. enterica serovar Choleraesuis]
 gi|16445323|gb|AAL23541.1| mutagenesis by UV and mutagens; related to umuDC operon [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|45359324|gb|AAS58911.1| SamA protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161087293|gb|ABX56763.1| SamA [Salmonella enterica subsp. enterica serovar Choleraesuis]
 gi|205327113|gb|EDZ13877.1| protein SamA [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|224470991|gb|ACN48820.1| SamA [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261857327|emb|CBA11400.1| mutagenesis by UV and mutagens; related to umuDC operon [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|267990091|gb|ACY86488.1| SamA [Salmonella enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|304376192|dbj|BAJ15354.1| mutagenesis by UV and mutagens related to umuDC operon [Salmonella
           enterica subsp. enterica serovar Typhimurium]
 gi|312915775|dbj|BAJ39748.1| protein SamA [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|322713005|gb|EFZ04577.1| SamA protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323132995|gb|ADX20424.1| mutagenesis protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326626282|gb|EGE32626.1| protein samA [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332991451|gb|AEF10433.1| mutagenesis by UV and mutagens [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 140

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 38/104 (36%), Gaps = 17/104 (16%)

Query: 106 SGVFPTGNK---WNTVGVPEIRSPHNGIYAIQTQDTRHKTQ--DTSMLPL-YRKGDILIL 159
              FP+         + +          Y I+        +    SM  +    GD++++
Sbjct: 24  PAGFPSPAADYTEEELDL--------NAYCIRRPAATFFVRAIGDSMKEMGLHSGDLMVV 75

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           + A +   GD ++I    G+   K L  +    I L+ +N  YP
Sbjct: 76  DKAEKPMQGD-IVIAETDGEFTVKRLQLKP--RIALLPINPAYP 116


>gi|209964501|ref|YP_002297416.1| LexA repressor [Rhodospirillum centenum SW]
 gi|226694238|sp|B6IST2|LEXA_RHOCS RecName: Full=LexA repressor
 gi|209957967|gb|ACI98603.1| LexA repressor [Rhodospirillum centenum SW]
          Length = 237

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 42/154 (27%), Gaps = 21/154 (13%)

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---VGVPEIRSP 126
                         + +   +PL     +           P     +T   + VP     
Sbjct: 95  GDFRGALPGREARGDAEAVSLPLYGRIAA---------GLPIEALRDTTASIDVPTGLIA 145

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
               YA++           SM+      GD +I+        G  ++      ++  K L
Sbjct: 146 SGEHYALE-------VAGDSMVDAGILDGDTVIIQRCETAENGTVIVALVDDNEVTLKRL 198

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             + G SI L   N  Y         +    R++
Sbjct: 199 RRK-GNSIALEPANPAYETRVFGADRVRIQGRLV 231


>gi|239815617|ref|YP_002944527.1| LexA repressor [Variovorax paradoxus S110]
 gi|259494481|sp|C5CKV7|LEXA_VARPS RecName: Full=LexA repressor
 gi|239802194|gb|ACS19261.1| SOS-response transcriptional repressor, LexA [Variovorax paradoxus
           S110]
          Length = 227

 Score = 44.2 bits (103), Expect = 0.014,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 31/76 (40%), Gaps = 3/76 (3%)

Query: 137 DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDL 195
           D   K +  SM       GD+L + +  +   G  ++ +    ++  K L     + I+L
Sbjct: 136 DYLLKVRGMSMRDAGIMDGDLLAVQATKEARNGQIVVARLGD-EVTVKRLKR-NKQVIEL 193

Query: 196 MSLNCCYPVDTVEMSD 211
            + N  YP   V+  +
Sbjct: 194 HAENPDYPTIVVQPGE 209


>gi|319793947|ref|YP_004155587.1| transcriptional repressor, lexa family [Variovorax paradoxus EPS]
 gi|315596410|gb|ADU37476.1| transcriptional repressor, LexA family [Variovorax paradoxus EPS]
          Length = 227

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 31/76 (40%), Gaps = 3/76 (3%)

Query: 137 DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDL 195
           D   K +  SM       GD+L + +  +   G  ++ +    ++  K L     + I+L
Sbjct: 136 DYLLKVRGMSMRDAGIMDGDLLAVQATKEARNGQIVVARLGD-EVTVKRLKR-NKQVIEL 193

Query: 196 MSLNCCYPVDTVEMSD 211
            + N  YP   V+  +
Sbjct: 194 HAENPDYPTIIVQPGE 209


>gi|260435498|ref|ZP_05789468.1| protein UmuD [Synechococcus sp. WH 8109]
 gi|260413372|gb|EEX06668.1| protein UmuD [Synechococcus sp. WH 8109]
          Length = 143

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/133 (16%), Positives = 45/133 (33%), Gaps = 14/133 (10%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT 135
                   ++    +PL     +          FP+    + V V      +  +    T
Sbjct: 5   HRPLPLQPKRSRLTLPLAGERVA--------AGFPSPAD-DYVDV--GIDLNEQLIRHPT 53

Query: 136 QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                     SM       GD+L+++ ++    G ++++    G    K L+  RGR + 
Sbjct: 54  STFFLHVSGESMTDAGIHDGDLLVVDRSLDPRPG-QVVVAVLDGAFTLKRLMRHRGR-LR 111

Query: 195 LMSLNCCYPVDTV 207
           L + +  YP   +
Sbjct: 112 LEAAHPDYPPLEL 124


>gi|167554278|ref|ZP_02348019.1| protein SamA [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205321486|gb|EDZ09325.1| protein SamA [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 140

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 40/104 (38%), Gaps = 17/104 (16%)

Query: 106 SGVFPTGNK---WNTVGVPEIRSPHNGIYAIQTQDTRHKTQ--DTSMLPL-YRKGDILIL 159
              FP+       + + +          Y I+     +  +    SM  +    GD++++
Sbjct: 24  PAGFPSPAADYTEDELDL--------NAYCIRRPSATYFVRAIGDSMKDMGLHSGDLMVV 75

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
           + A +   GD ++I    G+   K L  +    I L+ +N  YP
Sbjct: 76  DKAEKPMQGD-IVIAETDGEFTVKRLQLKP--RIALLPMNPAYP 116


>gi|255264421|ref|ZP_05343763.1| LexA repressor [Thalassiobium sp. R2A62]
 gi|255106756|gb|EET49430.1| LexA repressor [Thalassiobium sp. R2A62]
          Length = 232

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 51/146 (34%), Gaps = 16/146 (10%)

Query: 76  PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE-IRSPHNGIYAIQ 134
           P            E+P++    +G        +    +  ++V VP  + +     YA++
Sbjct: 95  PHDARPVETTHAIELPVMGKIAAGV------PIEAISHAAHSVAVPGGMVAGTCEHYALE 148

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                   +  SM+      GD++++      + GD ++      +   K    R G SI
Sbjct: 149 -------VKGDSMIDAGINDGDVVVIKETSTADNGDIVVALVEDQEATLKRF-RRNGASI 200

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L + N  Y         ++   R++
Sbjct: 201 ALEAANPAYETRVFNDDQVKVQGRLV 226


>gi|218886195|ref|YP_002435516.1| phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757149|gb|ACL08048.1| putative phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 249

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 64/204 (31%), Gaps = 39/204 (19%)

Query: 50  NRWPS-------TESIFKILAATNE-----TICQLLDLPFSDGRTTEKKEKEIP------ 91
            R+PS       TE + +I A +        + + +  P+ +       + E+P      
Sbjct: 49  ERFPSRTNLARLTEHLDRIPAVSGLQPHRRGLHERMLRPYGEAPRASAGQPEVPEEVRRL 108

Query: 92  -----LLYFPPS---GSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
                L+    +     GG   +G  P       +     R+       +       +  
Sbjct: 109 AEEFVLVDRAEARPSAGGGSLQTGGHPQEQHAFRLDWVLGRARSTTGLCL------MEVM 162

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM      GD++++N        DR+ +     +I  K               N  + 
Sbjct: 163 GRSMERTLHDGDLVLVNQHDHALAEDRIYVVRVQDEIYIKRFSR-TPGRYHFRGDNPEFA 221

Query: 204 VDTVEM----SDIEW--IARILWA 221
              +E+      ++W  I R++WA
Sbjct: 222 YQDIEIDPRDEALQWEVIGRVIWA 245


>gi|217975711|ref|YP_002360310.1| putative phage repressor [Shewanella baltica OS223]
 gi|217501061|gb|ACK48948.1| putative phage repressor [Shewanella baltica OS223]
          Length = 231

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV---AKVLISRRGRSIDLM 196
                 SM P  + G +++++    V    ++ +  R GD++   A     +  ++    
Sbjct: 146 ITVTGDSMEPALKDGSLIVVDPTQTVVRDGKIYV-FRQGDVLRVKAFSYEKQMVKA---K 201

Query: 197 SLNCCYPVDTVEMSDIEWIARILWAS 222
           S N  Y  +   + ++E + R++++S
Sbjct: 202 SYNEFYKDELYRLDELELLGRVVFSS 227


>gi|164686056|ref|ZP_01946368.2| peptidase S24-like domain protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165924149|ref|ZP_02219981.1| peptidase S24-like domain protein [Coxiella burnetii RSA 334]
 gi|164601612|gb|EAX33041.2| peptidase S24-like domain protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165916408|gb|EDR35012.1| peptidase S24-like domain protein [Coxiella burnetii RSA 334]
          Length = 216

 Score = 44.2 bits (103), Expect = 0.015,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 37/103 (35%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 98  WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 156

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V +
Sbjct: 157 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAL 196


>gi|167753569|ref|ZP_02425696.1| hypothetical protein ALIPUT_01846 [Alistipes putredinis DSM 17216]
 gi|167658194|gb|EDS02324.1| hypothetical protein ALIPUT_01846 [Alistipes putredinis DSM 17216]
          Length = 136

 Score = 43.8 bits (102), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 7/94 (7%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ--VNCGDRLLIKPRTGDIVAKVLISRRG 190
           ++ Q+ R   Q  SMLP +R G ++ L       +  G  ++ +   G+ V   +I    
Sbjct: 19  LEGQNVRICVQGQSMLPFFRSGSVITLRPLRHEDLRRGAVVMAETVQGNFVVHRIIQATP 78

Query: 191 RSIDLMS---LNCC--YPVDTVEMSDIEWIARIL 219
             + L+    L      P     + D   I R+L
Sbjct: 79  EEVTLLGDGNLTTETMPPAKVYGVVDCSAIHRVL 112


>gi|163742788|ref|ZP_02150173.1| LexA repressor [Phaeobacter gallaeciensis 2.10]
 gi|161384043|gb|EDQ08427.1| LexA repressor [Phaeobacter gallaeciensis 2.10]
          Length = 224

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 35/92 (38%), Gaps = 2/92 (2%)

Query: 129 GIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
            + + Q Q    + +  SM       GDI+++      + GD ++      +   K +  
Sbjct: 128 SMLSAQGQHFALEVRGDSMIEAGINDGDIVVIRETAVADNGDVVVALVEGQEATLKRIYR 187

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + G +I L + N  Y         ++   R++
Sbjct: 188 K-GSTIALEAANPAYETRRYRQDQVKVQGRLV 218


>gi|294786785|ref|ZP_06752039.1| UmuD protein [Parascardovia denticolens F0305]
 gi|294485618|gb|EFG33252.1| UmuD protein [Parascardovia denticolens F0305]
          Length = 140

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 36/111 (32%), Gaps = 7/111 (6%)

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV 165
             FP+             S    +               SM       GD+LI++ ++  
Sbjct: 15  AGFPSVA---QDYFDGDFSFDENVIIHPDTTFIVTVAGDSMQGAGIFDGDLLIVDRSLPA 71

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV--EMSDIEW 214
              D ++I    G++  K L+  +  +  L   N  YP   +  E   + W
Sbjct: 72  QEND-VVIAAIDGELTVKRLVIDQEGNPVLHPENPSYPDIHLYWEADALIW 121


>gi|261406209|ref|YP_003242450.1| LexA family transcriptional repressor [Paenibacillus sp. Y412MC10]
 gi|329930854|ref|ZP_08284253.1| repressor LexA [Paenibacillus sp. HGF5]
 gi|261282672|gb|ACX64643.1| transcriptional repressor, LexA family [Paenibacillus sp. Y412MC10]
 gi|328934556|gb|EGG31061.1| repressor LexA [Paenibacillus sp. HGF5]
          Length = 208

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 40/148 (27%), Gaps = 24/148 (16%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFD------------SGVFPTGNKW---NTVGVPEIRS 125
           R    K + I LL    S S   F             +   P        +   +P+   
Sbjct: 57  RRDPTKPRAIELLGQEESESANLFTHTIARVPVVGKVTAGVPITAMENIEDYFPLPQHYV 116

Query: 126 PHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
             + ++ +            SM       GD +I+      + GD ++      +   K 
Sbjct: 117 GDDKVFML-------SVVGDSMIEAGIHSGDYVIVRQQQTADNGDIVVAMTEEDEATVKT 169

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDI 212
              +    + L   N  Y    +    I
Sbjct: 170 F-YKEKDHVRLQPENPTYEPLRLNHVTI 196


>gi|110680397|ref|YP_683404.1| LexA repressor [Roseobacter denitrificans OCh 114]
 gi|123065396|sp|Q163X5|LEXA_ROSDO RecName: Full=LexA repressor
 gi|109456513|gb|ABG32718.1| LexA repressor [Roseobacter denitrificans OCh 114]
          Length = 233

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 67/209 (32%), Gaps = 41/209 (19%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDG--RTTEKKEKEIPLLYFPP- 97
           KR   +G    PS + + + L   +   I +L+      G  R    + + I ++  P  
Sbjct: 15  KRVQRDGVP--PSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHRARAIEIVKLPET 72

Query: 98  ---SGSGGFFD--------SGVFPTGN----KWNTVGVPEIRS-----------PHNGIY 131
              +  GGF              P G       + V +P +              ++   
Sbjct: 73  LGGAARGGFTPRVIEGDKPDAPLPAGAQAVSSADAVALPLVGRIAAGLPIEAINQNSASV 132

Query: 132 AIQTQ-------DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
           A+  Q           + +  SM+      GD++++      + GD ++      +   K
Sbjct: 133 AVPGQMLSGKGDHYALEVKGDSMIDAGINDGDVVVIRETSVADNGDIVVALIEDHEATLK 192

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDI 212
             + + G SI L + N  Y         +
Sbjct: 193 RYMRK-GSSIALEAANPAYETRVFTEDKV 220


>gi|308171850|ref|YP_003915180.1| UmuD-like protein [Arthrobacter arilaitensis Re117]
 gi|307743222|emb|CBQ74045.1| UmuD-like protein [Arthrobacter arilaitensis Re117]
          Length = 143

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 3/76 (3%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           Q      +    SM       GD LI++ ++Q   G  ++I    G++  K L +     
Sbjct: 52  QVSTFIVRVSGESMQGAGISDGDELIVDRSVQPRDG-HVVIAVIDGEMTVKRLSTGPAGV 110

Query: 193 IDLMSLNCCYPVDTVE 208
           + L + N  YP   V 
Sbjct: 111 V-LKAENPDYPDLRVA 125


>gi|87200194|ref|YP_497451.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135875|gb|ABD26617.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
          Length = 213

 Score = 43.8 bits (102), Expect = 0.016,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 27/224 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
                A+D + ++  +  S ++R  G +     +  R    G  R        ++     
Sbjct: 2   DDARRALDELIQQRGVNYSSVSRLLGRNAAYIQQYIRR---GSPR--------QLDEQDR 50

Query: 67  ETICQLLDLPFSDGRTTEKKEK------EIPLLYF-PPSGSGGFFDSGVFPTGNKWNTVG 119
             + +   +         ++         +PLL     +G G   +         ++   
Sbjct: 51  SVLARFFGVDEKVLGAPARRSGPVVELVHVPLLNVEASAGHGALAEMEAKSAQFGFDEKW 110

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTG 178
           +  + +      +I            SM P    GD ++++    Q    D + +     
Sbjct: 111 LRRLTASKASSLSI------IAVHGDSMEPTLHDGDEVMVDLGDGQSRLRDGIYVLRMDD 164

Query: 179 DIVAKVLISRR-GRSIDLMSLNCCYPV-DTVEMSDIEWIARILW 220
            +  K +     G+   ++S N  YP    +E   +  + R+LW
Sbjct: 165 MLSVKRIALEPQGKRASVLSDNPAYPSWRGLEKRTLNIVGRVLW 208


>gi|315646590|ref|ZP_07899708.1| transcriptional repressor, LexA family protein [Paenibacillus
           vortex V453]
 gi|315278233|gb|EFU41553.1| transcriptional repressor, LexA family protein [Paenibacillus
           vortex V453]
          Length = 208

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 40/148 (27%), Gaps = 24/148 (16%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFD------------SGVFPTGNKW---NTVGVPEIRS 125
           R    K + I LL    S S   F             +   P        +   +P+   
Sbjct: 57  RRDPTKPRAIELLGQEESDSANLFTHTIARVPVVGKVTAGVPITAMENIEDYFPLPQHYV 116

Query: 126 PHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
             + ++ +            SM       GD +I+      + GD ++      +   K 
Sbjct: 117 GDDKVFML-------SVVGDSMIEAGIHSGDYVIVRQQQTADNGDIVVAMTEEDEATVKT 169

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDI 212
              +    + L   N  Y    +    I
Sbjct: 170 F-YKEKDHVRLQPENPTYEPLRLNHVTI 196


>gi|331701909|ref|YP_004398868.1| phage repressor like XRE family transcriptional regulator
           [Lactobacillus buchneri NRRL B-30929]
 gi|329129252|gb|AEB73805.1| phage repressor like transcriptional regulator, XRE family
           [Lactobacillus buchneri NRRL B-30929]
          Length = 237

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 34/85 (40%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
             D        SM PL +KG  + ++   +V  G+  ++  R   +  K        ++ 
Sbjct: 152 GADELITVDGDSMEPLLKKGSQVFIHYQPEVENGEIAIVHIRDVGVTCKKFYVNEDNTVT 211

Query: 195 LMSLNCCYPVDTVEMSDIEWIARIL 219
           L S+N  Y     +  ++  I +++
Sbjct: 212 LKSINEAYDDMVFDCDEVNVIGKVI 236


>gi|313682117|ref|YP_004059855.1| phage repressor [Sulfuricurvum kujiense DSM 16994]
 gi|313154977|gb|ADR33655.1| putative phage repressor [Sulfuricurvum kujiense DSM 16994]
          Length = 219

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 47/126 (37%), Gaps = 9/126 (7%)

Query: 102 GFFDSGVFPTGNKWN--TVGVPEIRSPHNGIYAIQTQDT-----RHKTQDTSMLPLYRKG 154
            +F S     G   +   +    +    N + ++  +              SM P +   
Sbjct: 88  RYFSSVNASAGGGADNEELDYEPLMLEDNFVLSLGGEKELRHIEAINVSGDSMEPSFSYN 147

Query: 155 DILILNSA-IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           DI+ +N +   ++ G    I+   G +  K +  R    +D++S N  YP       ++E
Sbjct: 148 DIIFINRSKTDISRGGIFTIRTEHG-LFIKRIQVRIDGKLDIISDNKDYPTYVARRDEVE 206

Query: 214 WIARIL 219
            I R++
Sbjct: 207 VIGRVV 212


>gi|315226410|ref|ZP_07868198.1| SOS mutagenesis and repair protein UmuD [Parascardovia denticolens
           DSM 10105]
 gi|315120542|gb|EFT83674.1| SOS mutagenesis and repair protein UmuD [Parascardovia denticolens
           DSM 10105]
          Length = 137

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 36/111 (32%), Gaps = 7/111 (6%)

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV 165
             FP+             S    +               SM       GD+LI++ ++  
Sbjct: 12  AGFPSVA---QDYFDGDFSFDENVIIHPDTTFIVTVAGDSMQGAGIFDGDLLIVDRSLPA 68

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV--EMSDIEW 214
              D ++I    G++  K L+  +  +  L   N  YP   +  E   + W
Sbjct: 69  QEND-VVIAAIDGELTVKRLVIDQEGNPVLHPENPSYPDIHLYWEADALIW 118


>gi|161831001|ref|YP_001597255.1| peptidase S24-like domain-containing protein [Coxiella burnetii RSA
           331]
 gi|81628752|sp|Q83BT6|Y1416_COXBU RecName: Full=Uncharacterized HTH-type transcriptional regulator
           CBU_1416
 gi|161762868|gb|ABX78510.1| peptidase S24-like domain protein [Coxiella burnetii RSA 331]
          Length = 216

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 36/103 (34%), Gaps = 12/103 (11%)

Query: 115 WNTVGVPEIRSPHNGIYA-----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           W    +P  ++    +Y      +         Q  +M PL+  G  +I+    +    D
Sbjct: 98  WPE-ALPHYQTSDEVMYISTDANVSKLAYGLIIQGCAMEPLFPNGTTIIVEPERKPKDRD 156

Query: 170 RLLIKPRTGDIVAK---VLISRRGRSIDLMSLNCCYPVDTVEM 209
            ++++   G+  A+   ++     R   L SLN       V  
Sbjct: 157 FVVVRL-QGEPEARLRQIITEGNDRY--LKSLNPELEKLEVAR 196


>gi|303328406|ref|ZP_07358843.1| peptidase, S24 family [Desulfovibrio sp. 3_1_syn3]
 gi|302861400|gb|EFL84337.1| peptidase, S24 family [Desulfovibrio sp. 3_1_syn3]
          Length = 211

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 33/92 (35%), Gaps = 14/92 (15%)

Query: 140 HKTQDTSMLPLYRKGDILILNS---AIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
                 SM PL R+GD ++++      ++  G   ++      ++ K L         L 
Sbjct: 122 MCVAGDSMEPLIREGDTILVDESEKGKELRDGYIFVVGLND-ALMVKRLAKIPNGW-RLC 179

Query: 197 SLNCCYPVDTVEMSD---------IEWIARIL 219
           S N   P   V+  D         + W  R++
Sbjct: 180 SENKERPDIDVQGDDFNTFRVYGRVRWFGRVV 211


>gi|170080892|ref|YP_001730212.1| repressor protein CI [Escherichia coli str. K-12 substr. DH10B]
 gi|133351|sp|P14819|RPC1_BPPH8 RecName: Full=Repressor protein CI
 gi|14804|emb|CAA31471.1| unnamed protein product [Enterobacteria phage phi80]
 gi|169888727|gb|ACB02434.1| repressor protein CI [Escherichia coli str. K-12 substr. DH10B]
          Length = 236

 Score = 43.8 bits (102), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 2/81 (2%)

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV-AKVLISRRGRSIDLMSLNCC 201
              SM P+   G  + +++  +    D  L     GD+   K L  + G  I + S+N  
Sbjct: 151 SGDSMEPVIPDGATVAVDTGNK-RVIDGELYAINQGDLKRIKQLYRKPGGKILIRSINRD 209

Query: 202 YPVDTVEMSDIEWIARILWAS 222
           Y  +  + +D+E I  + W S
Sbjct: 210 YDDEEADEADVEIIGFVFWYS 230


>gi|71559074|ref|YP_271801.1| SamA [Salmonella enterica]
 gi|68166373|gb|AAY88134.1| SamA [Salmonella enterica]
          Length = 140

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 37/101 (36%), Gaps = 11/101 (10%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ--DTSMLPL-YRKGDILILNSA 162
              FP+    +              Y I+        +    SM  +    GD+++++ A
Sbjct: 24  PAGFPSPAA-DYTE----EKLDLNAYCIRRPAATFFVRAIGDSMKEMGLHSGDLMVVDKA 78

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
            +   GD ++I    G+   K L  +    I L+ +N  YP
Sbjct: 79  EKPMQGD-IVIAETDGEFTVKRLQLKP--RIALLPINPAYP 116


>gi|44888098|sp|Q7W0T5|LEXA_BORPA RecName: Full=LexA repressor
          Length = 216

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 11/83 (13%)

Query: 134 QTQDTRHKTQDTSMLPLYRK-----GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           QT D   K +  SM    R      GD+L +  A +   G  ++ +    ++  K L  +
Sbjct: 122 QTPDYLLKVRGMSM----RDAGILEGDLLAVKRAAEARNGQIVVARLGD-EVTVKRLQRQ 176

Query: 189 RGRSIDLMSLNCCYPVDTVEMSD 211
            GR I+L+  N  +    V  +D
Sbjct: 177 NGR-IELLPENPDFSPIVVANTD 198


>gi|114327480|ref|YP_744637.1| LexA repressor [Granulibacter bethesdensis CGDNIH1]
 gi|122327547|sp|Q0BTY8|LEXA_GRABC RecName: Full=LexA repressor
 gi|114315654|gb|ABI61714.1| lexA repressor [Granulibacter bethesdensis CGDNIH1]
          Length = 242

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 52/171 (30%), Gaps = 20/171 (11%)

Query: 53  PSTESIFKILAAT-NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS--GGFFDSGVF 109
           PS  S     A T N                 +    ++PL     +G       D+  +
Sbjct: 82  PSAPSFASPPAFTPNVIQGSFSSRIAGVRAAQDASAVQLPLYGRIAAGMPIEALRDTSAY 141

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCG 168
                   + VP     +   YA++           SM+      GD +I+  +     G
Sbjct: 142 --------LSVPIDMLGNGEHYALE-------VAGDSMIDAGIFDGDTVIIQQSDLAENG 186

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             ++      ++  K L  R G+S+ L   N  +         +    R++
Sbjct: 187 QIVVALIDDTEVTLKRLRRR-GKSVALEPANERHETRIFPADRVRVQGRLI 236


>gi|312114155|ref|YP_004011751.1| LexA family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219284|gb|ADP70652.1| transcriptional repressor, LexA family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 258

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 131 YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           Y         + +  SM     ++GD ++L        GD ++      +   K L  +R
Sbjct: 164 YLSTGDHFALEVRGDSMIEAGIQEGDTVVLKKTAAAESGDIVVALIDDEEATLKRL-RKR 222

Query: 190 GRSIDLMSLNCCYPVDTVEMSDI 212
           G+SI L   N  Y         +
Sbjct: 223 GQSIALEPANPAYETRIFGPDRV 245


>gi|83942599|ref|ZP_00955060.1| LexA repressor [Sulfitobacter sp. EE-36]
 gi|83953840|ref|ZP_00962561.1| LexA repressor [Sulfitobacter sp. NAS-14.1]
 gi|83841785|gb|EAP80954.1| LexA repressor [Sulfitobacter sp. NAS-14.1]
 gi|83846692|gb|EAP84568.1| LexA repressor [Sulfitobacter sp. EE-36]
          Length = 232

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
            +    + Q  SM+      GD++I+      + GD ++      +   K    R G S+
Sbjct: 142 GEHYALEVQGDSMIDAGINDGDVVIIRETSVADDGDIVVALVEDHEATLKKF-RRHGSSV 200

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L + N  Y    +    ++   R++
Sbjct: 201 ALEAANPAYETRVLPSDKVKVQGRLV 226


>gi|170683779|ref|YP_001744018.1| DNA polymerase V subunit UmuD [Escherichia coli SMS-3-5]
 gi|218700236|ref|YP_002407865.1| DNA polymerase V subunit UmuD [Escherichia coli IAI39]
 gi|300939591|ref|ZP_07154248.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|170521497|gb|ACB19675.1| protein UmuD [Escherichia coli SMS-3-5]
 gi|218370222|emb|CAR18018.1| DNA polymerase V, subunit D [Escherichia coli IAI39]
 gi|300455595|gb|EFK19088.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
          Length = 139

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + +   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYIE--QRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|229551634|ref|ZP_04440359.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus rhamnosus LMS2-1]
 gi|229314952|gb|EEN80925.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus rhamnosus LMS2-1]
          Length = 260

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 39/108 (36%), Gaps = 13/108 (12%)

Query: 94  YFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
               +G G F D    P     +TV +P+   P +  Y         K    SM P Y  
Sbjct: 132 GIVAAGYGAFNDDRYEPM----DTVKIPDSAIPSHYDYC-------FKVVGDSMSPYYED 180

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC 201
           G+ + +     V  G   ++       + K+++ +    + L SLN  
Sbjct: 181 GEFVFVQKTQDVTNGMIAVVDIDDMTFIKKLILEQ--DRLCLRSLNDD 226


>gi|149915248|ref|ZP_01903776.1| putative transcriptional regulator, repressor [Roseobacter sp.
           AzwK-3b]
 gi|149810969|gb|EDM70808.1| putative transcriptional regulator, repressor [Roseobacter sp.
           AzwK-3b]
          Length = 220

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 79/211 (37%), Gaps = 16/211 (7%)

Query: 18  ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPF 77
           ER N++ + +ARKAG+   +    KR    G+ +  S E   KI  A    +  +L    
Sbjct: 15  ERQNVSVAEIARKAGVPYDAVRDIKR----GKVQSTSWERAVKIAQALGIVLEDVLPATS 70

Query: 78  S----DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                    +   +  + +     S   G       P G+    +  P          A 
Sbjct: 71  KTEQVREAASSDLQAMVSVYDVHASAGDGAVVIHEEPIGS----LAFPA-NYLRQLTQAN 125

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD-IVAKVLISR-RGR 191
                    +  SMLP     D+++L+ + +    D L +    G+ ++ K +       
Sbjct: 126 WRDLAIISVKGDSMLPTLADDDVVMLDRSKRDLSYDGLFVIRDNGEALLVKRIQRAPTPG 185

Query: 192 SIDLMSLNCC-YPVDTVEMSDIEWIARILWA 221
            + ++S N   Y     ++SD+E I R++WA
Sbjct: 186 HVIIISDNRALYDPVEKKLSDMEVIGRVIWA 216


>gi|323516288|gb|ADX90669.1| S24 family peptidase [Acinetobacter baumannii TCDC-AB0715]
          Length = 229

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 36/94 (38%), Gaps = 13/94 (13%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQV---NCGDRLLIKPRTGDIVA--KVLISRRG 190
                    TSMLP +  GD + +N    V      D +++    GD  A  K LI   G
Sbjct: 135 NGYGLIVTGTSMLPKFEPGDRIYVNPDYPVFDLKTNDLVIV-SCAGDTQATFKRLIIEDG 193

Query: 191 RSIDLMSLNCCYPVDTVEMSD-------IEWIAR 217
               L  LN  +P   +++++       +  + R
Sbjct: 194 EEKYLEPLNTKWPEQIIKLTEECKLVGKVVGMHR 227


>gi|315929874|gb|EFV09035.1| Signal peptidase I, putative [Campylobacter jejuni subsp. jejuni
           305]
          Length = 224

 Score = 43.8 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQ----VNCGDRLLIKPRTGDIVAKVLISRR-GRSID 194
            K    SM P    GD++ ++ +      V  GD ++I    G+I  K L+ +     I 
Sbjct: 122 IKVIGDSMEPFIHSGDVIAIDVSKNKLDLVKNGDIVVINL-DGEIYCKKLLKQPFVNEIV 180

Query: 195 LMSLNCCYPVDTVEMSDI 212
           L S+N  Y    V +  I
Sbjct: 181 LSSMNSFYKDIVVNIEHI 198


>gi|325849104|ref|ZP_08170596.1| DNA-binding helix-turn-helix protein [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325480349|gb|EGC83412.1| DNA-binding helix-turn-helix protein [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 202

 Score = 43.8 bits (102), Expect = 0.019,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 33/106 (31%), Gaps = 3/106 (2%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
               P     +   + +        +         K +  SM P Y +GD +IL      
Sbjct: 84  PAGIPIEAIED---ISDTEDISFKDFDKNKTYIGLKVEGDSMYPKYLQGDTIILELTPDC 140

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
             G    +     +   K +I     +I LM +N  YP  T    D
Sbjct: 141 ESGTDAAVYVNGYEATLKTVIKNDNGTITLMPINTSYPPKTYGKDD 186


>gi|317969758|ref|ZP_07971148.1| putative SOS mutagenesis protein UmuD [Synechococcus sp. CB0205]
          Length = 148

 Score = 43.8 bits (102), Expect = 0.020,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 48/132 (36%), Gaps = 14/132 (10%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDT 138
            G   E+  + +PL     +          FP+    + + V      +  +    +   
Sbjct: 9   GGLRDERPRRPLPLASSTVA--------AGFPSPAD-DYIDV--GIDLNETLIRHPSSTF 57

Query: 139 RHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
             +    SM     + GD+L+++ +++   G  +++    G    K L   +GR + L +
Sbjct: 58  FLRVSGDSMVEAGIQHGDLLVVDRSLEARPG-HVVVAVLDGAFTLKRLARHQGR-LRLEA 115

Query: 198 LNCCYPVDTVEM 209
            N  YP   +  
Sbjct: 116 ANSAYPPLELHH 127


>gi|283138937|gb|ADB12540.1| hypothetical protein [uncultured bacterium 9F08]
          Length = 125

 Score = 43.8 bits (102), Expect = 0.020,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 25/87 (28%), Gaps = 9/87 (10%)

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                          Y +            SM P + +GD++++        G  ++   
Sbjct: 17  EEFDYQPTGCEDKEPYVL-------MVLGDSMEPEFNEGDVIVIEPGANYRDGSYIIAYH 69

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCY 202
              + + + L      +  L  LN  Y
Sbjct: 70  ND-EYIFRQL-RVINDNFYLTPLNPNY 94


>gi|149914774|ref|ZP_01903304.1| LexA repressor [Roseobacter sp. AzwK-3b]
 gi|149811567|gb|EDM71402.1| LexA repressor [Roseobacter sp. AzwK-3b]
          Length = 233

 Score = 43.8 bits (102), Expect = 0.020,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 9/90 (10%)

Query: 131 YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           YA++        +  SM       GD++I+      + GD ++      +   K    R 
Sbjct: 146 YALE-------VRGDSMIEAGINDGDVVIIRETNTADNGDIVVALVEDQEATLKKFYRR- 197

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           G +I L + N  Y    +    ++   R++
Sbjct: 198 GNAIALEAANPAYETRVLPEDQVKVQGRLV 227


>gi|307258155|ref|ZP_07539905.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863340|gb|EFM95273.1| Possible LexA family repressor/S24 family protease [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 107

 Score = 43.8 bits (102), Expect = 0.020,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%), Gaps = 10/93 (10%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK------VLI 186
           +       K +  SM P +  GDI+I++  ++ + G+ +       +   K       L 
Sbjct: 6   VSGDAFALKIKGDSMEPEFIAGDIVIIDPRVEPHAGEFVAAINGDYEATFKKYRPLEDLD 65

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               +  +L+ LN  +   +    +I    RI+
Sbjct: 66  EYGRQHFELVPLNPDWHSMSSLKQEI----RII 94


>gi|1854946|gb|AAB48301.1| RvuZ homolog [Rattus norvegicus]
          Length = 79

 Score = 43.8 bits (102), Expect = 0.020,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 5/71 (7%)

Query: 137 DTRHKTQDTSM--LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
                    SM    ++  GD LI++ A++   GD +++    GD+  K L     +S  
Sbjct: 6   TYVVLVSGDSMTGAGIF-DGDYLIVSRALEAKSGD-VVVACLNGDVFVKRLGR-CQKSYV 62

Query: 195 LMSLNCCYPVD 205
           L S +  Y   
Sbjct: 63  LQSEHPDYAPR 73


>gi|257438216|ref|ZP_05613971.1| LexA repressor [Faecalibacterium prausnitzii A2-165]
 gi|257199293|gb|EEU97577.1| LexA repressor [Faecalibacterium prausnitzii A2-165]
          Length = 211

 Score = 43.4 bits (101), Expect = 0.021,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 65/209 (31%), Gaps = 33/209 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
            + +   ++ S  A++ GL  ++  K K  G       PS E++ ++ A     + +LL 
Sbjct: 8   ALCQARGISRSRAAQEMGLSNSTVTKWKNTGAT-----PSGETLARVSAYFGVPVGELLG 62

Query: 75  ---------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
                        +G          PLL    +           P   + N  G   I  
Sbjct: 63  EAVPSVQEERKLPEGAVPFDPALTAPLLGTVRA---------GLPMYAEENIEGYIPITR 113

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                Y         + +  SM  +   + D +++    +V  G   ++     +   K 
Sbjct: 114 KDGARY------FWLRVRGDSMNAVGISENDEILVREQPEVENGQLAVVMVNGDEATVKY 167

Query: 185 LISRRGRSIDL--MSLNCCYPVDTVEMSD 211
              + G  + L   S N  +     ++  
Sbjct: 168 F-RQEGSLVVLTPKSFNPVHQPQIYDLKR 195


>gi|229117182|ref|ZP_04246561.1| Phage transcriptional repressor [Bacillus cereus Rock1-3]
 gi|228666350|gb|EEL21813.1| Phage transcriptional repressor [Bacillus cereus Rock1-3]
          Length = 223

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 77/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 13  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLEV 68

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L      T              +     IP++    +G+  F +  +           +P
Sbjct: 69  LTTKGDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENI--------EGYLP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 121 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 176

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L  +  +   T  +   D++ I R++ A
Sbjct: 177 VKKIS-KSGSIITLIPLSNDPIHEPQTYDLSAEDVKIIGRVVQA 219


>gi|82776514|ref|YP_402863.1| DNA polymerase V subunit UmuD [Shigella dysenteriae Sd197]
 gi|301648166|ref|ZP_07247919.1| peptidase S24-like domain protein [Escherichia coli MS 146-1]
 gi|307137796|ref|ZP_07497152.1| DNA polymerase V subunit UmuD [Escherichia coli H736]
 gi|309789205|ref|ZP_07683798.1| UmuD protein [Shigella dysenteriae 1617]
 gi|331641709|ref|ZP_08342844.1| protein UmuD [Escherichia coli H736]
 gi|331652213|ref|ZP_08353232.1| protein UmuD [Escherichia coli M718]
 gi|81240662|gb|ABB61372.1| UmuD [Shigella dysenteriae Sd197]
 gi|301073752|gb|EFK88558.1| peptidase S24-like domain protein [Escherichia coli MS 146-1]
 gi|308922959|gb|EFP68473.1| UmuD protein [Shigella dysenteriae 1617]
 gi|315615980|gb|EFU96606.1| UmuD protein [Escherichia coli 3431]
 gi|331038507|gb|EGI10727.1| protein UmuD [Escherichia coli H736]
 gi|331050491|gb|EGI22549.1| protein UmuD [Escherichia coli M718]
          Length = 139

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYVE--QRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|15801405|ref|NP_287422.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 EDL933]
 gi|15830932|ref|NP_309705.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 str. Sakai]
 gi|16129146|ref|NP_415701.1| DNA polymerase V, subunit D [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24112570|ref|NP_707080.1| DNA polymerase V subunit UmuD [Shigella flexneri 2a str. 301]
 gi|30062700|ref|NP_836871.1| DNA polymerase V subunit UmuD [Shigella flexneri 2a str. 2457T]
 gi|74311713|ref|YP_310132.1| DNA polymerase V subunit UmuD [Shigella sonnei Ss046]
 gi|82544364|ref|YP_408311.1| DNA polymerase V subunit UmuD [Shigella boydii Sb227]
 gi|89108028|ref|AP_001808.1| DNA polymerase V, subunit D [Escherichia coli str. K-12 substr.
           W3110]
 gi|110641408|ref|YP_669138.1| DNA polymerase V subunit UmuD [Escherichia coli 536]
 gi|110805182|ref|YP_688702.1| DNA polymerase V subunit UmuD [Shigella flexneri 5 str. 8401]
 gi|157159399|ref|YP_001462433.1| DNA polymerase V subunit UmuD [Escherichia coli E24377A]
 gi|157160686|ref|YP_001458004.1| DNA polymerase V subunit UmuD [Escherichia coli HS]
 gi|168752764|ref|ZP_02777786.1| protein UmuD [Escherichia coli O157:H7 str. EC4113]
 gi|168756548|ref|ZP_02781555.1| protein UmuD [Escherichia coli O157:H7 str. EC4401]
 gi|168771074|ref|ZP_02796081.1| protein UmuD [Escherichia coli O157:H7 str. EC4486]
 gi|168778216|ref|ZP_02803223.1| protein UmuD [Escherichia coli O157:H7 str. EC4196]
 gi|168782541|ref|ZP_02807548.1| protein UmuD [Escherichia coli O157:H7 str. EC4076]
 gi|168787684|ref|ZP_02812691.1| protein UmuD [Escherichia coli O157:H7 str. EC869]
 gi|170020449|ref|YP_001725403.1| DNA polymerase V subunit UmuD [Escherichia coli ATCC 8739]
 gi|170080811|ref|YP_001730131.1| DNA polymerase V, subunit D [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187732911|ref|YP_001879965.1| DNA polymerase V subunit UmuD [Shigella boydii CDC 3083-94]
 gi|188493785|ref|ZP_03001055.1| protein UmuD [Escherichia coli 53638]
 gi|191169122|ref|ZP_03030882.1| protein UmuD [Escherichia coli B7A]
 gi|191170936|ref|ZP_03032487.1| protein UmuD [Escherichia coli F11]
 gi|193066783|ref|ZP_03047799.1| protein UmuD [Escherichia coli E22]
 gi|193071165|ref|ZP_03052088.1| protein UmuD [Escherichia coli E110019]
 gi|194430792|ref|ZP_03063189.1| protein UmuD [Escherichia coli B171]
 gi|194437085|ref|ZP_03069184.1| protein UmuD [Escherichia coli 101-1]
 gi|195938838|ref|ZP_03084220.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 str.
           EC4024]
 gi|208809140|ref|ZP_03251477.1| protein UmuD [Escherichia coli O157:H7 str. EC4206]
 gi|208815181|ref|ZP_03256360.1| protein UmuD [Escherichia coli O157:H7 str. EC4045]
 gi|208822366|ref|ZP_03262685.1| protein UmuD [Escherichia coli O157:H7 str. EC4042]
 gi|209400795|ref|YP_002270123.1| protein UmuD [Escherichia coli O157:H7 str. EC4115]
 gi|209918422|ref|YP_002292506.1| DNA polymerase V subunit UmuD [Escherichia coli SE11]
 gi|217328507|ref|ZP_03444589.1| protein UmuD [Escherichia coli O157:H7 str. TW14588]
 gi|218553738|ref|YP_002386651.1| DNA polymerase V subunit UmuD [Escherichia coli IAI1]
 gi|218694697|ref|YP_002402364.1| DNA polymerase V subunit UmuD [Escherichia coli 55989]
 gi|218704698|ref|YP_002412217.1| DNA polymerase V subunit UmuD [Escherichia coli UMN026]
 gi|238900414|ref|YP_002926210.1| DNA polymerase V, subunit D [Escherichia coli BW2952]
 gi|253773819|ref|YP_003036650.1| DNA polymerase V subunit UmuD [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161265|ref|YP_003044373.1| DNA polymerase V subunit UmuD [Escherichia coli B str. REL606]
 gi|254792660|ref|YP_003077497.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 str.
           TW14359]
 gi|256018567|ref|ZP_05432432.1| DNA polymerase V subunit UmuD [Shigella sp. D9]
 gi|256023141|ref|ZP_05437006.1| DNA polymerase V subunit UmuD [Escherichia sp. 4_1_40B]
 gi|260843475|ref|YP_003221253.1| DNA polymerase V subunit D [Escherichia coli O103:H2 str. 12009]
 gi|260854844|ref|YP_003228735.1| DNA polymerase V subunit D [Escherichia coli O26:H11 str. 11368]
 gi|261224920|ref|ZP_05939201.1| DNA polymerase V, subunit D [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257223|ref|ZP_05949756.1| DNA polymerase V subunit D [Escherichia coli O157:H7 str. FRIK966]
 gi|291282198|ref|YP_003499016.1| DNA polymerase V subunit UmuD [Escherichia coli O55:H7 str. CB9615]
 gi|293404718|ref|ZP_06648710.1| DNA polymerase V subunit UmuD [Escherichia coli FVEC1412]
 gi|293409561|ref|ZP_06653137.1| DNA polymerase V subunit UmuD [Escherichia coli B354]
 gi|293414453|ref|ZP_06657102.1| DNA polymerase V subunit UmuD [Escherichia coli B185]
 gi|293433501|ref|ZP_06661929.1| DNA polymerase V subunit UmuD [Escherichia coli B088]
 gi|297516123|ref|ZP_06934509.1| DNA polymerase V subunit UmuD [Escherichia coli OP50]
 gi|298380361|ref|ZP_06989960.1| DNA polymerase V subunit UmuD [Escherichia coli FVEC1302]
 gi|300816870|ref|ZP_07097090.1| peptidase S24-like domain protein [Escherichia coli MS 107-1]
 gi|300821050|ref|ZP_07101199.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
 gi|300896557|ref|ZP_07115078.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
 gi|300906914|ref|ZP_07124588.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|300917942|ref|ZP_07134573.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
 gi|300921855|ref|ZP_07138012.1| peptidase S24-like domain protein [Escherichia coli MS 182-1]
 gi|300928274|ref|ZP_07143811.1| peptidase S24-like domain protein [Escherichia coli MS 187-1]
 gi|300951645|ref|ZP_07165469.1| peptidase S24-like domain protein [Escherichia coli MS 116-1]
 gi|300955578|ref|ZP_07167937.1| peptidase S24-like domain protein [Escherichia coli MS 175-1]
 gi|300996032|ref|ZP_07181366.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|301017203|ref|ZP_07181984.1| peptidase S24-like domain protein [Escherichia coli MS 69-1]
 gi|301029520|ref|ZP_07192600.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
 gi|301307334|ref|ZP_07213343.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|301327108|ref|ZP_07220388.1| peptidase S24-like domain protein [Escherichia coli MS 78-1]
 gi|307310063|ref|ZP_07589713.1| Peptidase S24/S26A/S26B, conserved region [Escherichia coli W]
 gi|309794268|ref|ZP_07688692.1| peptidase S24-like domain protein [Escherichia coli MS 145-7]
 gi|312971365|ref|ZP_07785540.1| protein umuD [Escherichia coli 1827-70]
 gi|331657227|ref|ZP_08358189.1| protein UmuD [Escherichia coli TA206]
 gi|331662576|ref|ZP_08363499.1| protein UmuD [Escherichia coli TA143]
 gi|331667564|ref|ZP_08368428.1| protein UmuD [Escherichia coli TA271]
 gi|331676959|ref|ZP_08377655.1| protein UmuD [Escherichia coli H591]
 gi|332279629|ref|ZP_08392042.1| UmuD protein [Shigella sp. D9]
 gi|84029417|sp|P0AG12|UMUD_ECO57 RecName: Full=Protein umuD; Contains: RecName: Full=Protein umuD'
 gi|84029418|sp|P0AG11|UMUD_ECOLI RecName: Full=Protein umuD; Contains: RecName: Full=Protein umuD'
 gi|84029419|sp|P0AG13|UMUD_SHIFL RecName: Full=Protein umuD; Contains: RecName: Full=Protein umuD'
 gi|12514880|gb|AAG56034.1|AE005335_7 SOS mutagenesis; error-prone repair; processed to UmuD'; forms
           complex with UmuC [Escherichia coli O157:H7 str. EDL933]
 gi|148125|gb|AAA24728.1| UmuD protein [Escherichia coli]
 gi|148128|gb|AAA98073.1| umuD [Escherichia coli]
 gi|1651580|dbj|BAA36030.1| DNA polymerase V, subunit D [Escherichia coli str. K12 substr.
           W3110]
 gi|1787431|gb|AAC74267.1| DNA polymerase V, subunit D [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13361142|dbj|BAB35101.1| UmuD protein [Escherichia coli O157:H7 str. Sakai]
 gi|24051468|gb|AAN42787.1| mutagenesis and repair protein [Shigella flexneri 2a str. 301]
 gi|30040948|gb|AAP16678.1| mutagenesis and repair protein [Shigella flexneri 2a str. 2457T]
 gi|73855190|gb|AAZ87897.1| UmuD [Shigella sonnei Ss046]
 gi|81245775|gb|ABB66483.1| UmuD [Shigella boydii Sb227]
 gi|110343000|gb|ABG69237.1| UmuD protein [Escherichia coli 536]
 gi|110614730|gb|ABF03397.1| SOS mutagenesis [Shigella flexneri 5 str. 8401]
 gi|157066366|gb|ABV05621.1| protein UmuD [Escherichia coli HS]
 gi|157081429|gb|ABV21137.1| protein UmuD [Escherichia coli E24377A]
 gi|169755377|gb|ACA78076.1| peptidase S24 and S26 domain protein [Escherichia coli ATCC 8739]
 gi|169888646|gb|ACB02353.1| DNA polymerase V, subunit D [Escherichia coli str. K-12 substr.
           DH10B]
 gi|187429903|gb|ACD09177.1| protein UmuD [Shigella boydii CDC 3083-94]
 gi|187766778|gb|EDU30622.1| protein UmuD [Escherichia coli O157:H7 str. EC4196]
 gi|188013531|gb|EDU51653.1| protein UmuD [Escherichia coli O157:H7 str. EC4113]
 gi|188488984|gb|EDU64087.1| protein UmuD [Escherichia coli 53638]
 gi|189000043|gb|EDU69029.1| protein UmuD [Escherichia coli O157:H7 str. EC4076]
 gi|189356367|gb|EDU74786.1| protein UmuD [Escherichia coli O157:H7 str. EC4401]
 gi|189360079|gb|EDU78498.1| protein UmuD [Escherichia coli O157:H7 str. EC4486]
 gi|189372424|gb|EDU90840.1| protein UmuD [Escherichia coli O157:H7 str. EC869]
 gi|190900836|gb|EDV60625.1| protein UmuD [Escherichia coli B7A]
 gi|190908668|gb|EDV68256.1| protein UmuD [Escherichia coli F11]
 gi|192925573|gb|EDV80251.1| protein UmuD [Escherichia coli E22]
 gi|192955497|gb|EDV85977.1| protein UmuD [Escherichia coli E110019]
 gi|194411164|gb|EDX27589.1| protein UmuD [Escherichia coli B171]
 gi|194424068|gb|EDX40056.1| protein UmuD [Escherichia coli 101-1]
 gi|208728941|gb|EDZ78542.1| protein UmuD [Escherichia coli O157:H7 str. EC4206]
 gi|208731829|gb|EDZ80517.1| protein UmuD [Escherichia coli O157:H7 str. EC4045]
 gi|208737851|gb|EDZ85534.1| protein UmuD [Escherichia coli O157:H7 str. EC4042]
 gi|209162195|gb|ACI39628.1| protein UmuD [Escherichia coli O157:H7 str. EC4115]
 gi|209772708|gb|ACI84666.1| UmuD protein [Escherichia coli]
 gi|209772710|gb|ACI84667.1| UmuD protein [Escherichia coli]
 gi|209772712|gb|ACI84668.1| UmuD protein [Escherichia coli]
 gi|209772714|gb|ACI84669.1| UmuD protein [Escherichia coli]
 gi|209772716|gb|ACI84670.1| UmuD protein [Escherichia coli]
 gi|209911681|dbj|BAG76755.1| mutagenesis and repair protein UmuD [Escherichia coli SE11]
 gi|217318934|gb|EEC27360.1| protein UmuD [Escherichia coli O157:H7 str. TW14588]
 gi|218351429|emb|CAU97137.1| DNA polymerase V, subunit D [Escherichia coli 55989]
 gi|218360506|emb|CAQ98062.1| DNA polymerase V, subunit D [Escherichia coli IAI1]
 gi|218431795|emb|CAR12680.1| DNA polymerase V, subunit D [Escherichia coli UMN026]
 gi|238860840|gb|ACR62838.1| DNA polymerase V, subunit D [Escherichia coli BW2952]
 gi|242376963|emb|CAQ31685.1| SOS mutagenesis; error-prone repair; processed to UmuD'; forms
           complex with UmuC, subunit of DNA polymerase V
           [Escherichia coli BL21(DE3)]
 gi|253324863|gb|ACT29465.1| peptidase S24 and S26 domain protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973166|gb|ACT38837.1| DNA polymerase V, subunit D [Escherichia coli B str. REL606]
 gi|253977380|gb|ACT43050.1| DNA polymerase V, subunit D [Escherichia coli BL21(DE3)]
 gi|254592060|gb|ACT71421.1| DNA polymerase V, subunit D [Escherichia coli O157:H7 str. TW14359]
 gi|257753493|dbj|BAI24995.1| DNA polymerase V subunit D [Escherichia coli O26:H11 str. 11368]
 gi|257758622|dbj|BAI30119.1| DNA polymerase V subunit D [Escherichia coli O103:H2 str. 12009]
 gi|260449683|gb|ACX40105.1| peptidase S24 and S26 domain protein [Escherichia coli DH1]
 gi|281600596|gb|ADA73580.1| DNA polymerase V subunit [Shigella flexneri 2002017]
 gi|284920987|emb|CBG34052.1| SOS mutagenesis and repair protein [Escherichia coli 042]
 gi|290762071|gb|ADD56032.1| DNA polymerase V subunit UmuD [Escherichia coli O55:H7 str. CB9615]
 gi|291324320|gb|EFE63742.1| DNA polymerase V subunit UmuD [Escherichia coli B088]
 gi|291426926|gb|EFE99952.1| DNA polymerase V subunit UmuD [Escherichia coli FVEC1412]
 gi|291434511|gb|EFF07484.1| DNA polymerase V subunit UmuD [Escherichia coli B185]
 gi|291470029|gb|EFF12513.1| DNA polymerase V subunit UmuD [Escherichia coli B354]
 gi|298277803|gb|EFI19317.1| DNA polymerase V subunit UmuD [Escherichia coli FVEC1302]
 gi|299877584|gb|EFI85795.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
 gi|300304639|gb|EFJ59159.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|300317554|gb|EFJ67338.1| peptidase S24-like domain protein [Escherichia coli MS 175-1]
 gi|300359586|gb|EFJ75456.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
 gi|300400334|gb|EFJ83872.1| peptidase S24-like domain protein [Escherichia coli MS 69-1]
 gi|300401347|gb|EFJ84885.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|300414855|gb|EFJ98165.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
 gi|300421781|gb|EFK05092.1| peptidase S24-like domain protein [Escherichia coli MS 182-1]
 gi|300449091|gb|EFK12711.1| peptidase S24-like domain protein [Escherichia coli MS 116-1]
 gi|300463743|gb|EFK27236.1| peptidase S24-like domain protein [Escherichia coli MS 187-1]
 gi|300526349|gb|EFK47418.1| peptidase S24-like domain protein [Escherichia coli MS 119-7]
 gi|300530644|gb|EFK51706.1| peptidase S24-like domain protein [Escherichia coli MS 107-1]
 gi|300837480|gb|EFK65240.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|300846286|gb|EFK74046.1| peptidase S24-like domain protein [Escherichia coli MS 78-1]
 gi|306909781|gb|EFN40275.1| Peptidase S24/S26A/S26B, conserved region [Escherichia coli W]
 gi|308122173|gb|EFO59435.1| peptidase S24-like domain protein [Escherichia coli MS 145-7]
 gi|309701483|emb|CBJ00790.1| SOS mutagenesis and repair protein [Escherichia coli ETEC H10407]
 gi|310335962|gb|EFQ01162.1| protein umuD [Escherichia coli 1827-70]
 gi|313649361|gb|EFS13792.1| UmuD protein [Shigella flexneri 2a str. 2457T]
 gi|315060433|gb|ADT74760.1| DNA polymerase V, subunit D [Escherichia coli W]
 gi|315135819|dbj|BAJ42978.1| DNA polymerase V subunit UmuD [Escherichia coli DH1]
 gi|315254862|gb|EFU34830.1| peptidase S24-like domain protein [Escherichia coli MS 85-1]
 gi|320181810|gb|EFW56720.1| Error-prone repair protein UmuD [Shigella boydii ATCC 9905]
 gi|320183054|gb|EFW57918.1| Error-prone repair protein UmuD [Shigella flexneri CDC 796-83]
 gi|320187967|gb|EFW62634.1| Error-prone repair protein UmuD [Escherichia coli O157:H7 str.
           EC1212]
 gi|320195837|gb|EFW70462.1| Error-prone repair protein UmuD [Escherichia coli WV_060327]
 gi|320199220|gb|EFW73811.1| Error-prone repair protein UmuD [Escherichia coli EC4100B]
 gi|320637328|gb|EFX07135.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 str. G5101]
 gi|320643189|gb|EFX12390.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H- str.
           493-89]
 gi|320648126|gb|EFX16802.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H- str. H
           2687]
 gi|320653960|gb|EFX22034.1| DNA polymerase V subunit UmuD [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320659439|gb|EFX27008.1| DNA polymerase V subunit UmuD [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320664576|gb|EFX31727.1| DNA polymerase V subunit UmuD [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323153149|gb|EFZ39413.1| UmuD protein [Escherichia coli EPECa14]
 gi|323162294|gb|EFZ48152.1| protein umuD [Escherichia coli E128010]
 gi|323165667|gb|EFZ51454.1| protein umuD [Shigella sonnei 53G]
 gi|323172469|gb|EFZ58106.1| protein umuD [Escherichia coli LT-68]
 gi|323185656|gb|EFZ71017.1| protein umuD [Escherichia coli 1357]
 gi|323379004|gb|ADX51272.1| Peptidase S24/S26A/S26B, conserved region [Escherichia coli KO11]
 gi|323937901|gb|EGB34165.1| peptidase S24 [Escherichia coli E1520]
 gi|323942461|gb|EGB38629.1| peptidase S24 [Escherichia coli E482]
 gi|323947535|gb|EGB43539.1| peptidase S24 [Escherichia coli H120]
 gi|323962760|gb|EGB58338.1| peptidase S24 [Escherichia coli H489]
 gi|323964674|gb|EGB60145.1| peptidase S24 [Escherichia coli M863]
 gi|323973420|gb|EGB68607.1| peptidase S24 [Escherichia coli TA007]
 gi|323977255|gb|EGB72342.1| peptidase S24 [Escherichia coli TW10509]
 gi|324015677|gb|EGB84896.1| peptidase S24-like domain protein [Escherichia coli MS 60-1]
 gi|324017572|gb|EGB86791.1| peptidase S24-like domain protein [Escherichia coli MS 117-3]
 gi|324117269|gb|EGC11176.1| peptidase S24 [Escherichia coli E1167]
 gi|326342722|gb|EGD66492.1| Error-prone repair protein UmuD [Escherichia coli O157:H7 str.
           1044]
 gi|326346428|gb|EGD70165.1| Error-prone repair protein UmuD [Escherichia coli O157:H7 str.
           1125]
 gi|327253865|gb|EGE65494.1| protein umuD [Escherichia coli STEC_7v]
 gi|331055475|gb|EGI27484.1| protein UmuD [Escherichia coli TA206]
 gi|331060998|gb|EGI32962.1| protein UmuD [Escherichia coli TA143]
 gi|331065149|gb|EGI37044.1| protein UmuD [Escherichia coli TA271]
 gi|331075648|gb|EGI46946.1| protein UmuD [Escherichia coli H591]
 gi|332094406|gb|EGI99455.1| protein umuD [Shigella boydii 3594-74]
 gi|332101981|gb|EGJ05327.1| UmuD protein [Shigella sp. D9]
 gi|332342762|gb|AEE56096.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332757824|gb|EGJ88151.1| protein umuD [Shigella flexneri 4343-70]
 gi|332759425|gb|EGJ89733.1| protein umuD [Shigella flexneri 2747-71]
 gi|332760265|gb|EGJ90555.1| protein umuD [Shigella flexneri K-671]
 gi|332767406|gb|EGJ97600.1| UmuD protein [Shigella flexneri 2930-71]
 gi|333005615|gb|EGK25133.1| protein umuD [Shigella flexneri K-218]
 gi|333019357|gb|EGK38640.1| protein umuD [Shigella flexneri K-304]
          Length = 139

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYVE--QRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|315930359|gb|EFV09439.1| peptidase S24-like family protein [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 222

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 66/194 (34%), Gaps = 20/194 (10%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G++P +FN  K        +      I   L   N +I  
Sbjct: 25  DILASEGKRDLKTKDIAKELGINPDTFNSMKFRNSIPYPQ------ILNFLNERNISINY 78

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + + +I  LY   +  GG         G   + +   E+        
Sbjct: 79  FFYGVSPKDQLECENKYKILKLYKTNASLGG---------GGINDLIDCSELIVDEKLLN 129

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 130 FFGSKECEFITCYGESMEPLIKDGSICVIDRNKTFKNKSICVINTRDG-LFIKQVLKQDD 188

Query: 191 RSIDLMSLNCCYPV 204
             I L SLN  Y  
Sbjct: 189 GVI-LHSLNPLYKD 201


>gi|333005008|gb|EGK24528.1| protein umuD [Shigella flexneri VA-6]
          Length = 139

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYVE--QRIDLNQRLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|302129811|ref|ZP_07255801.1| putative phage repressor [Pseudomonas syringae pv. tomato NCPPB
           1108]
          Length = 259

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 31/85 (36%), Gaps = 6/85 (7%)

Query: 142 TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN-C 200
               SM P+   G  ++ N    +    ++ +    G I  K L    G  I + S N  
Sbjct: 170 ISGNSMSPVLHDGSTVLANMNESLVVDGKMYVIDHGGQIRVKALYRLPGGGIRVRSYNTA 229

Query: 201 CYPV-----DTVEMSDIEWIARILW 220
            +P        +E S I  + R+ W
Sbjct: 230 EHPDETYTAREMEDSRIRIMGRVFW 254


>gi|308047905|ref|YP_003911471.1| SOS-response transcriptional repressor, LexA [Ferrimonas balearica
           DSM 9799]
 gi|307630095|gb|ADN74397.1| SOS-response transcriptional repressor, LexA [Ferrimonas balearica
           DSM 9799]
          Length = 207

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 31/81 (38%), Gaps = 2/81 (2%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
            + +   + +  SM  +    GD+L ++       G  ++ +    ++  K    R G  
Sbjct: 111 PSANYLLRVRGDSMKEIGILDGDLLAVHQTQDARNGQVVVARVGEDEVTVKRFERR-GNV 169

Query: 193 IDLMSLNCCYPVDTVEMSDIE 213
           + L + N  Y    V++ D  
Sbjct: 170 VYLHAENAEYEPIVVDLEDTA 190


>gi|293381388|ref|ZP_06627389.1| signal peptidase I [Lactobacillus crispatus 214-1]
 gi|290922078|gb|EFD99079.1| signal peptidase I [Lactobacillus crispatus 214-1]
          Length = 210

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT--GDIVAKVLISRRGRSI 193
                SM P ++ GD LI     Q+  G+ +++K     G +  K +I   G  I
Sbjct: 41  TVSGPSMQPTFQNGDRLIAERHAQIKRGEVVIVKAPDEPGALYIKRVIGLPGEKI 95


>gi|256843912|ref|ZP_05549399.1| signal peptidase I [Lactobacillus crispatus 125-2-CHN]
 gi|295693815|ref|YP_003602425.1| signal peptidase i [Lactobacillus crispatus ST1]
 gi|256613817|gb|EEU19019.1| signal peptidase I [Lactobacillus crispatus 125-2-CHN]
 gi|295031921|emb|CBL51400.1| Signal peptidase I [Lactobacillus crispatus ST1]
          Length = 210

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT--GDIVAKVLISRRGRSI 193
                SM P ++ GD LI     Q+  G+ +++K     G +  K +I   G  I
Sbjct: 41  TVSGPSMQPTFQNGDRLIAERHAQIKRGEVVIVKAPDEPGALYIKRVIGLPGEKI 95


>gi|299483505|gb|ADJ19586.1| putative transcriptional repressor protein [Treponema primitia
           ZAS-2]
          Length = 242

 Score = 43.4 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 72/200 (36%), Gaps = 30/200 (15%)

Query: 21  NLTPSGLARKAGLDPTSFNKSKRFG---IEGRNRWPSTESIFKILAATNETICQLLDLPF 77
            LT  G A   GL       SK  G     G  + PS E++ K+    N  +   L    
Sbjct: 51  GLTKKGFAESLGL-------SKALGYQISTGMLK-PSRETLEKLSFIYNVNLNWFL---L 99

Query: 78  SDGRTTEKKEKEIPLL-YFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
            +G   E ++  I LL     +G G   +        +  T+ +P           +Q  
Sbjct: 100 GEGSPFETEKATIKLLRQEAAAGQGREIEDY-----AEEETLKLPRSLISPYRPENLQ-- 152

Query: 137 DTRHKTQDTSM--LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI-SRRGRSI 193
                    SM    +Y  GD +I +    +  G+ + +      ++ K +      RS+
Sbjct: 153 --AVYVAGDSMIGEHIY-NGDAVIFHPG--LTEGNGIYVLSLDTSLLVKRVSFDELPRSV 207

Query: 194 DLMSLNCCYPVDTVEMSDIE 213
            L+S N  YP   +  +++E
Sbjct: 208 FLISANPAYPPRQISGAELE 227


>gi|218884748|ref|YP_002429130.1| signal peptidase [Desulfurococcus kamchatkensis 1221n]
 gi|218766364|gb|ACL11763.1| signal peptidase [Desulfurococcus kamchatkensis 1221n]
          Length = 152

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ--VNCGDRLLIKPRTGDIVA 182
           +         +  SMLP  R+GDI+I+  A    +  GD ++I    G ++ 
Sbjct: 34  LNGFSPLAVVKGYSMLPTLREGDIVIVQKATPEAIRPGD-VIIYSTGGKLII 84


>gi|114771089|ref|ZP_01448529.1| LexA repressor [alpha proteobacterium HTCC2255]
 gi|114548371|gb|EAU51257.1| LexA repressor [alpha proteobacterium HTCC2255]
          Length = 228

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 66/205 (32%), Gaps = 38/205 (18%)

Query: 42  KRFGIEGRNRWPSTESIFKILAA-TNETICQLLDLPFSDG--RTTEKKEKEIPLLYFPPS 98
           KR   +G    PS + + + L   +   I +L+      G  R    + + I +L  P S
Sbjct: 15  KRLQKDGVP--PSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHRARAIEILRLPES 72

Query: 99  GSGGFFDS------------GVFPTGNKWNTVGVPEIRSPHNG--IYAIQ---------- 134
             GG F                 P     N + +P +     G  I AIQ          
Sbjct: 73  IDGGGFQPRIIEGSLTPPPAAALPIEAA-NALTLPIMGRIAAGTPIEAIQQVSNNVSVPG 131

Query: 135 ------TQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  +    + +  SM       GDI+++N       GD ++      +   K L  
Sbjct: 132 EMLKNSGRHYALEVKGDSMIEAGINDGDIVVINEQNDAENGDIVVALVDDQEATLKRL-R 190

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDI 212
           +RG  + L + N  Y         +
Sbjct: 191 KRGTVVALEAANPAYETRVYRDDQV 215


>gi|15802659|ref|NP_288686.1| putative repressor protein CI of prophage CP-933V [Escherichia coli
           O157:H7 EDL933]
 gi|12516411|gb|AAG57241.1|AE005443_9 putative repressor protein CI of prophage CP-933V [Escherichia coli
           O157:H7 str. EDL933]
          Length = 215

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 66/215 (30%), Gaps = 32/215 (14%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK---------RFGIEGRNRWPSTE 56
           H+ I E I  + E   L+ + LA+  G        S+         +   +         
Sbjct: 5   HEIIGERIKSLREAKGLSQAQLAKLCGWAA----PSRLGNYELGTRKVSADD-------- 52

Query: 57  SIFKIL-AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
               +L AA   +      + F +      ++ E PL     +   G F      T +  
Sbjct: 53  --ALVLGAALGVSP---AKIMFGEDSDAVFRQYEYPLFSSVQA---GPFXEVGXYTASDA 104

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
               VP         + ++ +     T    + P + +G +++++ A  V  GD  +   
Sbjct: 105 KAW-VPTTTKASEKAFWLEVKGHSM-TAPQGVRPSFPEGMLILVDPAEPVESGDFCVASA 162

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
                       +      L+ LN  Y     + S
Sbjct: 163 NGDSEATFKKYEKDAGVSYLVPLNPAYRTLDCDHS 197


>gi|86609770|ref|YP_478532.1| S24 family peptidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558312|gb|ABD03269.1| peptidase, S24 (LexA) family [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 219

 Score = 43.4 bits (101), Expect = 0.023,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 33/82 (40%), Gaps = 7/82 (8%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR----LLIKPRTGDIVAKVLISRR 189
             + +  + Q  SM P    GD + +        GD     + +    GD++ K L    
Sbjct: 123 PAELSLIRVQGDSMSPTLEDGDWIFVERQ---EGGDLGCEGIYVFQMDGDLLVKRLQRLP 179

Query: 190 GRSIDLMSLNCCYPVDTVEMSD 211
           G  + ++S N  +P    +++D
Sbjct: 180 GSQVKVISDNPRFPPFVADLAD 201


>gi|257463935|ref|ZP_05628320.1| SOS-response transcriptional repressor, LexA [Fusobacterium sp.
           D12]
 gi|317061461|ref|ZP_07925946.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313687137|gb|EFS23972.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 214

 Score = 43.4 bits (101), Expect = 0.024,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 45/128 (35%), Gaps = 16/128 (12%)

Query: 84  EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
           E+    IPL     +G  G F           + + +P +R+               + +
Sbjct: 88  EEGPAAIPLFPRISAGI-GVFGEE-----EVEDYISIPGVRNLEEVF--------SVRVK 133

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
             SM P  R   I++    +Q++ G  +      G+   K L  +    I LMS N  Y 
Sbjct: 134 GDSMEPTIRNSSIIVCRQNMQIHNG-EIGAFLVNGEAFVKRLQVKS-DYIVLMSDNPNYQ 191

Query: 204 VDTVEMSD 211
              +  SD
Sbjct: 192 PIYISPSD 199


>gi|253577142|ref|ZP_04854463.1| LexA repressor [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843524|gb|EES71551.1| LexA repressor [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 208

 Score = 43.4 bits (101), Expect = 0.024,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 38/148 (25%), Gaps = 24/148 (16%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFD------------SGVFPTGNKW---NTVGVPEIRS 125
           R    K + I LL    S +   F             +   P        +   +PE   
Sbjct: 57  RRDPTKPRAIELLGQEESENYNLFAHSVTRVPIVGKVTAGVPITATENIEDYFPLPEH-- 114

Query: 126 PHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                YA             SM       GD +I+      N GD ++      +   K 
Sbjct: 115 -----YAADGDIFMLSVVGDSMIEAGIHNGDYVIVRQQQTANNGDIVVAMTEDDEATVKT 169

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDI 212
              +    I L   N       ++   I
Sbjct: 170 F-YKESDHIRLQPENSTMEPLRLKHVTI 196


>gi|319956938|ref|YP_004168201.1| phage repressor [Nitratifractor salsuginis DSM 16511]
 gi|319419342|gb|ADV46452.1| putative phage repressor [Nitratifractor salsuginis DSM 16511]
          Length = 200

 Score = 43.4 bits (101), Expect = 0.025,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 47/148 (31%), Gaps = 28/148 (18%)

Query: 79  DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN---TVGVPEIRSPHNGIYAIQT 135
           D        + IPL+            S   PTG  +     + VP      +  YA++ 
Sbjct: 64  DETQEIPLNRYIPLIGEA---------SCGVPTGAFYESDEYIAVP-PGVDASSSYAVKA 113

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLISRRGRSID 194
                     SM P    G+I++ ++       D  ++     G+   K +  +   S+ 
Sbjct: 114 -------SGDSMWPTIADGEIVVCDTKRPP--SDNSVVHYTFDGESGIKRVKRQSDGSVI 164

Query: 195 LMSLNCCYP---VDTVEMSDIE--WIAR 217
           L+  N          +    +   + AR
Sbjct: 165 LLPDNTSCEGCTPIVIPKDRVAELYTAR 192


>gi|119961687|ref|YP_947146.1| SOS mutagenesis protein UmuD [Arthrobacter aurescens TC1]
 gi|119948546|gb|ABM07457.1| putative SOS mutagenesis protein UmuD [Arthrobacter aurescens TC1]
          Length = 143

 Score = 43.4 bits (101), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 35/105 (33%), Gaps = 6/105 (5%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  +P+               +  +    T     +    SM       GD LI+N A++
Sbjct: 27  AAGYPSPA---QDYFDGRIDLNEHLIKDVTSTFVVRVTGQSMEGAGISDGDELIVNRALE 83

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
              G  +++    G++  K L       + L + N  YP   V  
Sbjct: 84  PKDGS-VVVAVLDGELTIKRL-RVTPSGVILQADNPKYPDIRVPA 126


>gi|227522302|ref|ZP_03952351.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus hilgardii ATCC 8290]
 gi|227090509|gb|EEI25821.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus hilgardii ATCC 8290]
          Length = 235

 Score = 43.4 bits (101), Expect = 0.025,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 35/85 (41%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSID 194
             D        SM PL +KG  + ++   +V  G+  ++  R   +  K +      ++ 
Sbjct: 150 GADELITVDGDSMEPLLKKGSQVFIHYQPEVEDGEIAIVHIRDIGVTCKKIYVNEDNTVT 209

Query: 195 LMSLNCCYPVDTVEMSDIEWIARIL 219
           L S+N  Y     +  ++  I +++
Sbjct: 210 LRSINEAYDDMHFDCDEVNVIGKVI 234


>gi|229844478|ref|ZP_04464618.1| putative prophage repressor [Haemophilus influenzae 6P18H1]
 gi|229812727|gb|EEP48416.1| putative prophage repressor [Haemophilus influenzae 6P18H1]
          Length = 221

 Score = 43.4 bits (101), Expect = 0.025,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 37/90 (41%), Gaps = 10/90 (11%)

Query: 136 QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA---KVLISRRGRS 192
                + +  SMLP + +GD+++++  I    G  +       +      K L +R    
Sbjct: 126 NSFYLRIERKSMLPRFNEGDLVLIDPDIAPTPGKFVAAINGNNEATFKQYKELGTRTSEG 185

Query: 193 I---DLMSLNCCYPVDTVEMSDIEWIARIL 219
           I   +L+ LN  +P  +    DI    RI+
Sbjct: 186 IPHFELVPLNPMFPTLSSLNQDI----RII 211


>gi|229098164|ref|ZP_04229112.1| Phage transcriptional repressor [Bacillus cereus Rock3-29]
 gi|228685355|gb|EEL39285.1| Phage transcriptional repressor [Bacillus cereus Rock3-29]
          Length = 223

 Score = 43.4 bits (101), Expect = 0.025,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 77/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 13  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLEV 68

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L      T              +     IP++    +G+  F +  +           +P
Sbjct: 69  LTTKGDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENI--------EGYLP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 121 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 176

Query: 182 AKVLISRRGRSIDLMSLN--CCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L+    +   T  +   D++ I R++ A
Sbjct: 177 VKKIS-KSGSIITLIPLSNHPIHEPQTYDLSAEDVKIIGRVVQA 219


>gi|11138336|gb|AAG31331.1|AF182207_5 ORF 221 [Lactobacillus phage mv4]
          Length = 221

 Score = 43.4 bits (101), Expect = 0.026,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 55/156 (35%), Gaps = 17/156 (10%)

Query: 56  ESIFKILAATNETIC-QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           E +      +NE I  +   +P +     +    +IPL+     G     D  +      
Sbjct: 62  EKLADFFRVSNEEIDPRFATMPENMVPVDQSHLVKIPLIGHIACGEPITADQNI----EG 117

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           + T   P+   P + I+A++ +         SM P    GDI  +    +V  G  +   
Sbjct: 118 YITEYFPDHVDPDS-IFALKCE-------GDSMEPYILDGDIAYIRQQPEVEDG-EIAAV 168

Query: 175 PRTGDIVAKVLIS--RRGRSIDLMSLNCCYPVDTVE 208
              GD  A  L    + G  + L+  N  Y    ++
Sbjct: 169 LVDGDTRAS-LKRVKKVGNQVFLLPDNPHYSPIVLD 203


>gi|99081161|ref|YP_613315.1| putative phage repressor [Ruegeria sp. TM1040]
 gi|99037441|gb|ABF64053.1| hypothetical protein TM1040_1320 [Ruegeria sp. TM1040]
          Length = 211

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 61/166 (36%), Gaps = 25/166 (15%)

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTV 118
           +I A+    +   L     +G T       I +     +G+    FD+  +P G     V
Sbjct: 52  RIAASFGTNLENFL-----EGNTAPSVRPTISIAGTVGAGAQVPVFDA--YPKGGG-PQV 103

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC-----GDRLLI 173
             P   SPH GI A++        +  SM P+Y   D+L  +     +      G R + 
Sbjct: 104 ECPPGLSPH-GIVAVE-------VEGDSMEPVYSDRDLLFYSRNGHDSVPSDIIGHRCVC 155

Query: 174 KPRTGDIVAKVLIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +   G    K + +        L+SLN       +    ++W AR+
Sbjct: 156 EDEDGMGWVKQVKAGDEPGLFHLISLNPGANN--IWNVRLKWAARV 199


>gi|239834287|ref|ZP_04682615.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
 gi|239822350|gb|EEQ93919.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
          Length = 264

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 48/142 (33%), Gaps = 27/142 (19%)

Query: 87  EKEIPLLYFPPSGSGGF---FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQ 143
           ++++P+      G G     FD   +        + +P +     G Y +          
Sbjct: 135 QRDLPVYAAAKGGDGHVIITFDPISY--------MKMPAVLQGVKGGYGL-------LLS 179

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLI----KPRTGDIVAKVLISRRGRSIDLMSLN 199
             SM+P YR G+  ++N  +     + +++    +    + + K L+    R   L   N
Sbjct: 180 GESMVPAYRPGETALVNPNLPPMRDEDVILYHTSEMDENEAIIKRLVGYNDREWMLEQYN 239

Query: 200 CCYPVDTVEMSDIEW--IARIL 219
                        +W    R++
Sbjct: 240 PHKEFKEFRA---DWPVCHRVV 258


>gi|85703338|ref|ZP_01034442.1| LexA repressor [Roseovarius sp. 217]
 gi|85672266|gb|EAQ27123.1| LexA repressor [Roseovarius sp. 217]
          Length = 233

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 30/86 (34%), Gaps = 2/86 (2%)

Query: 135 TQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                 + +  SM       GD++I+      + GD ++      +   K    R G +I
Sbjct: 143 ANHYALEVRGDSMIEAGINDGDVVIIRETSVADNGDIVVALIEDQEATLKRFYRR-GNAI 201

Query: 194 DLMSLNCCYPVDTVEMSDIEWIARIL 219
            L + N  Y         ++   R++
Sbjct: 202 ALEAANPAYETRLFPEDQVQVQGRLV 227


>gi|300717122|ref|YP_003741925.1| DNA polymerase V, subunit D [Erwinia billingiae Eb661]
 gi|299062958|emb|CAX60078.1| DNA polymerase V, subunit D [Erwinia billingiae Eb661]
          Length = 139

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 7/102 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVN 166
            FP+    + V        +  + +  +     +    SM       GD+L+++S+++  
Sbjct: 25  GFPSPAA-DYVE--SRIDLNELLVSHPSATYFIRAAGNSMIEGNINDGDMLVVDSSLKPQ 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
            GDR++     G+   K L      S+ L+ +N  Y    ++
Sbjct: 82  HGDRVIAAI-DGEFTLKKLQ-LTP-SVKLLPMNPSYAAIDID 120


>gi|34541026|ref|NP_905505.1| umuD protein [Porphyromonas gingivalis W83]
 gi|34397341|gb|AAQ66404.1| umuD protein [Porphyromonas gingivalis W83]
          Length = 141

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 49/136 (36%), Gaps = 19/136 (13%)

Query: 92  LLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLY 151
           LL F   G         FP+    + + +      ++ +          + +  SM   +
Sbjct: 14  LLPFADEGI-----RAGFPS-PAQDYMDI--AIDLNHELITHPYSTFYGRVKGNSMEDAH 65

Query: 152 R-KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
              GDIL+++ +++   GD + +    G+   K +   +   I L   N  YP   V   
Sbjct: 66  VFDGDILVIDKSLEARDGD-MAVCFLDGEFTLKTI-RIKSEEILLEPANPDYPTIHVSAD 123

Query: 211 D--IEW------IARI 218
           +  + W      I +I
Sbjct: 124 NDFVIWGIVTYCIHKI 139


>gi|26247496|ref|NP_753536.1| DNA polymerase V subunit UmuD [Escherichia coli CFT073]
 gi|91210396|ref|YP_540382.1| DNA polymerase V subunit UmuD [Escherichia coli UTI89]
 gi|117623397|ref|YP_852310.1| DNA polymerase V subunit UmuD [Escherichia coli APEC O1]
 gi|218558107|ref|YP_002391020.1| DNA polymerase V subunit UmuD [Escherichia coli S88]
 gi|227886404|ref|ZP_04004209.1| DNA polymerase V subunit UmuD [Escherichia coli 83972]
 gi|237705138|ref|ZP_04535619.1| mutagenesis and repair protein UmuD [Escherichia sp. 3_2_53FAA]
 gi|301046821|ref|ZP_07193939.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|306813923|ref|ZP_07448096.1| DNA polymerase V subunit UmuD [Escherichia coli NC101]
 gi|26107897|gb|AAN80096.1|AE016759_370 UmuD protein [Escherichia coli CFT073]
 gi|85376582|gb|ABC70509.1| UmuD [Escherichia coli]
 gi|91071970|gb|ABE06851.1| UmuD protein [Escherichia coli UTI89]
 gi|115512521|gb|ABJ00596.1| mutagenesis and repair protein UmuD [Escherichia coli APEC O1]
 gi|218364876|emb|CAR02572.1| DNA polymerase V, subunit D [Escherichia coli S88]
 gi|222032978|emb|CAP75718.1| Protein umuD [Escherichia coli LF82]
 gi|226899895|gb|EEH86154.1| mutagenesis and repair protein UmuD [Escherichia sp. 3_2_53FAA]
 gi|227836608|gb|EEJ47074.1| DNA polymerase V subunit UmuD [Escherichia coli 83972]
 gi|294491049|gb|ADE89805.1| protein UmuD [Escherichia coli IHE3034]
 gi|300301240|gb|EFJ57625.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|305852560|gb|EFM53008.1| DNA polymerase V subunit UmuD [Escherichia coli NC101]
 gi|307553233|gb|ADN46008.1| protein UmuD [Escherichia coli ABU 83972]
 gi|307627299|gb|ADN71603.1| DNA polymerase V subunit UmuD [Escherichia coli UM146]
 gi|312945809|gb|ADR26636.1| DNA polymerase V subunit UmuD [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315288605|gb|EFU48003.1| peptidase S24-like domain protein [Escherichia coli MS 110-3]
 gi|315290751|gb|EFU50123.1| peptidase S24-like domain protein [Escherichia coli MS 153-1]
 gi|323187408|gb|EFZ72717.1| protein umuD [Escherichia coli RN587/1]
 gi|323949706|gb|EGB45592.1| peptidase S24 [Escherichia coli H252]
 gi|323953967|gb|EGB49766.1| peptidase S24 [Escherichia coli H263]
 gi|324006037|gb|EGB75256.1| peptidase S24-like domain protein [Escherichia coli MS 57-2]
          Length = 139

 Score = 43.0 bits (100), Expect = 0.027,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYVE--QRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L  +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLTPMNSAYSPITISSED 123


>gi|331672716|ref|ZP_08373502.1| protein UmuD [Escherichia coli TA280]
 gi|331069937|gb|EGI41306.1| protein UmuD [Escherichia coli TA280]
          Length = 139

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPSPAA-DYVE--QRIDLNQLLILHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|315504932|ref|YP_004083819.1| transcriptional repressor, lexa family [Micromonospora sp. L5]
 gi|315411551|gb|ADU09668.1| transcriptional repressor, LexA family [Micromonospora sp. L5]
          Length = 250

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 44/121 (36%), Gaps = 16/121 (13%)

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
                +PL+    +G        +    +    + +P        ++A+         + 
Sbjct: 119 CPGVRVPLVGAIAAGV------PILAEEHVEEILALPSELVGRGTLFAL-------HVRG 165

Query: 145 TSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYP 203
            SM       GD++++   +    GD ++      +   KV  SR G+ ++L+  N  YP
Sbjct: 166 DSMIEAGIADGDVIVVRQQVSAENGD-IVAALIDDEATVKVYRSRDGK-VELLPRNPLYP 223

Query: 204 V 204
           V
Sbjct: 224 V 224


>gi|295111675|emb|CBL28425.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Synergistetes bacterium SGP1]
          Length = 233

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 42/213 (19%), Positives = 78/213 (36%), Gaps = 25/213 (11%)

Query: 16  MAERH--NLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTES-IFKILAATNETICQL 72
           MA R    +    LA + G+ P +  + +   I  R+   S +S I K L     ++  L
Sbjct: 14  MARRKALGMKRPELAERLGVKPNTLYRYEIGSIGIRD---SMKSRIAKEL---GVSLAYL 67

Query: 73  LDLPFSDGR---------TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           +      GR              +  +P+L        GF  S V     KW      E 
Sbjct: 68  VSGTAEVGRERGSEETPEPVVPPQVYLPILDQEACAGSGFNWSDVRAGARKWMPWPTLET 127

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             P        T+    K +  SM+    + G ++++N   +V  GD   ++      V 
Sbjct: 128 GGPVG-----PTKPYFVKVEGDSMIGANIQDGCLILVNPNTEVRSGDIAYVRWNDRCSVK 182

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
            ++    GR ++L   N  +    ++  ++E++
Sbjct: 183 GIIFYNDGR-VELRPANKDFSSIWIQRDEVEFL 214


>gi|294650866|ref|ZP_06728213.1| LexA family repressor [Acinetobacter haemolyticus ATCC 19194]
 gi|292823284|gb|EFF82140.1| LexA family repressor [Acinetobacter haemolyticus ATCC 19194]
          Length = 224

 Score = 43.0 bits (100), Expect = 0.028,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 84/225 (37%), Gaps = 42/225 (18%)

Query: 1   MTSFS-HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW------P 53
           M   S H++I + +D      NL  + LAR           +KR  +  + +W      P
Sbjct: 1   MFVMSLHERIKQKLD----EKNLKAADLARA----------TKRSAVSAK-KWLDGVSVP 45

Query: 54  STESIFKILAATNETICQLL----DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           + E++  I      T   LL    +    D   + K  +  P+L +  +G+     +   
Sbjct: 46  TAENLKTIAKFLGVTDDWLLYGGKEQQTIDNNVSNKPARLAPVLSWVQAGTFTNVQAVDM 105

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA---IQVN 166
              ++W  + +P+                  K Q  S  P + +GD ++++       + 
Sbjct: 106 SQVDEW--LPLPDEC----------INCFYLKVQGISNQPDFLEGDYILVDPDVYYSDMQ 153

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++++    D   K L+     S  + +LN  +  + + + +
Sbjct: 154 SGDMIVVRKFE-DATFKKLVIETDGSRYMQALNPNFQPNIIPLDE 197


>gi|293386435|ref|YP_003540597.1| UV protection protein [Erwinia amylovora ATCC 49946]
 gi|291201078|emb|CBJ48216.1| UV protection protein [Erwinia amylovora ATCC 49946]
          Length = 142

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 45/116 (38%), Gaps = 7/116 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           +  FP+    + V        ++     ++     +    SM     + GD+++++ ++ 
Sbjct: 26  AAGFPS-PAQDYVE--ASLDLNDLCIRHRSATYFVRASGDSMNDAGIKDGDLMVVDKSLT 82

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
              GD ++I    G+   KVL  R    + L  +N  +P    E   +E    + W
Sbjct: 83  AEHGD-IVIAAVEGEFTVKVLQLRP--RLALQPMNPSFPTLFPEPDTLEIFGVVTW 135


>gi|227522664|ref|ZP_03952713.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus hilgardii ATCC 8290]
 gi|227090184|gb|EEI25496.1| bifunctional S24 family peptidase/transcriptional regulator
           [Lactobacillus hilgardii ATCC 8290]
          Length = 155

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 34/98 (34%), Gaps = 5/98 (5%)

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G     V     R   N    +   D   K    SM P +    + ++  A +   G +
Sbjct: 46  AGTGEELVD---ERDQINYRGELPKFDFAIKINGDSMEPRFHDQQVALVKKAFEAENG-Q 101

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
           ++I    G    K    +  ++  L+SLN  Y    V+
Sbjct: 102 IVIAYVDGRSYIKQF-EQTEQTCRLVSLNRKYAPIEVQ 138


>gi|328953857|ref|YP_004371191.1| SOS-response transcriptional repressor, LexA [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454181|gb|AEB10010.1| SOS-response transcriptional repressor, LexA [Desulfobacca
           acetoxidans DSM 11109]
          Length = 202

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 45/131 (34%), Gaps = 15/131 (11%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
           E+P+L    +G        +  +    +T+ +P        ++ +       +    SM 
Sbjct: 77  EVPILGQIAAGQ------PLLASEQVEDTLPLPRSWVQGEEVFLL-------RVAGDSMA 123

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
           PL   GD++++    +V  GD   +       V +V        + L   N  +      
Sbjct: 124 PLILPGDLVMVRVQPRVARGDIAAVLIYEEATVKRVYEE--AGGLVLRGDNPNFAPLRFS 181

Query: 209 MSDIEWIARIL 219
             +   + +IL
Sbjct: 182 PEEAAELVQIL 192


>gi|312115168|ref|YP_004012764.1| peptidase S24/S26A/S26B, conserved region [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220297|gb|ADP71665.1| Peptidase S24/S26A/S26B, conserved region [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 129

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 44/113 (38%), Gaps = 10/113 (8%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM--LPLYRKGDILILNSAI 163
              FP+    + +        +  +          +    SM    L+  GDIL+++ AI
Sbjct: 11  PAGFPSPAD-DYLE--GELDLNKFLIRNPAATFYVRLSGDSMVMAGLF-DGDILVVDRAI 66

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY-PVDTVEMSDIE-W 214
                  +++    G++  K L S  G  I+L S N  Y P+  VE  ++  W
Sbjct: 67  SAR-HRHIVVAVVDGELTVKRLWS-SGGVIELRSENPAYQPIKMVEGRELVIW 117


>gi|281357484|ref|ZP_06243972.1| Peptidase S24/S26A/S26B [Victivallis vadensis ATCC BAA-548]
 gi|281316087|gb|EFB00113.1| Peptidase S24/S26A/S26B [Victivallis vadensis ATCC BAA-548]
          Length = 312

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 52/152 (34%), Gaps = 11/152 (7%)

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
           LP           + IP++ +  +   G  D    P    ++    PE           +
Sbjct: 159 LPAGYFGDGAMLVRPIPVVSWANAA--GHLDLLANPDTRLFSRWD-PENTETVPAPVGTR 215

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQ---VNCGDRLLIKPRTGD----IVAKVLIS 187
                 +    SM P     DI+++   +    V     ++ +   G     +V K L  
Sbjct: 216 KGTQAFRVTGISMEPTIMDDDIILVEQRMSLDEVPNNKIVVARLTEGKFEDCVVCKRLRR 275

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + G    L S N    V  VE SD++W+  ++
Sbjct: 276 QGGHCW-LTSDNPAGMVIPVEPSDLQWLGIVV 306


>gi|188994990|ref|YP_001929242.1| putative error-prone repair: SOS-response transcriptional repressor
           UmuD homolog [Porphyromonas gingivalis ATCC 33277]
 gi|188594670|dbj|BAG33645.1| putative error-prone repair: SOS-response transcriptional repressor
           UmuD homolog [Porphyromonas gingivalis ATCC 33277]
          Length = 141

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 46/126 (36%), Gaps = 13/126 (10%)

Query: 92  LLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLY 151
           LL F   G         FP+    + + +      ++ +          + +  SM   +
Sbjct: 14  LLPFADEGI-----RAGFPS-PAQDYMDI--AIDLNHELITHPYSTFYGRVKGNSMEDAH 65

Query: 152 R-KGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
              GDIL+++ +++   GD + +    G+   K +   +   I L   N  YP   V   
Sbjct: 66  VFDGDILVIDKSLEARDGD-MAVCFLDGEFTLKTI-RIKSEEILLEPANPDYPTIHVSAD 123

Query: 211 D--IEW 214
           +  + W
Sbjct: 124 NDFVIW 129


>gi|329298544|ref|ZP_08255880.1| DNA polymerase V subunit UmuD [Plautia stali symbiont]
          Length = 98

 Score = 43.0 bits (100), Expect = 0.029,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
            +     + +  SM     R+GD+L+++S++     D ++I    G+   K L  +    
Sbjct: 4   PSATYFVRVEGDSMRDANIREGDLLVVDSSLNAR-HDDIVIAAINGEFTVKRL--QTHPC 60

Query: 193 IDLMSLNCCYPV 204
           + LM +N  Y  
Sbjct: 61  VQLMPMNPRYQP 72


>gi|260425213|ref|ZP_05779194.1| putative phage repressor [Citreicella sp. SE45]
 gi|260423785|gb|EEX17034.1| putative phage repressor [Citreicella sp. SE45]
          Length = 228

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 42/213 (19%), Positives = 74/213 (34%), Gaps = 46/213 (21%)

Query: 21  NLTPSGLARK------AGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
            L+ + LA +        +D ++ NK       G+ R  S E + +I   T         
Sbjct: 35  GLSQAALAERLDAVVPKNVDRSTINK----MTLGK-RAISAEELLRISEITG-------- 81

Query: 75  LPFSDGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                            +     +G+    FD+  +P G     V  P   SPH G+ A+
Sbjct: 82  FDVPGEAPIRPTTA---IAGKVGAGAQVPVFDA--YPKGGG-PQVECPPGLSPH-GVVAV 134

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILN-------SAIQVNCGDRLLIKPRTGDIVAKVLI 186
           +        +  SM P+Y  GD+L              +  G R +++ + G    K + 
Sbjct: 135 E-------VEGDSMEPVYSAGDLLFYTRDTHDGIPDDAI--GHRCIVEDQDGMGWVKQVK 185

Query: 187 S-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +        L+SLN       +    ++W AR+
Sbjct: 186 AGEEPGLFHLISLNPGATN--MWNKRLKWAARV 216


>gi|256849525|ref|ZP_05554957.1| signal peptidase [Lactobacillus crispatus MV-1A-US]
 gi|262046193|ref|ZP_06019156.1| signal peptidase I [Lactobacillus crispatus MV-3A-US]
 gi|256713641|gb|EEU28630.1| signal peptidase [Lactobacillus crispatus MV-1A-US]
 gi|260573523|gb|EEX30080.1| signal peptidase I [Lactobacillus crispatus MV-3A-US]
          Length = 210

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT--GDIVAKVLISRRGRSI 193
                SM P ++ GD LI     Q+  G+ +++K     G +  K +I   G  I
Sbjct: 41  TVSGLSMQPTFQNGDRLIAERHAQIKRGEVVIVKAPDEPGALYIKRVIGLPGEKI 95


>gi|227878456|ref|ZP_03996396.1| possible signal peptidase I [Lactobacillus crispatus JV-V01]
 gi|227861985|gb|EEJ69564.1| possible signal peptidase I [Lactobacillus crispatus JV-V01]
          Length = 219

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT--GDIVAKVLISRRGRSI 193
                SM P ++ GD LI     Q+  G+ +++K     G +  K +I   G  I
Sbjct: 50  TVSGLSMQPTFQNGDRLIAERHAQIKRGEVVIVKAPDEPGALYIKRVIGLPGEKI 104


>gi|332092221|gb|EGI97298.1| protein umuD [Shigella boydii 5216-82]
          Length = 139

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 7/105 (6%)

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
            FP+    + V   +    +  +    +     K    SM+      GD+LI++SAI  +
Sbjct: 25  GFPS-PTADYVE--QRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITAS 81

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            GD ++I    G+   K L  R   ++ L+ +N  Y   T+   D
Sbjct: 82  HGD-IVIAAVDGEFTVKKLQLRP--TVQLIPMNSAYSPITISSED 123


>gi|307710044|ref|ZP_07646489.1| helix-turn-helix family protein [Streptococcus mitis SK564]
 gi|307619229|gb|EFN98360.1| helix-turn-helix family protein [Streptococcus mitis SK564]
          Length = 260

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 36/104 (34%), Gaps = 7/104 (6%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDIL-ILNSAIQ 164
           +  F  G  ++      I             D   K    SM P Y+ GDIL +++  + 
Sbjct: 139 ASGFNYGFGYDDTDRETIEVDERP----PRHDIATKVSGDSMQPDYQDGDILYLVDRGLT 194

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
              GD  +I         K+        + L+SLN  Y    ++
Sbjct: 195 TYNGDLAVIAYGDRSYFKKIYTE--NGRLRLVSLNDKYEDIILD 236


>gi|228922414|ref|ZP_04085718.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837239|gb|EEM82576.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 223

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 78/224 (34%), Gaps = 34/224 (15%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLD 74
           R+ +    +    A K GL PT+  +S      G+    S +++ K+      T   L  
Sbjct: 13  RLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTDDLER 68

Query: 75  LPFSDGRTT-------------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L   +G T              +     IP++    +G+    +  +           +P
Sbjct: 69  LATQEGNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENI--------EGYLP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +    +     + +      + TSM   +  G  +++     V  G   ++K    D  
Sbjct: 121 ML----STFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDAT 176

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDT--VEMSDIEWIARILWA 221
            K +  + G  I L+ L  +  +   T  +   D++ I R++ A
Sbjct: 177 VKKIS-KSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|187476916|ref|YP_784940.1| phage repressor protein [Bordetella avium 197N]
 gi|115421502|emb|CAJ48011.1| Putative phage repressor protein [Bordetella avium 197N]
          Length = 317

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 33/85 (38%), Gaps = 8/85 (9%)

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGD----RLLIKPRTGDIVAKVL--ISRRGRSIDLMS 197
             SM P+ R G  L++     +   D     +      G ++ K +      GR +   S
Sbjct: 219 GDSMEPIIRDGAALLVAIDQSLTLHDVAAGGVYAINYDGKMLVKTVAKDRLTGRWVA-RS 277

Query: 198 LNCCYPVDTVE-MSDIEWIARILWA 221
            N  +P   +E    +  + R++WA
Sbjct: 278 FNAQHPDIPLEGNGLVRVLGRVVWA 302


>gi|34497787|ref|NP_902002.1| SOS mutagenesis [Chromobacterium violaceum ATCC 12472]
 gi|34103643|gb|AAQ60004.1| SOS mutagenesis [Chromobacterium violaceum ATCC 12472]
          Length = 198

 Score = 43.0 bits (100), Expect = 0.030,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 28/76 (36%), Gaps = 3/76 (3%)

Query: 134 QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                  K +  SM       GD+L++  + +   G ++++    G++  K L       
Sbjct: 106 PGDTFMVKVKGDSMQGAGIHDGDLLLVERSREPRSG-KVVVAALNGELTVKRLERGPAG- 163

Query: 193 IDLMSLNCCYPVDTVE 208
           + L+  N  Y    V 
Sbjct: 164 VRLLPENPAYQPIDVP 179


>gi|295102328|emb|CBK99873.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Faecalibacterium prausnitzii L2-6]
          Length = 208

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 44/163 (26%), Gaps = 26/163 (15%)

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTE-KKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           E +   L  T   +  L DLP          +   +PL+     G+              
Sbjct: 52  EELAAALDTTPAWLMGLADLPCPPPGFEPLPEMARVPLVGSIACGT-------------- 97

Query: 115 WNTVGVPEIRSPHNGIY----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                 P     +   Y    A    D       +SM P    GDI+ +    +V  G+ 
Sbjct: 98  ------PITAEQNIECYIGVPAAWHADFALTCHGSSMAPTICDGDIVCIRRQPEVEQGEI 151

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
             ++    +   K    +    + L       P        +E
Sbjct: 152 AAVRIGE-EATLKHFHRQGETVMLLADNTAVCPPMVFAGPQLE 193


>gi|315925034|ref|ZP_07921251.1| LexA repressor 1 [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621933|gb|EFV01897.1| LexA repressor 1 [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 219

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 41/123 (33%), Gaps = 12/123 (9%)

Query: 89  EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSML 148
            IP+L                P     + +G  EI        A   +    +   TSM 
Sbjct: 93  SIPVLGSV---------PAGVPVEAVEDIIGTIEIPRE---WLAGGAEFIGLRVTGTSMY 140

Query: 149 PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE 208
           P+Y +GD +++      + G   +I     D   K ++     +I L   N  +P  T  
Sbjct: 141 PMYLEGDTVVIEIKHDCDSGQDAIIYVNGYDATLKTVVKNDDGTITLKPRNPEWPTKTYG 200

Query: 209 MSD 211
             D
Sbjct: 201 PGD 203


>gi|158520251|ref|YP_001528121.1| LexA family transcriptional regulator [Desulfococcus oleovorans
           Hxd3]
 gi|158509077|gb|ABW66044.1| transcriptional repressor, LexA family [Desulfococcus oleovorans
           Hxd3]
          Length = 210

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 55/182 (30%), Gaps = 37/182 (20%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKE--------------------KEIPL 92
           PS       L+ ++  I Q L L    G  T                        +EIP+
Sbjct: 27  PSLRQAADALSVSHTAISQALKLLEKKGYITRHGRYSRDIHVLNPMNQSAGMHRWREIPV 86

Query: 93  LYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS-PHNGIYAIQTQDTRHKTQDTSML-PL 150
           +    +G   +          +W    V +    P + ++A+       + +  SM    
Sbjct: 87  IGAITAGLPMY-------AQQEWEGTLVLDRSCFPGDNLFAL-------RVKGDSMKDAA 132

Query: 151 YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
              GD++I         G+ ++      +   K    R    I+L   N  Y    +   
Sbjct: 133 ILDGDLVICEPRQFAENGEIVVALVNGEEATVKRFFKR-QDHIELKPENPAYAPLKLMFG 191

Query: 211 DI 212
           D+
Sbjct: 192 DV 193


>gi|315930676|gb|EFV09696.1| peptidase S24-like family protein [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 222

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 65/194 (33%), Gaps = 20/194 (10%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G+ P +FN  K        +      I   L   N +I  
Sbjct: 25  DILASEGKRDLKTKDIAKELGIHPDTFNSMKFRNSIPYPQ------ILNFLNQRNISINY 78

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + + +I  LY   +  GG         G   + +   E+        
Sbjct: 79  FFYGSSPKDQLECENKYKILKLYKTNASLGG---------GGINDLIDCSELIMDEKLLN 129

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 130 FFGSKECEFITCYGESMEPLIKDGSICVIDRNKTFKNKSICVINTRDG-LFIKQVLKQDD 188

Query: 191 RSIDLMSLNCCYPV 204
             I L SLN  Y  
Sbjct: 189 GVI-LHSLNPLYED 201


>gi|313116334|gb|ADR32142.1| phage repressor protein, putative [Campylobacter jejuni]
          Length = 222

 Score = 43.0 bits (100), Expect = 0.031,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 65/194 (33%), Gaps = 20/194 (10%)

Query: 14  DRMAE--RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
           D +A   + +L    +A++ G+ P +FN  K        +      I   L   N +I  
Sbjct: 25  DILASEGKRDLKTKDIAKELGIHPDTFNSMKFRNSIPYPQ------ILNFLNQRNISINY 78

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI-RSPHNGI 130
                    +   + + +I  LY   +  GG         G   + +   E+        
Sbjct: 79  FFYGSSPKDQLECENKYKILKLYKTNASLGG---------GGINDLIDCSELIMDEKLLN 129

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +         SM PL + G I +++           +I  R G +  K ++ +  
Sbjct: 130 FFGSKECEFITCYGESMEPLIKDGSICVIDRNKTFKNKSICVINTRDG-LFIKQVLKQDD 188

Query: 191 RSIDLMSLNCCYPV 204
             I L SLN  Y  
Sbjct: 189 GVI-LHSLNPLYED 201


>gi|193070526|ref|ZP_03051466.1| repressor protein CI [Escherichia coli E110019]
 gi|192956220|gb|EDV86683.1| repressor protein CI [Escherichia coli E110019]
          Length = 215

 Score = 43.0 bits (100), Expect = 0.032,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 66/215 (30%), Gaps = 32/215 (14%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK---------RFGIEGRNRWPSTE 56
           H+ I E I  + E   L+ + LA+  G        S+         +   +         
Sbjct: 5   HEIIGERIKSLREAKGLSQAQLAKLCGWAA----PSRLGNYELGTRKVSADD-------- 52

Query: 57  SIFKIL-AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
               +L AA   +      + F +      ++ E PL     +   G F      T +  
Sbjct: 53  --ALVLGAALGVSP---AKIMFGEDSDAVFRQYEYPLFSSVQA---GPFSEVGSYTASDA 104

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
               VP         + ++ +     T    + P + +G +++++ A  V  GD  +   
Sbjct: 105 KAW-VPTTTKASEKAFWLEVKGHSM-TAPQGVRPSFPEGMLILVDPAEPVESGDFCVASA 162

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
                       +      L+ LN  Y     + S
Sbjct: 163 NGDSEATFKKYEKDAGVSYLVPLNPAYRTLDCDHS 197


>gi|193077634|gb|ABO12464.2| EsvI [Acinetobacter baumannii ATCC 17978]
          Length = 229

 Score = 43.0 bits (100), Expect = 0.032,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 57/163 (34%), Gaps = 22/163 (13%)

Query: 58  IFKILAATNETICQLLDLPFSDGRT------TEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           + K       +   L         T      ++K  K  P+L +  +G+     S     
Sbjct: 55  LVKAAEFLGVSKDWLAGQSNKMDATKIDNNVSKKVAKLAPVLSWVQAGTFTNVQSVDLSM 114

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA---IQVNCG 168
             +W  + +P+  +               K Q  S  P + +GD ++++       +  G
Sbjct: 115 VEEW--LPLPDECT----------NCFYLKVQGVSNQPDFLEGDYILVDPDVYYSDMQSG 162

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           D ++++    D   K L+     S  L +LN  +  + + + +
Sbjct: 163 DMVVVRRFE-DATFKKLVIETDGSRYLQALNPKFEPNIIPLDE 204


>gi|218690255|ref|YP_002398467.1| Repressor protein CI from phage [Escherichia coli ED1a]
 gi|218427819|emb|CAR08732.2| Repressor protein CI from phage [Escherichia coli ED1a]
          Length = 215

 Score = 43.0 bits (100), Expect = 0.033,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 66/215 (30%), Gaps = 32/215 (14%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK---------RFGIEGRNRWPSTE 56
           H+ I E I  + E   L+ + LA+  G        S+         +   +         
Sbjct: 5   HEIIGERIKSLREAKGLSQAQLAKLCGWAA----PSRLGNYELGTRKVSADD-------- 52

Query: 57  SIFKIL-AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
               +L AA   +      + F +      ++ E PL     +   G F      T +  
Sbjct: 53  --ALVLGAALGVSP---AKIMFGEDSDAVFRQYEYPLFSSVQA---GPFSEVGSYTASDA 104

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
               VP         + ++ +     T    + P + +G +++++ A  V  GD  +   
Sbjct: 105 KAW-VPTTTKASEKAFWLEVKGHSM-TAPQGVRPSFPEGMLILVDPAEPVESGDFCVASA 162

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
                       +      L+ LN  Y     + +
Sbjct: 163 NGDSEATFKKYEKDAGVSYLVPLNPAYRTLDCDHT 197


>gi|197105225|ref|YP_002130602.1| SOS-response transcriptional repressor, LexA [Phenylobacterium
           zucineum HLK1]
 gi|229621740|sp|B4RBX6|LEXA_PHEZH RecName: Full=LexA repressor
 gi|196478645|gb|ACG78173.1| SOS-response transcriptional repressor, LexA [Phenylobacterium
           zucineum HLK1]
          Length = 229

 Score = 43.0 bits (100), Expect = 0.034,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 47/140 (33%), Gaps = 15/140 (10%)

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
                  +E+P+L    +G+       +     + + + VPE        + ++      
Sbjct: 97  PVAANDTRELPILGKIAAGT------PIEAIQQERDRLPVPEAMLGAGEHFVLE------ 144

Query: 141 KTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
             Q  SM+      GD +++      N GD ++      +   K L  +   SI L + N
Sbjct: 145 -IQGDSMINAGILDGDFVVIRRTDSANSGDIVVALVDGEEATLKRLRKKGA-SIALEAAN 202

Query: 200 CCYPVDTVEMSDIEWIARIL 219
             Y         +    R++
Sbjct: 203 PAYETRIFGPDRVAVQGRLV 222


>gi|332702887|ref|ZP_08422975.1| putative phage repressor [Desulfovibrio africanus str. Walvis Bay]
 gi|332553036|gb|EGJ50080.1| putative phage repressor [Desulfovibrio africanus str. Walvis Bay]
          Length = 247

 Score = 42.6 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 135 TQDTRHKTQDTSMLPLYRKGD-ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
           +Q    +    SM P  R GD +L+  S  +V  G   ++    G +V K L  R G+ +
Sbjct: 153 SQMCLMRVAGDSMEPTLRDGDAVLLDQSQTEVVYGKIYVVGIDEG-VVVKRLDKRPGKLV 211

Query: 194 DLMSLNCC-YPVDTVEMSD---IEWIARILW 220
            L+S N   YP   V +++   +  + R++W
Sbjct: 212 -LVSDNRQVYPPLEVALNESVSVRIVGRVIW 241


>gi|260655665|ref|ZP_05861138.1| toxin-antitoxin system, antitoxin component, Xre family
           [Jonquetella anthropi E3_33 E1]
 gi|260629582|gb|EEX47776.1| toxin-antitoxin system, antitoxin component, Xre family
           [Jonquetella anthropi E3_33 E1]
          Length = 247

 Score = 42.6 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 59/161 (36%), Gaps = 29/161 (18%)

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLL-YFPPSGSGG---FF----DSGVF----PTG 112
           T  +  +    P           + +PLL     +  GG   FF    DS  F    P  
Sbjct: 82  TAASDNEAASYPNDPRVIPLTNCRRVPLLSPEATAHCGGGCSFFEITSDSTEFIICTP-- 139

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
              + +G P         +A+ ++    ++   S       GD L++N A++V   +  +
Sbjct: 140 ---DELGSP--IDDLRPPFAVSSEGNCLQSSGIS------DGDKLVVNPAVEVRDFNVCV 188

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           I  R   + AK +   +   I+L S N    V  V   D+E
Sbjct: 189 ICWRDH-LSAKRIRKLQNGDIELRSDNG---VAVVPADDVE 225


>gi|239907530|ref|YP_002954271.1| UmuD protein [Desulfovibrio magneticus RS-1]
 gi|239797396|dbj|BAH76385.1| UmuD protein [Desulfovibrio magneticus RS-1]
          Length = 143

 Score = 42.6 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 42/116 (36%), Gaps = 16/116 (13%)

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK-----GDILILN 160
              FP+    + +   +    +  +          +    SM    R      GDIL+++
Sbjct: 27  PAGFPS-PAEDYID--KKIDLNEHLVRHPAATFFVRVDGDSM----RDAGVASGDILVVD 79

Query: 161 SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD--IEW 214
            A++   G  +++    G++  K L  R G+ + L+  N  Y    V      + W
Sbjct: 80  RALEAKDGS-IVVAALDGELTVKRLRRRDGKLL-LVPENPDYQAVEVAPEASFMVW 133


>gi|114569948|ref|YP_756628.1| LexA repressor [Maricaulis maris MCS10]
 gi|122316090|sp|Q0APU7|LEXA_MARMM RecName: Full=LexA repressor
 gi|114340410|gb|ABI65690.1| SOS-response transcriptional repressor, LexA [Maricaulis maris
           MCS10]
          Length = 232

 Score = 42.6 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 36/116 (31%), Gaps = 8/116 (6%)

Query: 106 SGVFPTGNKWNTVG-VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAI 163
           +   P     +     P       G      +    + +  SM       GD +++    
Sbjct: 116 AAGVPISAIQHETDRFPVPADMVMG-----GEHFGLEVKGDSMIEAGIMDGDTVLIRRCQ 170

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               GD ++      +   K L  ++G S+ L + N  Y         ++   R++
Sbjct: 171 SAETGDIVVALIDDEEATLKRL-RKKGGSVALEAANPEYETRIFPPDRVKVQGRLV 225


>gi|15596103|ref|NP_249597.1| transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|107100364|ref|ZP_01364282.1| hypothetical protein PaerPA_01001389 [Pseudomonas aeruginosa PACS2]
 gi|116048830|ref|YP_792370.1| transcriptional regulator [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893125|ref|YP_002441994.1| putative transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|254239258|ref|ZP_04932581.1| hypothetical protein PACG_05450 [Pseudomonas aeruginosa C3719]
 gi|296390740|ref|ZP_06880215.1| putative transcriptional regulator [Pseudomonas aeruginosa PAb1]
 gi|313105790|ref|ZP_07792053.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
 gi|9946808|gb|AAG04295.1|AE004525_3 probable transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|115584051|gb|ABJ10066.1| probable transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126171189|gb|EAZ56700.1| hypothetical protein PACG_05450 [Pseudomonas aeruginosa C3719]
 gi|218773353|emb|CAW29165.1| probable transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|310878555|gb|EFQ37149.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
          Length = 237

 Score = 42.6 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 7/95 (7%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                       SM P+   G  + ++++   +  GD +      G +  K+L    G  
Sbjct: 141 PASAACVTVSGNSMEPVLPDGSTVGVDTSARTIKDGD-MYAFDHDGQLRVKLLYRLPGGG 199

Query: 193 IDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           + + S N   +P +  E  +    I  I R+ W S
Sbjct: 200 LRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|126642082|ref|YP_001085066.1| EsvI [Acinetobacter baumannii ATCC 17978]
          Length = 154

 Score = 42.6 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSA---IQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
           T     K Q  S  P + +GD ++++       +  GD ++++    D   K L+     
Sbjct: 51  TNCFYLKVQGVSNQPDFLEGDYILVDPDVYYSDMQSGDMVVVRRFE-DATFKKLVIETDG 109

Query: 192 SIDLMSLNCCYPVDTVEMSD 211
           S  L +LN  +  + + + +
Sbjct: 110 SRYLQALNPKFEPNIIPLDE 129


>gi|49081996|gb|AAT50398.1| PA0906 [synthetic construct]
          Length = 238

 Score = 42.6 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 35/95 (36%), Gaps = 7/95 (7%)

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                       SM P+   G  + ++++   +  GD +      G +  K+L    G  
Sbjct: 141 PASAACVTVSGNSMEPVLPDGSTVGVDTSARTIKDGD-MYAFDHDGQLRVKLLYRLPGGG 199

Query: 193 IDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           + + S N   +P +  E  +    I  I R+ W S
Sbjct: 200 LRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|294784043|ref|ZP_06749365.1| LexA repressor [Fusobacterium sp. 1_1_41FAA]
 gi|294479855|gb|EFG27634.1| LexA repressor [Fusobacterium sp. 1_1_41FAA]
          Length = 219

 Score = 42.6 bits (99), Expect = 0.036,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 34/103 (33%), Gaps = 6/103 (5%)

Query: 111 TGNKWNTVGVPEIRSP-HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA--IQVNC 167
            G  +  +  P+   P   G +++       +    SM P    G+  +++      V  
Sbjct: 99  AGRGYLNMDKPDYYMPITKGDFSL--NSFFVEITGDSMEPTLEDGEYALVDPNNTAYVKN 156

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
              ++     G I    L  ++ + I L S N  Y    +   
Sbjct: 157 KIYVVTYNDEGYIKRVELKEKK-KVITLKSDNPDYDDIDIPEE 198


>gi|240141185|ref|YP_002965665.1| putative phage repressor [Methylobacterium extorquens AM1]
 gi|240011162|gb|ACS42388.1| putative phage repressor [Methylobacterium extorquens AM1]
          Length = 212

 Score = 42.6 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 36/82 (43%), Gaps = 6/82 (7%)

Query: 144 DTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT------GDIVAKVLISRRGRSIDLMS 197
             S+ P Y  G  + ++   +    D ++++ R       G    K L+SR G  + L  
Sbjct: 123 GDSVAPAYEDGSPIYVDPHRRPAPRDYVVVELRGEREGEPGPAFVKRLVSRGGGKLRLEQ 182

Query: 198 LNCCYPVDTVEMSDIEWIARIL 219
            N    ++ ++ +D+  + R++
Sbjct: 183 HNPPKQLEPIDEADVVRVHRVI 204


>gi|238918201|ref|YP_002931715.1| LexA repressor [Edwardsiella ictaluri 93-146]
 gi|259494473|sp|C5B718|LEXA_EDWI9 RecName: Full=LexA repressor
 gi|238867769|gb|ACR67480.1| repressor LexA, putative [Edwardsiella ictaluri 93-146]
          Length = 202

 Score = 42.6 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 43/116 (37%), Gaps = 13/116 (11%)

Query: 105 DSGVFP-TGNKWNTVGVPEIRSPH-NGIYAIQTQ------DTRHKTQDTSMLPL-YRKGD 155
           D    P  G      G P +   H  G Y I         D   +    SM  +    GD
Sbjct: 72  DETGLPLVGQV--AAGEPLLAQQHIEGFYQIDPSLFKPGADFLLRVNGMSMRDIGILDGD 129

Query: 156 ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
           +L ++    V  G ++++     ++  K L  + G  + L+  NC +    V++ +
Sbjct: 130 LLAVHKTQDVRNG-QVVVARIEDEVTVKRLKKQ-GNMVQLLPENCDFQPIVVDLRE 183


>gi|221213964|ref|ZP_03586937.1| HTH-type transcriptional regulator PrtR (Pyocin repressor protein)
           [Burkholderia multivorans CGD1]
 gi|221166141|gb|EED98614.1| HTH-type transcriptional regulator PrtR (Pyocin repressor protein)
           [Burkholderia multivorans CGD1]
          Length = 257

 Score = 42.6 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 40/113 (35%), Gaps = 9/113 (7%)

Query: 109 FPTGNK---WNTVGVPEIRSPHNGIYAI---QTQDTRHKTQDTSMLPLYRKGDILILNSA 162
           F  G     W       +        A+          +    SM P     D++++++A
Sbjct: 126 FSAGTGLIQWEVRQKKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTA 185

Query: 163 -IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIE 213
              +  G ++      G+ + K +  + G SI L S+N   YP   V    +E
Sbjct: 186 KTHIRDG-KVYAIYFEGEPLVKQIFKQAGGSICLHSINSGKYPDKIVTPELME 237


>gi|121634351|ref|YP_974596.1| putative transcriptional regulator [Neisseria meningitidis FAM18]
 gi|120866057|emb|CAM09795.1| putative transcriptional regulator [Neisseria meningitidis FAM18]
 gi|325131771|gb|EGC54472.1| putative transcriptional regulator [Neisseria meningitidis M6190]
 gi|325137661|gb|EGC60238.1| putative transcriptional regulator [Neisseria meningitidis ES14902]
          Length = 228

 Score = 42.6 bits (99), Expect = 0.037,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 59/189 (31%), Gaps = 28/189 (14%)

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
           P +E++ KI      +I  LL               E P         G   D+  F   
Sbjct: 42