PSIBLAST alignment of GI: 254780444 and protein with PDB id: 1jhh

>gi|15988320|pdb|1JHH|A Chain A, Lexa S119a Mutant Length = 202
>gi|15988321|pdb|1JHH|B Chain B, Lexa S119a Mutant Length = 202
 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/216 (11%), Positives = 61/216 (28%), Gaps = 38/216 (17%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTP--SGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE 56
           M + +   +++++ I     +  + P  + +A++ G                  R P+  
Sbjct: 1   MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGF-----------------RSPNA- 42

Query: 57  SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
                         +      +     E        +        G    G    G    
Sbjct: 43  -------------AEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLL 89

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKP 175
                E     +        D   +    +M  +    GD+L ++    V  G  ++ + 
Sbjct: 90  AQQHIEGHYQVDPSLFKPNADFLLRVSGMAMKDIGIMDGDLLAVHKTQDVRNGQVVVARI 149

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
              ++  K L  + G  ++L+  N  +    V++  
Sbjct: 150 D-DEVTVKRLKKQ-GNKVELLPENSEFKPIVVDLRQ 183