BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780444|ref|YP_003064857.1| bacteriophage repressor
protein C1 [Candidatus Liberibacter asiaticus str. psy62]
         (223 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|75674664|ref|YP_317085.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
 gi|74419534|gb|ABA03733.1| peptidase S24 [Nitrobacter winogradskyi Nb-255]
          Length = 210

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 98/223 (43%), Positives = 135/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT   I   +         TE+  K +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATGTAIDTFVQFIE----DTERAAKAVPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P                   +    SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 P---------CVNDEHAYALEISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  R+I+L SLN  +   T+  S++EWIARI+WASQ
Sbjct: 168 MVKELKRRTARTIELQSLNPSHANRTLPASEVEWIARIVWASQ 210


>gi|85713691|ref|ZP_01044681.1| peptidase S24 [Nitrobacter sp. Nb-311A]
 gi|85699595|gb|EAQ37462.1| peptidase S24 [Nitrobacter sp. Nb-311A]
          Length = 210

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 96/223 (43%), Positives = 137/223 (61%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLAR+AGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MVMLTHAQIWTALDRLAERAGLSPSGLARRAGLDPTTFNKSKRITSDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +         + +  + +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIE----DSARAAQAVPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H             +    SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PAVNDEH---------AYALEISGDSMKPAYRDGDVIVVSPGTPIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  ++I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKTIELQSLNPSHANRTLPASDVEWIARIVWASQ 210


>gi|144899439|emb|CAM76303.1| Peptidase S24, S26A and S26B [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 212

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 88/221 (39%), Positives = 127/221 (57%), Gaps = 9/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H  IW A+D +A  + LT S LAR+AGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLTHADIWAALDSLARDNGLTASALARRAGLDPTTFNKSKRITREGKLRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ QLL+           K   IPL+    +G  G+FD   +P G  W+ +  PE
Sbjct: 61  DATGSSLGQLLNYIDDSLPAPVVKGATIPLIGSAQAGDRGYFDDAGYPCGGGWDEIPFPE 120

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +           +     +    SM PLYR GDI+I++ A  V  GDR+++K   G+++ 
Sbjct: 121 VGD---------SNAYALEVSGDSMEPLYRDGDIVIVSPAASVRRGDRVVVKTLEGEVMV 171

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K LI +  + I+L SLN  +P  ++   ++ W+ARILWASQ
Sbjct: 172 KQLIRQTAKRIELASLNPAHPGRSLAAEEVSWLARILWASQ 212


>gi|39933872|ref|NP_946148.1| S24 family peptidase [Rhodopseudomonas palustris CGA009]
 gi|192289291|ref|YP_001989896.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|39647719|emb|CAE26239.1| Peptidase family S24 [Rhodopseudomonas palustris CGA009]
 gi|192283040|gb|ACE99420.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 210

 Score =  213 bits (543), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/223 (43%), Positives = 135/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L         +  + +PLL    +GSGG+FD G FP G  W+ VG+
Sbjct: 61  ALQATNTAIDTFVQLIHDRP----RVVQSVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H             +    SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSITDEH---------AYALEISGDSMKPAYRSGDIVVVSPSATVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  S+IEWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVVELASLNPSHPDRTLAPSEIEWIGRIVWASQ 210


>gi|13474687|ref|NP_106256.1| repressor protein CI [Mesorhizobium loti MAFF303099]
 gi|14025442|dbj|BAB52042.1| repressor protein CI [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 95/221 (42%), Positives = 135/221 (61%), Gaps = 9/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKII 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ +   L      T     + +PLL F  +G+GGFFD   FP G  W+ V +P 
Sbjct: 61  EATGASLDEFTGLIEGRMSTAPAHRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDLVELPA 120

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             +               + Q  SMLPLYR GD+LI+        GDR+++K  +G+++A
Sbjct: 121 QSTE---------SSYALQVQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTSGEVMA 171

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           KVL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 172 KVLDRQTVKSIALVSLNPDHPDRDIPMREVEWVARIVWASQ 212


>gi|316932334|ref|YP_004107316.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
 gi|315600048|gb|ADU42583.1| putative phage repressor [Rhodopseudomonas palustris DX-1]
          Length = 210

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 96/223 (43%), Positives = 134/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            L ATN  I   + L         +  + +PLL    +GSGG+FD G FP G  W  +G+
Sbjct: 61  ALQATNTAIDTFVQLIHDRP----RVVQSVPLLGLAQAGSGGYFDDGGFPVGKGWEEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H             +    SM P YR GDI++++ +  V+ GDR+++K   G++
Sbjct: 117 PSISDEH---------AYALQISGDSMKPAYRHGDIVVVSPSAAVHRGDRVVVKTTKGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +P  T+  S++EWI RI+WASQ
Sbjct: 168 MVKELKRRTAKVIELASLNPSHPDRTLAPSEVEWIGRIVWASQ 210


>gi|92116178|ref|YP_575907.1| putative phage repressor [Nitrobacter hamburgensis X14]
 gi|91799072|gb|ABE61447.1| putative phage repressor [Nitrobacter hamburgensis X14]
          Length = 210

 Score =  211 bits (537), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 98/223 (43%), Positives = 136/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MAMLTHAQIWTALDRLAERSGLSPSGLARKAGLDPTTFNKSKRITGDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAAT+  I   +         T +  + +PLL F  +G+GG+FD G FP G  W+ VG+
Sbjct: 61  ALAATDTAIDTFVQFIE----DTARATQAVPLLGFAEAGAGGYFDDGGFPVGKGWDEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H             +    SM P YR GD+++++    +  GDR+++K R G++
Sbjct: 117 PSVHDEH---------AYALEISGDSMKPAYRDGDVIVVSPGTSIRRGDRVVVKTRDGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + I+L SLN  +   T+  SD+EWIARI+WASQ
Sbjct: 168 MVKELKRRTAKMIELQSLNPNHVNRTLAASDVEWIARIVWASQ 210


>gi|239834343|ref|ZP_04682671.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
 gi|239822406|gb|EEQ93975.1| Repressor protein C [Ochrobactrum intermedium LMG 3301]
          Length = 227

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 97/228 (42%), Positives = 133/228 (58%), Gaps = 14/228 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K
Sbjct: 9   MTMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAK 68

Query: 61  ILAATNETICQLLD-----LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           ++ AT  T  +                  +  + IPLL    +G+GG+FD   FP G  W
Sbjct: 69  VMEATGSTFDEFTRLIGGETRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGW 128

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P                   +    SMLPLYR GD LI+     +  GDR++++ 
Sbjct: 129 DIVEFPASTGEG---------VYALEVSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRT 179

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + G+++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 180 KDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESRDIEWVARILWASQ 227


>gi|90422277|ref|YP_530647.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
 gi|90104291|gb|ABD86328.1| putative phage repressor [Rhodopseudomonas palustris BisB18]
          Length = 208

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 92/221 (41%), Positives = 136/221 (61%), Gaps = 13/221 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+AER  L+PSGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAERAGLSPSGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AATN      +D          +  + +PLL    +GSGG+FD G FP G  W+ VG+P 
Sbjct: 61  AATN----TAIDAFVQLIGDGPRAVQSVPLLGLAQAGSGGYFDDGGFPVGKGWDEVGLPS 116

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H             +    SM P YR GD+++++    +  GDR+++K R G+++ 
Sbjct: 117 VNDEH---------AYALEISGDSMKPAYRAGDVIVVSPGSPIRRGDRVVVKTRDGEVMV 167

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L+SLN  +P  T+  +++EWIARI+WASQ
Sbjct: 168 KELKRRTAKTLELLSLNPSHPDRTLAPAEVEWIARIVWASQ 208


>gi|299134039|ref|ZP_07027232.1| putative phage repressor [Afipia sp. 1NLS2]
 gi|298590786|gb|EFI50988.1| putative phage repressor [Afipia sp. 1NLS2]
          Length = 207

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 93/221 (42%), Positives = 135/221 (61%), Gaps = 14/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTSDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++   +         +  +  ++PLL F  +GSGG+FD G FP G  W+ VG+P 
Sbjct: 61  AATGISVDTFVHFIE-----SSSRSVQVPLLGFAEAGSGGYFDDGGFPVGKGWDEVGLPS 115

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H             +    SM P YR GD+++++ +  +  GDR+++K + G+++ 
Sbjct: 116 VNDEH---------AYALEISGDSMKPAYRDGDVIVVSPSAPIRRGDRVVVKTKDGEVMV 166

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  + I+L SLN  +   T+  S+IEWIARILWASQ
Sbjct: 167 KELRRRTQKVIELQSLNPAHSDRTLPTSEIEWIARILWASQ 207


>gi|115522745|ref|YP_779656.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
 gi|115516692|gb|ABJ04676.1| putative phage repressor [Rhodopseudomonas palustris BisA53]
          Length = 208

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 94/221 (42%), Positives = 136/221 (61%), Gaps = 13/221 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MLTHDQIWTALDRLAERAGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AATN      +D          +  + +PLL F  +G+GG+FD G FP G  W+ VG+P+
Sbjct: 61  AATN----TAIDSFVRLIGDRARPVQSVPLLGFAQAGAGGYFDDGGFPVGKGWDEVGLPQ 116

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H             +    SM P YR GD+++++    V  GDR+++K   G+++ 
Sbjct: 117 VNDEH---------AYALEISGDSMKPAYRAGDVIVVSPGTPVRRGDRVVVKTNNGEVMV 167

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 168 KELKRRTSKTLELASLNPSHPDRTLAPADVEWIARIVWASQ 208


>gi|319785581|ref|YP_004145057.1| peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171469|gb|ADV15007.1| Peptidase S24/S26A/S26B, conserved region [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 216

 Score =  208 bits (529), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 94/225 (41%), Positives = 135/225 (60%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLA++AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLAKRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKIM 60

Query: 63  AATNETICQLLDLPFSD----GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ +   L           +  +   +PLL F  +G+GGFFD   FP G  W+ +
Sbjct: 61  EATGASLDEFTGLIEGRAGASHAASVARRSSVPLLGFAQAGAGGFFDDAGFPAGQGWDLI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P   +               + Q  SMLPLYR GD+LI+        GDR+++K  +G
Sbjct: 121 ELPTQSTE---------SSYALQVQGDSMLPLYRNGDVLIVEPGAVTRKGDRVVVKTTSG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  RSI L+SLN  +P   + M D+EW+ARI+WASQ
Sbjct: 172 EVMAKVLERQTVRSIALVSLNPDHPDRDIPMRDVEWVARIVWASQ 216


>gi|153011349|ref|YP_001372563.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
 gi|151563237|gb|ABS16734.1| putative phage repressor [Ochrobactrum anthropi ATCC 49188]
          Length = 217

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 95/226 (42%), Positives = 131/226 (57%), Gaps = 14/226 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYASDGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD-----LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
            AT  T  +                  +  + IPLL    +G+GG+FD   FP G  W+ 
Sbjct: 61  EATGSTFDEFTRLIRGGNRTPQFGEYTQDMQSIPLLGMAEAGAGGYFDDAGFPAGQGWDI 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           V  P                   +    SMLPLYR GD LI+     +  GDR++++ + 
Sbjct: 121 VEFPAGSGEG---------VYALEVSGDSMLPLYRDGDTLIVAPNTAIRRGDRVVVRTKD 171

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+++AK+L  +  R+I+L SLN  +P    E  DIEW+ARILWASQ
Sbjct: 172 GEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWVARILWASQ 217


>gi|288957020|ref|YP_003447361.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
 gi|288909328|dbj|BAI70817.1| hypothetical protein AZL_001790 [Azospirillum sp. B510]
          Length = 210

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/221 (38%), Positives = 133/221 (60%), Gaps = 11/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AIDR+A +H L+ SGLAR+AGLDPT+FNKSKR   +G+ RWPSTESI K+L
Sbjct: 1   MLKHTDIWRAIDRLAAQHGLSASGLARRAGLDPTTFNKSKRTTNDGKLRWPSTESISKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++ + + L            + +P++ +  +GS G+FD   FP G+ W+ +  P 
Sbjct: 61  DATGASLSEFVSLVGD--GAGTGPLQRVPVIGYAQAGSAGYFDDAGFPAGSGWDELLFPS 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +  PH             +    SM P+YR GD +I++ A Q+   DR++++ + G+++A
Sbjct: 119 LGDPH---------AYALEISGDSMEPVYRDGDTIIVSPAAQIRRNDRVVVRTKGGEVMA 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K LI      I+L+S+N  +P  ++ ++D+ W+ARI+WASQ
Sbjct: 170 KQLIRETATKIELLSINRAHPDRSIPLADVAWMARIIWASQ 210


>gi|154250891|ref|YP_001411715.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
 gi|154154841|gb|ABS62058.1| putative phage repressor [Parvibaculum lavamentivorans DS-1]
          Length = 214

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 89/224 (39%), Positives = 130/224 (58%), Gaps = 11/224 (4%)

Query: 1   MT-SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M    SH ++W AID +A RH LT SGLA+ AGLDPT+FNKSKR    GR RWP+TES+ 
Sbjct: 1   MPRKLSHNRLWAAIDALAGRHGLTASGLAKAAGLDPTTFNKSKRVTAAGRPRWPNTESLA 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +IL AT  ++ +   +  +DG      ++ +PL+    +G GGFFD   FP G+ W  V 
Sbjct: 61  RILDATGSSL-EDFLVLVADGEVAFTPQRHVPLIGLAQAGRGGFFDDAGFPVGSGWEEVA 119

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P+ +  H             +    SM P YR GDI++++   ++  GDR+++K    +
Sbjct: 120 FPDFKDEH---------AYALEVSGDSMEPFYRAGDIIVVSPGAEIRRGDRVVVKTAGDE 170

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AKVL  +    IDL SLN  Y   +++  +I W+ARI+WASQ
Sbjct: 171 VMAKVLARKTATRIDLQSLNPAYEDRSLKPEEIVWMARIIWASQ 214


>gi|260461922|ref|ZP_05810167.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
 gi|259032169|gb|EEW33435.1| putative phage repressor [Mesorhizobium opportunistum WSM2075]
          Length = 216

 Score =  204 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 94/225 (41%), Positives = 134/225 (59%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH ++W AID +AER++L+ SGLAR+AGLD T+FNKSKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHDRVWAAIDALAERYSLSASGLARRAGLDSTAFNKSKRLSSDGRPRWPSTESLAKII 60

Query: 63  AATNETICQLLDLPFSDGRTTEK----KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ +   L              + + +PLL F  +G+GGFFD   FP G  W+ V
Sbjct: 61  EATGASLDEFTGLIEGRAGLVHDARDGRRRSVPLLGFAQAGAGGFFDDAGFPAGQGWDLV 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P   +               + Q  SMLPLYR GD+LI+        GDR+++K   G
Sbjct: 121 ELPAQSTE---------SSYALQVQGDSMLPLYRNGDVLIVEPGAATRKGDRVVVKTTAG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  +SI L+SLN  +P   + M ++EW+ARI+WASQ
Sbjct: 172 EVMAKVLERQTVKSISLVSLNPDHPDRDISMREVEWVARIVWASQ 216


>gi|15887830|ref|NP_353511.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
 gi|15155410|gb|AAK86296.1| bacteriophage repressor protein C1 [Agrobacterium tumefaciens str.
           C58]
          Length = 216

 Score =  204 bits (519), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 110/223 (49%), Positives = 146/223 (65%), Gaps = 9/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AID +AERH LTPS LA++AGLDPTSFNKSKRFG +GR RWPSTES+ K+L
Sbjct: 1   MLSHETIWSAIDTLAERHQLTPSALAKRAGLDPTSFNKSKRFGPDGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEI--PLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  ++ Q     F   +T +    +   PLL F  +GSGGFFD G FP G  W+ V  
Sbjct: 61  EATGASVDQFFGYAFGRAQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+YA++        Q  SM+PLYR GDILI+     V  GDR+++K R G++
Sbjct: 121 PSSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAPVRRGDRVVLKSRDGEV 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 174 MAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|227820746|ref|YP_002824716.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
 gi|227339745|gb|ACP23963.1| putative peptidase, S24 family [Sinorhizobium fredii NGR234]
          Length = 217

 Score =  204 bits (519), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 107/224 (47%), Positives = 140/224 (62%), Gaps = 10/224 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI K+L
Sbjct: 1   MLSHDSIWRAIDALAERHQLSPSGLARRAGLDPTSFNKSKRQSPDGRDRWPSTESISKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEK---KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            AT  TI Q + L  S    + +       IPL+ F  +G+GGFFD G FP G  W+ V 
Sbjct: 61  EATGATIDQFMALLQSGSGPSSRTGLPAAGIPLIGFAQAGAGGFFDDGGFPVGQGWDEVD 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P            +      + Q  SMLPLYR GD+LI++    V  GDR+++K   G+
Sbjct: 121 FPVAA-------QSKASVYALEVQGDSMLPLYRDGDVLIVDPGASVRRGDRVVLKSCEGE 173

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK+L  +  R ++L+SLN  +P  + EM D+EWIARI+WASQ
Sbjct: 174 VMAKILARQTSRGVELLSLNPDHPNRSFEMKDVEWIARIVWASQ 217


>gi|325291874|ref|YP_004277738.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
 gi|325059727|gb|ADY63418.1| bacteriophage repressor protein C1 [Agrobacterium sp. H13-3]
          Length = 216

 Score =  204 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 109/223 (48%), Positives = 146/223 (65%), Gaps = 9/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AID +A+RH LTPS LA++AGLD TSFNKSKRFG +GR RWPSTES+ K+L
Sbjct: 1   MLSHETIWSAIDTLAKRHQLTPSALAKRAGLDSTSFNKSKRFGPDGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEI--PLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  ++ Q     F   +T +    +   PLL F  +GSGGFFD G FP G  W+ V  
Sbjct: 61  EATGASVDQFFGYAFGRTQTMQPSGADNAIPLLGFAQAGSGGFFDDGGFPAGQGWDVVEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+YA++        Q  SM+PLYR GDILI+    QV  GDR+++K R G++
Sbjct: 121 PSSPERKQGVYALE-------VQGESMMPLYRDGDILIVEPGAQVRRGDRVVLKSRDGEV 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AKVL  +  ++I+L+SLN  +P  + +M+D+EWIARI+WASQ
Sbjct: 174 MAKVLARQSPKNIELLSLNPEHPNRSFDMADVEWIARIIWASQ 216


>gi|323135593|ref|ZP_08070676.1| putative phage repressor [Methylocystis sp. ATCC 49242]
 gi|322398684|gb|EFY01203.1| putative phage repressor [Methylocystis sp. ATCC 49242]
          Length = 213

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 94/224 (41%), Positives = 134/224 (59%), Gaps = 12/224 (5%)

Query: 1   MTS-FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           MT   SH +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR    GR RWPSTESI 
Sbjct: 1   MTDILSHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRETASGRQRWPSTESIA 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K+L AT  ++ + + L  ++  ++  ++   PL+    +G+GGFFD   F  G  W+ + 
Sbjct: 61  KVLQATGASLDEFMALVSAN--SSACRKHTRPLIGLAQAGAGGFFDDAGFAIGAGWDEID 118

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           V      H             +    SM PLYR GD++I++ A  V  GDR+++K   G+
Sbjct: 119 VLADADEH---------SYALEISGDSMFPLYRDGDVVIVSPAAPVRRGDRVVVKTTDGE 169

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           I+AK L  +  R+++L S+N  YP   +   ++ WIARILWASQ
Sbjct: 170 IMAKELKRQTARTVELRSINPAYPDRVIPREEVSWIARILWASQ 213


>gi|296446773|ref|ZP_06888712.1| putative phage repressor [Methylosinus trichosporium OB3b]
 gi|296255776|gb|EFH02864.1| putative phage repressor [Methylosinus trichosporium OB3b]
          Length = 213

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/220 (40%), Positives = 127/220 (57%), Gaps = 11/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+D + ER+ LTPSGLARKAGLDPT+FN+SKR   +G  RWPSTESI K+L 
Sbjct: 5   LTHAQIWAALDALGERYGLTPSGLARKAGLDPTTFNRSKRQTADGHLRWPSTESIAKVLQ 64

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT   + + + L  S G    +  +  PL+    +G GGFFD   F  G  W  + V   
Sbjct: 65  ATGAGLDEFMTLVSSKGARPSRSAR--PLIGLAQAGVGGFFDDAGFAIGAGWEEIDVLAD 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              H             +    SM PLYR GDI+I++ +  V  GDR+++K   G+I+AK
Sbjct: 123 TDEH---------SYALEISGDSMAPLYRDGDIVIVSPSAPVRRGDRVVVKTIAGEILAK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  +  ++++L SLN  +P   +   ++ W+ARILWASQ
Sbjct: 174 ELKRQTAKTVELKSLNPAFPDRVLPKEEVSWMARILWASQ 213


>gi|15964281|ref|NP_384634.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307307018|ref|ZP_07586757.1| putative phage repressor [Sinorhizobium meliloti BL225C]
 gi|307320672|ref|ZP_07600085.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|15073458|emb|CAC45100.1| Transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306893707|gb|EFN24480.1| putative phage repressor [Sinorhizobium meliloti AK83]
 gi|306901958|gb|EFN32557.1| putative phage repressor [Sinorhizobium meliloti BL225C]
          Length = 218

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 111/225 (49%), Positives = 146/225 (64%), Gaps = 11/225 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL
Sbjct: 1   MLSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRQSTDGRDRWPSTESIAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKE----IPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            AT  ++ Q L L   +   +E+++      IPL+ F  +G+GGFFD G FP G  W+T+
Sbjct: 61  HATGASVDQFLALMEPNAAGSEREDASAAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDTI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P            Q      + Q  SMLPLYR GD+LI++ + QV   DR+++K R G
Sbjct: 121 EFPTPERR-------QGGTYALEVQGDSMLPLYRDGDVLIVDPSAQVRRNDRVVVKTRGG 173

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AKVL  +  R I+L+SLN  +P    EM+D+EWIARI+WASQ
Sbjct: 174 EVMAKVLARQTPRGIELVSLNPDHPNRNFEMNDVEWIARIIWASQ 218


>gi|154245416|ref|YP_001416374.1| putative phage repressor [Xanthobacter autotrophicus Py2]
 gi|154159501|gb|ABS66717.1| putative phage repressor [Xanthobacter autotrophicus Py2]
          Length = 225

 Score =  201 bits (512), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 87/234 (37%), Positives = 130/234 (55%), Gaps = 22/234 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H ++W AID++AE+H L+ SGLAR++GLDPT+FN+SKR   +GR RWPSTESI K L
Sbjct: 1   MLTHGQVWRAIDQLAEQHGLSTSGLARRSGLDPTTFNRSKRITTDGRLRWPSTESIAKAL 60

Query: 63  AATNET-------------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
           +AT  +                       + +        IP + F  +GSGGFFD   F
Sbjct: 61  SATGTSAELFFAMMVPADERHGGAHGFAEESQPLTGPIHAIPQIGFAQAGSGGFFDDAGF 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P G  W+ +  PE+   H             +    SM P+YR GDI++++    V  GD
Sbjct: 121 PVGTGWDEIAFPEVEDQH---------AYALEIAGDSMQPVYRNGDIVVVSPGTPVRRGD 171

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R+++K R G+++AK L+ +  R ++L SLN  +    + +  +EW+ARI+WASQ
Sbjct: 172 RVVVKTREGEVLAKELVRKTTRHVELRSLNPAHEDRQIPLDQLEWMARIIWASQ 225


>gi|158422012|ref|YP_001523304.1| S24 family peptidase [Azorhizobium caulinodans ORS 571]
 gi|158328901|dbj|BAF86386.1| peptidase family S24 protein [Azorhizobium caulinodans ORS 571]
          Length = 222

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 92/231 (39%), Positives = 136/231 (58%), Gaps = 19/231 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW AIDR+AE + L+ SGLA++AGLD T+FN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLTHGQIWTAIDRLAEANGLSASGLAKRAGLDSTAFNRSKRITSDGRPRWPSTESVSKIL 60

Query: 63  AATNETICQL----------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
           +ATN ++                   +     + ++ IP +    +G GGFFD   FP G
Sbjct: 61  SATNTSMRAFLALLEGEDIGPSGFSEEPAPPFRPQRAIPHIGLAQAGDGGFFDDAGFPVG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           + W+ +  PE+   H             +    SMLPLYR GD+++++ A  V  GDR++
Sbjct: 121 SGWDEILFPEVEDEH---------AYALEISGDSMLPLYRPGDLVVVSPAASVRKGDRVV 171

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +K R G+++AK L+ R  R+++L SLN  Y   T+  +D+ WIARI+WASQ
Sbjct: 172 VKTRDGEVLAKELVRRTARTVELRSLNPEYEGRTLAATDVLWIARIIWASQ 222


>gi|298290079|ref|YP_003692018.1| phage repressor [Starkeya novella DSM 506]
 gi|296926590|gb|ADH87399.1| putative phage repressor [Starkeya novella DSM 506]
          Length = 206

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 92/221 (41%), Positives = 132/221 (59%), Gaps = 15/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW AID++AERH L+ S LA++AGLDPT+FN+SKR   +GR RWPSTESI KIL
Sbjct: 1   MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPDGRARWPSTESIAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++   + L     R      + IPL+ F  +G GG+FD   FP G  W+ +  P 
Sbjct: 61  AATGASLDDFMALIGGGTR------RAIPLIGFAQAGRGGYFDDAGFPVGGAWDEIEFPN 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H             +    SMLPLYR GD+++++ A     GDR+++K R G+++A
Sbjct: 115 VGDEH---------AYALEIAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEVMA 165

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  ++++L SLN  +     +  +I WIAR+LWASQ
Sbjct: 166 KELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ 206


>gi|83859576|ref|ZP_00953096.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
 gi|83851935|gb|EAP89789.1| peptidase S24 [Oceanicaulis alexandrii HTCC2633]
          Length = 210

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/224 (38%), Positives = 120/224 (53%), Gaps = 15/224 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIF 59
           M   +H +IW  IDR+A R  LTPSGLAR+AGLDPT+FN SKR   +G + RWPSTES+ 
Sbjct: 1   MPMLTHAQIWSGIDRLAHRAGLTPSGLARRAGLDPTTFNPSKRTSADGAKPRWPSTESLA 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K L AT  +      L            + +PLL F  +G  G+FD   FPTG  W  + 
Sbjct: 61  KALEATRVSFDDFAALAM-----GHTAGRSVPLLGFAQAGDHGYFDDAGFPTGEGWEDIR 115

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P                   +    SM P+YR GD ++++       GDR+++K R+G+
Sbjct: 116 FPGDEGEG---------AYALEISGESMSPVYRHGDRIVVSPDAPPRRGDRVVVKTRSGE 166

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK L      S++L+SLN  Y    +   D+ W+ARI+WASQ
Sbjct: 167 VMAKELGRVTAESVELISLNPSYDNRILSTRDLVWMARIVWASQ 210


>gi|222084796|ref|YP_002543325.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722244|gb|ACM25400.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 221

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 109/228 (47%), Positives = 147/228 (64%), Gaps = 14/228 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AID++AER+ LTPSGLAR+AGLDPTSFNKSKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWSAIDKLAERYALTPSGLARRAGLDPTSFNKSKRLGQDGRLRWPSTESIAKVL 60

Query: 63  AATNETICQL-------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
            AT  ++ Q             +    +      IPLL F  +GSGGFFD G FP G  W
Sbjct: 61  GATGASMEQFLGILRPVERGDGNADHASSPPASSIPLLGFAQAGSGGFFDDGGFPAGQGW 120

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P       G+YA++        Q  SMLPLYR GD+LI+    Q+   DR+++K 
Sbjct: 121 DMVEFPAAPGQKGGVYALE-------VQGESMLPLYRDGDVLIVEPGAQIRRSDRVVVKT 173

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AKVL+ +  +SI+L+SLN  +P  + +++D+EWIARI+WASQ
Sbjct: 174 REGEVMAKVLLRQSAKSIELLSLNPEHPNRSFDLADVEWIARIIWASQ 221


>gi|86751722|ref|YP_488218.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
 gi|86574750|gb|ABD09307.1| putative phage repressor [Rhodopseudomonas palustris HaA2]
          Length = 210

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 96/223 (43%), Positives = 136/223 (60%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+PSGLA+K+GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MQMLTHDQIWTALDRLAERSGLSPSGLAKKSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L         +  + +PLL    +G+GGFFD G FP G  W+ +G+
Sbjct: 61  ALAATNTAIDTFVQLITDRP----RVVQSVPLLGLAQAGAGGFFDDGGFPAGKGWDEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P I   H             +    SM P YR GDI++++    +  GDR+++K  +G++
Sbjct: 117 PSINDEH---------AYALEISGESMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTSGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +P  T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHPDRTLAPADVEWIARIVWASQ 210


>gi|239787365|emb|CAX83841.1| Predicted transcriptional regulator [uncultured bacterium]
          Length = 210

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 88/221 (39%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AIDR+A +H LT SGLARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLRHADIWHAIDRLAFKHGLTASGLARKAGLDPTTFNKSKRTSPEGKLRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  +I + + +  +         + IPL+    +GS G+FD   +PTG  W+ +  PE
Sbjct: 61  TATGASIAEFVTMIDN--PDETGAVQRIPLIGLAQAGSDGYFDDAGYPTGAGWDEIPFPE 118

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +           ++    +    SM PLYR+GDI+I++ A Q+   DR+++K   G+++ 
Sbjct: 119 MGD---------SKAYALEITGDSMEPLYREGDIVIVSPAAQIRRADRVIVKTNDGEVMV 169

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L+ R  + +DL SLN  +P  ++ + ++  I R++WASQ
Sbjct: 170 KQLLRRTAKFVDLQSLNDQHPNRSLPIEEVALIHRVVWASQ 210


>gi|114704909|ref|ZP_01437817.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
 gi|114539694|gb|EAU42814.1| Peptidase family S24:Peptidase S24, C-terminal [Fulvimarina pelagi
           HTCC2506]
          Length = 216

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/225 (41%), Positives = 136/225 (60%), Gaps = 13/225 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH +IW AID +A+R+ LTPSGLARKAGLDPT+FNKSKR   +GR RWPSTES+ KI 
Sbjct: 1   MFSHDEIWSAIDALAKRNGLTPSGLARKAGLDPTTFNKSKRQSTDGRPRWPSTESLSKIF 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPL----LYFPPSGSGGFFDSGVFPTGNKWNTV 118
            A N +      L   D   ++ K +  P+    L    +G GGFFD   FP G+ W+ +
Sbjct: 61  EAVNSSFGDFAQLVSGDDAESDSKVRSKPVSVPLLGLAEAGGGGFFDDAGFPAGHGWDEI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P+ +                +    SM PLYR+GD ++++    V  GDR+++K R G
Sbjct: 121 TLPDGKDEP---------MYALEVSGRSMEPLYREGDRIVVSPTASVRRGDRVVVKTREG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK+L  +  R+I+L SLN  +P+    + +I+W+ARI+WA+Q
Sbjct: 172 EVMAKILQRQTARTIELSSLNPDFPLRQFAVEEIDWLARIVWATQ 216


>gi|91975266|ref|YP_567925.1| putative phage repressor [Rhodopseudomonas palustris BisB5]
 gi|91681722|gb|ABE38024.1| peptidase S24, S26A and S26B [Rhodopseudomonas palustris BisB5]
          Length = 210

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 93/223 (41%), Positives = 132/223 (59%), Gaps = 13/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +H +IW A+DR+AER  L+ SGLA+++GLDPT+FNKSKR   +GR RWPSTES+ K
Sbjct: 1   MHMLTHDQIWTALDRLAERAGLSASGLAKRSGLDPTTFNKSKRITNDGRERWPSTESVAK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            LAATN  I   + L         +  + +PLL    +G+GGFFD G FP G  W  VG+
Sbjct: 61  ALAATNTAIDTFVQLITDRP----RVVQSVPLLGLAQAGAGGFFDDGGFPAGKGWEEVGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +   H             +    SM P YR GDI++++    +  GDR+++K   G++
Sbjct: 117 PSVNDEH---------AYALEISGDSMKPAYRDGDIIVVSPGTAIRRGDRVVVKTTGGEV 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + K L  R  + ++L SLN  +   T+  +D+EWIARI+WASQ
Sbjct: 168 MVKELKRRTTKIVELASLNPSHADRTLAPADVEWIARIVWASQ 210


>gi|163851531|ref|YP_001639574.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163663136|gb|ABY30503.1| peptidase S24 and S26 domain protein [Methylobacterium extorquens
           PA1]
          Length = 210

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 92/222 (41%), Positives = 130/222 (58%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQGPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++            +    + Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGG---------DRAFALEVQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++D+ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLADVAWMARVMWVRQ 210


>gi|218530341|ref|YP_002421157.1| phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240138699|ref|YP_002963171.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
 gi|218522644|gb|ACK83229.1| putative phage repressor [Methylobacterium chloromethanicum CM4]
 gi|240008668|gb|ACS39894.1| putative LexA/Signal peptidase [Methylobacterium extorquens AM1]
          Length = 210

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 91/222 (40%), Positives = 130/222 (58%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQGPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++            +    + Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGG---------DRAFALEVQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLNNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|254561298|ref|YP_003068393.1| LexA/Signal peptidase [Methylobacterium extorquens DM4]
 gi|254268576|emb|CAX24533.1| putative LexA/Signal peptidase [Methylobacterium extorquens DM4]
          Length = 210

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 91/222 (40%), Positives = 130/222 (58%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           AAT  ++   L L  S    T      +PL+    +GSG  F+    PTG   W+ +  P
Sbjct: 61  AATGASLDDFLHLVDSGQAPTRT---MVPLIGLTQAGSGRLFNEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++            +    + Q  SMLPLYR GD+LI+     +  GDR++ +   G+++
Sbjct: 118 DLGG---------DRAFALEVQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|188581313|ref|YP_001924758.1| phage repressor [Methylobacterium populi BJ001]
 gi|179344811|gb|ACB80223.1| putative phage repressor [Methylobacterium populi BJ001]
          Length = 210

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 91/222 (40%), Positives = 129/222 (58%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWTAIDRLAERHGFSASGLARRAGLDATSFNRSKRVGPDGRKRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVGVP 121
           +AT  ++   L L  S   +       +PL+    +GSG  F     PTG   W+ +  P
Sbjct: 61  SATGASLDDFLHLVDSGQASART---MVPLIGLTQAGSGRLFTEEGIPTGGPGWDEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++   H             + Q  SMLPLYR GD+LI+     +  GDR++ +   G++V
Sbjct: 118 DLGGDH---------AFALEVQGDSMLPLYRDGDVLIVAPNASIRKGDRIVARLTNGEVV 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+I+L SLN  +    V ++++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTIELASLNPDHEDRAVPLAEVAWMARVMWVRQ 210


>gi|23015760|ref|ZP_00055528.1| COG2932: Predicted transcriptional regulator [Magnetospirillum
           magnetotacticum MS-1]
          Length = 211

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 88/221 (39%), Positives = 125/221 (56%), Gaps = 10/221 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+L
Sbjct: 1   MLKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRVTREGKPRWPSTESVAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  T+   +           +    IPL+ F  +G  G+FD   +P G  W+ +  PE
Sbjct: 61  EATGATMTAFVGYIEDT-AQARQTANTIPLIGFAQAGDCGYFDDAGYPVGGSWDEIPFPE 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           I  PH             +    SM PLYR GD++I++ A  V  GDR++++   G+++ 
Sbjct: 120 IGDPH---------AYALEVSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEVMV 170

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L+ +  + I+L S+N  +P  ++   ++ WIARILW+SQ
Sbjct: 171 KQLVRQTAKRIELASINPAHPGRSLATEEVAWIARILWSSQ 211


>gi|222147460|ref|YP_002548417.1| bacteriophage repressor protein [Agrobacterium vitis S4]
 gi|221734450|gb|ACM35413.1| bacteriophage repressor protein [Agrobacterium vitis S4]
          Length = 224

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 106/233 (45%), Positives = 138/233 (59%), Gaps = 21/233 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW AIDR+AE+++LTPSGLARKAGLDPTSFNKSKR G +GR RWPSTESI K+L
Sbjct: 1   MLSHETIWNAIDRLAEQYHLTPSGLARKAGLDPTSFNKSKRVGPDGRMRWPSTESIAKVL 60

Query: 63  AATNETICQLLD------------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
            AT   I Q +                        +   IPLL    +GSGGFFD G FP
Sbjct: 61  EATGARIDQFVTLISNDNHQVNAVHETLPDGNFPPQIGTIPLLGLAQAGSGGFFDDGGFP 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            G  W+ V +P          + +      + Q  SM PLYR GDILI+     V  GDR
Sbjct: 121 AGQGWDLVDLPT---------SAKPGVYALEIQGDSMKPLYRDGDILIVEPGAPVRRGDR 171

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++K   G+++AKVL  +  R++DL+S+N  +P   ++M D+EWIARI+W SQ
Sbjct: 172 VVVKTCDGEVMAKVLGRQTARTVDLISINPDHPNRVLDMQDVEWIARIIWVSQ 224


>gi|170746983|ref|YP_001753243.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
 gi|170653505|gb|ACB22560.1| putative phage repressor [Methylobacterium radiotolerans JCM 2831]
          Length = 210

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/222 (38%), Positives = 129/222 (58%), Gaps = 13/222 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AIDR+AERH  + SGLAR+AGLD TSFN+SKR G +GR RWPSTES+ K+L
Sbjct: 1   MLSHEQIWNAIDRLAERHGYSASGLARRAGLDATSFNRSKRVGADGRKRWPSTESVSKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG-NKWNTVGVP 121
           AAT  ++ + L L              +PL+    +G+G  F     PTG   W  +  P
Sbjct: 61  AATGSSLDEFLRLIE---AREIPARTMVPLIGLTQAGAGRLFTDEGMPTGGAGWEEIEFP 117

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           ++          + +    + Q  SMLPL+R GD+LI++    V  GDR++++   G+++
Sbjct: 118 DLG---------EERAFALEIQGDSMLPLFRDGDVLIVSPTASVRKGDRVVVRLHGGEVL 168

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AK L  R  R+++L SLN  +    + + ++ W+AR++W  Q
Sbjct: 169 AKELRRRTARTVELASLNPEHEDRVLNLGEVAWMARVMWVRQ 210


>gi|114799918|ref|YP_759340.1| S24 family peptidase [Hyphomonas neptunium ATCC 15444]
 gi|114740092|gb|ABI78217.1| peptidase, S24 family [Hyphomonas neptunium ATCC 15444]
          Length = 205

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 86/220 (39%), Positives = 115/220 (52%), Gaps = 15/220 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             HK IW  +D +A  H LT S LA++AGLDPTSFN SKR   +GR RWPSTES+ ++L 
Sbjct: 1   MQHKDIWRGLDLLAAHHGLTASALAKRAGLDPTSFNPSKREAADGRPRWPSTESLARVLD 60

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A          L         ++    PL+ F  +G  GFFD   FP G  W  V  P +
Sbjct: 61  AVGAGFDDFAALVEG------RRGGSAPLIGFAQAGQDGFFDDAGFPVGAGWEEVRFPGL 114

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +               +    SM P YR GD +I+    +V  GDR++ K   G+++AK
Sbjct: 115 GAE---------TVYALEISGDSMEPAYRAGDRIIVAPGAEVKPGDRVVAKTVAGEVMAK 165

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VL  +  R I+L SLN  YP    + S++ W+ARILWASQ
Sbjct: 166 VLARKNTRLIELASLNPAYPAREFKPSEVAWLARILWASQ 205


>gi|167644106|ref|YP_001681769.1| putative phage repressor [Caulobacter sp. K31]
 gi|167346536|gb|ABZ69271.1| putative phage repressor [Caulobacter sp. K31]
          Length = 219

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 16/227 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  SH +IW AID +A+R +++PS +A+ AGLDPTSFN+SKR   + R RWPSTES+ K
Sbjct: 5   MSPLSHTEIWTAIDALAKRFDMSPSAMAKMAGLDPTSFNRSKRGDGDARPRWPSTESLAK 64

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT     +   L            + +PL+ F  +G+ G FD    P G  W+ +  
Sbjct: 65  VLEATGVGFSEFAALTERVRP---LNPRVVPLIGFAQAGAEGVFDETGAPIGAGWDEIDF 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +                 +    ++ P++R GD ++++ +     GDR++++   G++
Sbjct: 122 PGLGDEG---------VYALEITGDALAPVFRDGDRILVSPSAPPRRGDRVVVRTAGGEL 172

Query: 181 VAKVLISRRGRSIDLMSLN----CCYPVDTVEMSDIEWIARILWASQ 223
           + K L     RS++L  LN          T+++ ++ WIARILWASQ
Sbjct: 173 LVKELARVTARSVELAPLNRLDGRDGGDRTLDLGEVVWIARILWASQ 219


>gi|209883821|ref|YP_002287678.1| peptidase S24 [Oligotropha carboxidovorans OM5]
 gi|209872017|gb|ACI91813.1| peptidase S24 [Oligotropha carboxidovorans OM5]
          Length = 207

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 92/221 (41%), Positives = 133/221 (60%), Gaps = 14/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             +H +IW A+DR+A R  L+PSGLA++AGLDPT+FNKSKR   +GR RWPSTES+ K L
Sbjct: 1   MMTHDQIWAALDRLAARAGLSPSGLAKRAGLDPTTFNKSKRVTNDGRERWPSTESVAKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  ++             +  +  ++PLL F  +GSGG+FD G FP G  WN VG+P 
Sbjct: 61  AATGVSVDTFAHFIE-----SSSRTVQVPLLGFAEAGSGGYFDDGGFPVGEGWNEVGLPS 115

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +   H             +    SM P YR GD+++++    +  GDR+++K + G+++ 
Sbjct: 116 VNDEH---------AYALEISGDSMKPAYRDGDVIVVSPGAPIRRGDRVVVKTKDGEVMV 166

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L  R  + I+L SLN  +P  T   ++I+WIARI+WASQ
Sbjct: 167 KELRRRTQKVIELQSLNPAHPDRTFPTAEIDWIARIVWASQ 207


>gi|163761294|ref|ZP_02168369.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162281451|gb|EDQ31747.1| putative phage-related transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 226

 Score =  191 bits (486), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 145/231 (62%), Gaps = 16/231 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              SH++IW A+D +AERH LT SGLAR+AGLDPT+FNKSKR G +GR+RWPSTES+ K+
Sbjct: 3   PMLSHERIWSALDALAERHGLTASGLARRAGLDPTAFNKSKRRGADGRDRWPSTESLAKV 62

Query: 62  LAATNETICQLL---------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
           L AT  ++   +         D           +   IPLL F  +GSGGFFD G FP G
Sbjct: 63  LDATGSSLNDFMSLVVGGQRNDASAIPEGAFPPQAGSIPLLGFAQAGSGGFFDDGGFPAG 122

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             W+ V  P   S   G+YA++        Q  SMLPLYR GDILI+    QV  GDR++
Sbjct: 123 QGWDVVDFPAQPSERPGVYALE-------VQGDSMLPLYRDGDILIVEPGAQVRRGDRVV 175

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++   G+++AKVL     RS++L+SLN  +P  + E+S+I+W+ARI+WASQ
Sbjct: 176 VRSGEGEVMAKVLNRLSPRSVELISLNPDHPNRSFELSEIDWMARIIWASQ 226


>gi|83313328|ref|YP_423592.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82948169|dbj|BAE53033.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 223

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 87/222 (39%), Positives = 126/222 (56%), Gaps = 10/222 (4%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
               H  IW AID +A  H LT S LARKAGLDPT+FNKSKR   EG+ RWPSTES+ K+
Sbjct: 12  PMLKHADIWAAIDALARDHGLTASALARKAGLDPTTFNKSKRITREGKPRWPSTESVAKV 71

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L AT  ++   +       +    +   IPL+ F  +G  G+FD   +P G  W+ +  P
Sbjct: 72  LEATGASMTAFVAYIEDLAQP-HNQASTIPLVGFAQAGDRGYFDDAGYPVGGSWDEIPFP 130

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           EI  PH             +    SM PLYR GD++I++ A  V  GDR++++   G+++
Sbjct: 131 EIGDPH---------AYALEVSGDSMEPLYRDGDVVIVSPAAGVRRGDRVVVRTTEGEVM 181

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            K L+ +  R I+L S+N  +P  ++   ++ W+ARILW+SQ
Sbjct: 182 VKQLLRQTARRIELGSINPAHPGRSLATEEVAWMARILWSSQ 223


>gi|110632380|ref|YP_672588.1| putative phage repressor [Mesorhizobium sp. BNC1]
 gi|110283364|gb|ABG61423.1| putative phage repressor [Chelativorans sp. BNC1]
          Length = 214

 Score =  191 bits (484), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 90/223 (40%), Positives = 134/223 (60%), Gaps = 11/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+K+W AID +A RH+L+ SGLARKAGLD T+FN+SKR   +GR RWPSTES+ KI+
Sbjct: 1   MLSHEKVWAAIDALAARHSLSASGLARKAGLDSTAFNRSKRHSPDGRPRWPSTESLAKIM 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPL--LYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            AT  T+ +   L      +  +K   I +  + F  +G+GG+F    FP G  W  V +
Sbjct: 61  DATGVTLGEFTALIEEMAESGRRKPGRISVPLIGFAQAGAGGYFTDAGFPVGQGWEQVEL 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P   S               + Q  SMLPLYR GD+L++  +  V  GDR++++   G++
Sbjct: 121 PGQVSE---------AAYALEVQGDSMLPLYRNGDVLVVEPSAPVRRGDRVVVRTLDGEV 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK+L+ +  R ++L+SLN  +P   +   +++WIARI+WASQ
Sbjct: 172 MAKILLRQTSRQMELLSLNPDHPNRVLGHEEVDWIARIVWASQ 214


>gi|86356189|ref|YP_468081.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280291|gb|ABC89354.1| putative transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 223

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 115/230 (50%), Positives = 151/230 (65%), Gaps = 16/230 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SHK+IWEAIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHKQIWEAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFS---------DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            AT  ++ Q L                R        IPLL F  +G+GGFFD G FP G+
Sbjct: 61  DATGASMEQFLAFMQPASSSSGERIGERAGPSPGGAIPLLGFAQAGAGGFFDDGGFPAGH 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+++
Sbjct: 121 GWDVVEFPPKPSQRSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVV 173

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +  TG+++AKVL+ +  RSI+LMSLN  +P  T++++D++WIARI+WASQ
Sbjct: 174 RTCTGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLADVDWIARIIWASQ 223


>gi|315499624|ref|YP_004088427.1| phage repressor [Asticcacaulis excentricus CB 48]
 gi|315417636|gb|ADU14276.1| putative phage repressor [Asticcacaulis excentricus CB 48]
          Length = 209

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 123/224 (54%), Gaps = 19/224 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE--GRNRWPSTESIFK 60
           S SH +IW AIDR+A     +PSGLAR AGLDPT+FNKSKR   E   R RWPSTES+ K
Sbjct: 2   SLSHAQIWNAIDRLARNLGTSPSGLARLAGLDPTAFNKSKRQSTEDPPRPRWPSTESLAK 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT ++      L            K +PL+ F  +G+ G FD   FP G  W+ +G+
Sbjct: 62  VLDATGQSFPDFAALTE-----PRPVPKGVPLIGFAQAGNDGLFDDAGFPVGQGWDEIGL 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS-AIQVNCGDRLLIKPRTGD 179
           P                   +    SMLPLYR GD +I++     +  GDR+++K   G+
Sbjct: 117 PAG-----------EGLYALEISGDSMLPLYRDGDRIIVDPLRQNLRRGDRVVVKTSEGE 165

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK L+    + ++L SLN  +    +E S + W+ARI+WASQ
Sbjct: 166 VMAKELVRLTEKQVELRSLNPDFSNRVLERSQVTWLARIVWASQ 209


>gi|254292703|ref|YP_003058726.1| phage repressor [Hirschia baltica ATCC 49814]
 gi|254041234|gb|ACT58029.1| putative phage repressor [Hirschia baltica ATCC 49814]
          Length = 206

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 86/221 (38%), Positives = 119/221 (53%), Gaps = 16/221 (7%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKIL 62
             H  IW  ID +A RH L+ S LAR AGLD T+FNKSKR   +G + RWPSTES+ K L
Sbjct: 1   MRHSDIWNGIDALAARHGLSVSALARAAGLDATAFNKSKRASADGSKPRWPSTESLSKAL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AA      +  D+         ++ + IPL+    +G GGFFD   FP G  W+ +  P+
Sbjct: 61  AAVGTGWEEFADMAQG------RQGRTIPLIGLAQAGDGGFFDDAGFPVGASWDDIHFPD 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +                 +    SM P++R+GD +I+   + V  GDR++ K + G+++A
Sbjct: 115 MGDE---------TVYALEISGDSMEPVFREGDRIIVAPGMDVRRGDRVVAKTKEGEVLA 165

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           K L       ++L+S N  YP      SDIEWIARILWASQ
Sbjct: 166 KFLGHLSASRVELISANPAYPPREFAASDIEWIARILWASQ 206


>gi|218671565|ref|ZP_03521235.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli GR56]
          Length = 223

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 115/230 (50%), Positives = 152/230 (66%), Gaps = 16/230 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTT---------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            AT  ++ Q L        ++               IPLL F  +G+GGFFD G FP G 
Sbjct: 61  DATGASMEQFLAFMRPGANSSAELPGERAKPPHGGAIPLLGFAQAGAGGFFDDGGFPAGQ 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+++
Sbjct: 121 GWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRVVV 173

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 RTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 223


>gi|189022624|ref|YP_001932365.1| Peptidase family S24 [Brucella abortus S19]
 gi|260544608|ref|ZP_05820429.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261756989|ref|ZP_06000698.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306839063|ref|ZP_07471883.1| Peptidase family S24 [Brucella sp. NF 2653]
 gi|306841676|ref|ZP_07474363.1| Peptidase family S24 [Brucella sp. BO2]
 gi|189021198|gb|ACD73919.1| Peptidase family S24 [Brucella abortus S19]
 gi|260097879|gb|EEW81753.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|261736973|gb|EEY24969.1| peptidase family S24 [Brucella sp. F5/99]
 gi|306288206|gb|EFM59590.1| Peptidase family S24 [Brucella sp. BO2]
 gi|306405886|gb|EFM62145.1| Peptidase family S24 [Brucella sp. NF 2653]
          Length = 223

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 99/228 (43%), Positives = 131/228 (57%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  +                   +    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P                   +    SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|225629264|ref|ZP_03787297.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237816924|ref|ZP_04595916.1| Repressor protein C [Brucella abortus str. 2308 A]
 gi|225615760|gb|EEH12809.1| Repressor protein C [Brucella ceti str. Cudo]
 gi|237787737|gb|EEP61953.1| Repressor protein C [Brucella abortus str. 2308 A]
          Length = 234

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 99/228 (43%), Positives = 131/228 (57%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 16  TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 75

Query: 62  LAATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  +                   +    IPLL    +G+GG+FD   FP G  W
Sbjct: 76  MEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 135

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P                   +    SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 136 DIVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 186

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 187 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 234


>gi|265999054|ref|ZP_05464836.2| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
 gi|263092030|gb|EEZ16327.1| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
          Length = 223

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 99/228 (43%), Positives = 132/228 (57%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  + +                 +    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P                   +    SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|260564858|ref|ZP_05835343.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
 gi|260152501|gb|EEW87594.1| peptidase family S24 [Brucella melitensis bv. 1 str. 16M]
          Length = 223

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 99/228 (43%), Positives = 132/228 (57%), Gaps = 15/228 (6%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K+
Sbjct: 5   TMFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKV 64

Query: 62  LAATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
           + AT  T  + +                 +    IPLL    +G+GG+FD   FP G  W
Sbjct: 65  MEATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAKAGAGGYFDDAGFPAGQGW 124

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           + V  P                   +    SMLPLYR GD LI+     V  GDR++++ 
Sbjct: 125 DIVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRT 175

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           R G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 176 RDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 223


>gi|23500526|ref|NP_699966.1| S24 family peptidase [Brucella suis 1330]
 gi|62317372|ref|YP_223225.1| S24 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|83269348|ref|YP_418639.1| S24 family peptidase [Brucella melitensis biovar Abortus 2308]
 gi|148558376|ref|YP_001257738.1| S24 family peptidase [Brucella ovis ATCC 25840]
 gi|161620851|ref|YP_001594737.1| repressor protein C [Brucella canis ATCC 23365]
 gi|163844918|ref|YP_001622573.1| hypothetical protein BSUIS_B0784 [Brucella suis ATCC 23445]
 gi|254695818|ref|ZP_05157646.1| Peptidase family S24 [Brucella abortus bv. 3 str. Tulya]
 gi|254698652|ref|ZP_05160480.1| Peptidase family S24 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700006|ref|ZP_05161834.1| Peptidase family S24 [Brucella suis bv. 5 str. 513]
 gi|254703127|ref|ZP_05164955.1| Peptidase family S24 [Brucella suis bv. 3 str. 686]
 gi|254705728|ref|ZP_05167556.1| Peptidase family S24 [Brucella pinnipedialis M163/99/10]
 gi|254720098|ref|ZP_05181909.1| Peptidase family S24 [Brucella sp. 83/13]
 gi|254732099|ref|ZP_05190677.1| Peptidase family S24 [Brucella abortus bv. 4 str. 292]
 gi|256015557|ref|YP_003105566.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|256157535|ref|ZP_05455453.1| Peptidase family S24 [Brucella ceti M490/95/1]
 gi|256253490|ref|ZP_05459026.1| Peptidase family S24 [Brucella ceti B1/94]
 gi|256256056|ref|ZP_05461592.1| Peptidase family S24 [Brucella abortus bv. 9 str. C68]
 gi|260167569|ref|ZP_05754380.1| Peptidase family S24 [Brucella sp. F5/99]
 gi|260759885|ref|ZP_05872233.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763123|ref|ZP_05875455.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882275|ref|ZP_05893889.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216238|ref|ZP_05930519.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261220617|ref|ZP_05934898.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313149|ref|ZP_05952346.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261750489|ref|ZP_05994198.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753747|ref|ZP_05997456.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265985104|ref|ZP_06097839.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265996036|ref|ZP_06108593.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297249410|ref|ZP_06933111.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306846010|ref|ZP_07478577.1| Peptidase family S24 [Brucella sp. BO1]
 gi|23464158|gb|AAN33971.1| peptidase, S24 family [Brucella suis 1330]
 gi|62197565|gb|AAX75864.1| peptidase, S24 family [Brucella abortus bv. 1 str. 9-941]
 gi|82939622|emb|CAJ12611.1| Peptidase family S24:Peptidase S24, C-terminal [Brucella melitensis
           biovar Abortus 2308]
 gi|148369661|gb|ABQ62533.1| peptidase, S24 family [Brucella ovis ATCC 25840]
 gi|161337662|gb|ABX63966.1| Repressor protein C [Brucella canis ATCC 23365]
 gi|163675641|gb|ABY39751.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|255998217|gb|ACU49904.1| peptidase, S24 family [Brucella microti CCM 4915]
 gi|260670203|gb|EEX57143.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673544|gb|EEX60365.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260871803|gb|EEX78872.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917845|gb|EEX84706.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919201|gb|EEX85854.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261302175|gb|EEY05672.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740242|gb|EEY28168.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743500|gb|EEY31426.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550333|gb|EEZ06494.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264663696|gb|EEZ33957.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|297173279|gb|EFH32643.1| peptidase family S24 [Brucella abortus bv. 5 str. B3196]
 gi|306273645|gb|EFM55490.1| Peptidase family S24 [Brucella sp. BO1]
          Length = 218

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 98/227 (43%), Positives = 130/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +                   +    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|327190883|gb|EGE57941.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CNPAF512]
          Length = 228

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 114/235 (48%), Positives = 152/235 (64%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQL--------------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q                +         + +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQQPDSRFQPQGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|241202972|ref|YP_002974068.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856862|gb|ACS54529.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 225

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 111/232 (47%), Positives = 147/232 (63%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLP-----------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q +                       +   IPLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P   S   G+YA++        Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPAAPSQKAGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040121|gb|ACT56917.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 223

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 223/223 (100%), Positives = 223/223 (100%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK
Sbjct: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV
Sbjct: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI
Sbjct: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ
Sbjct: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223


>gi|218516275|ref|ZP_03513115.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli 8C-3]
          Length = 228

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 114/235 (48%), Positives = 152/235 (64%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQL--------------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q                +         + +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPEGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|254712567|ref|ZP_05174378.1| Peptidase family S24 [Brucella ceti M644/93/1]
 gi|254715639|ref|ZP_05177450.1| Peptidase family S24 [Brucella ceti M13/05/1]
 gi|261217388|ref|ZP_05931669.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320261|ref|ZP_05959458.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922477|gb|EEX89045.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292951|gb|EEX96447.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 218

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 99/227 (43%), Positives = 131/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +                   +    IPLL    +G+GG+FD   FPTG  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPTGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|116250339|ref|YP_766177.1| phage-related transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254987|emb|CAK06061.1| putative phage-related transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 225

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 113/232 (48%), Positives = 153/232 (65%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IWEA+DR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEI-----------PLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q L     D   +E++ ++            PLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASMEQFLAFMRPDAGPSEQQARQQENAFQPQGGSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+L+SLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|190890233|ref|YP_001976775.1| phage-related transcriptional regulator protein [Rhizobium etli
           CIAT 652]
 gi|190695512|gb|ACE89597.1| putative phage-related transcriptional regulator protein [Rhizobium
           etli CIAT 652]
          Length = 228

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 114/235 (48%), Positives = 152/235 (64%), Gaps = 21/235 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IWEAIDR+AERH+LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHEQIWEAIDRLAERHDLTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQL--------------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
            AT  ++ Q                +         + +   IPLL F  +G+GGFFD G 
Sbjct: 61  DATGASMEQFLALLPPGGTAAERTGERAQRLDSRFQPQGGAIPLLGFAQAGAGGFFDDGG 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           FP G  W+ V  P   S  +G+YA++        Q  SM+PLYR GD+LI+    QV   
Sbjct: 121 FPAGQGWDVVEFPAAPSQKSGVYALE-------VQGESMMPLYRDGDVLIVEPGAQVRRN 173

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           DR++++ R G+++AKVL+ +  RSI+LMSLN  +P  T+++SD+EWIARI+WASQ
Sbjct: 174 DRVVVRTREGEVMAKVLLRQSPRSIELMSLNPEHPNRTLDLSDVEWIARIIWASQ 228


>gi|225686559|ref|YP_002734531.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|256111295|ref|ZP_05452321.1| DNA-binding protein RDGA [Brucella melitensis bv. 3 str. Ether]
 gi|265992801|ref|ZP_06105358.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225642664|gb|ACO02577.1| Repressor protein C [Brucella melitensis ATCC 23457]
 gi|262763671|gb|EEZ09703.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|326410945|gb|ADZ68009.1| Repressor protein C [Brucella melitensis M28]
 gi|326554236|gb|ADZ88875.1| Repressor protein C [Brucella melitensis M5-90]
          Length = 218

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/227 (43%), Positives = 131/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  + +                 +    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|17988843|ref|NP_541476.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. 16M]
 gi|256043668|ref|ZP_05446593.1| DNA-binding protein RDGA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265990088|ref|ZP_06102645.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984666|gb|AAL53740.1| DNA-binding protein rdga [Brucella melitensis bv. 1 str. 16M]
 gi|263000757|gb|EEZ13447.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/227 (43%), Positives = 131/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  + +                 +    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFIRLIAGVDSLPRHLGEYTQDPHPIPLLGMAKAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|256059031|ref|ZP_05449240.1| Peptidase family S24 [Brucella neotomae 5K33]
 gi|261322976|ref|ZP_05962173.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261298956|gb|EEY02453.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 218

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 97/227 (42%), Positives = 130/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AER++L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERYSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +                   +    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ 218


>gi|150395367|ref|YP_001325834.1| putative phage repressor [Sinorhizobium medicae WSM419]
 gi|150026882|gb|ABR58999.1| putative phage repressor [Sinorhizobium medicae WSM419]
          Length = 215

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 112/222 (50%), Positives = 147/222 (66%), Gaps = 8/222 (3%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AID +AERH L+PSGLAR+AGLDPTSFNKSKR   +GR+RWPSTESI KIL
Sbjct: 1   MLSHDSIWRAIDALAERHRLSPSGLARRAGLDPTSFNKSKRRSADGRDRWPSTESISKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKE-IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
            AT  T+ Q + L   +   +EK+    IPL+ F  +G+GGFFD G FP G  W+++  P
Sbjct: 61  QATGATVDQFMALMQPNAAGSEKESAPGIPLIGFAQAGAGGFFDDGGFPVGQGWDSIEFP 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                  G YA++        Q  SMLPLYR GDILI++ + QV   DR++++ R G+++
Sbjct: 121 TAERRQTGAYALE-------VQGDSMLPLYRDGDILIVDPSAQVRRNDRVVVRTREGEVM 173

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           AKVL  +  R I+L+SLN  +P    EM ++EWIARI+WASQ
Sbjct: 174 AKVLARQTPRGIELVSLNPDHPNRNFEMKEVEWIARIIWASQ 215


>gi|209547798|ref|YP_002279715.1| phage repressor [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533554|gb|ACI53489.1| putative phage repressor [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 225

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 109/232 (46%), Positives = 142/232 (61%), Gaps = 18/232 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IW AIDR+AERH LTPSGLAR+AGLDPTSFNKSKR   +GR RWPSTESI K+L
Sbjct: 1   MLSHDQIWGAIDRLAERHELTPSGLARRAGLDPTSFNKSKRLSADGRLRWPSTESIAKVL 60

Query: 63  AATNETICQL-----------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            AT  ++ Q                         +   IPLL F  +G+GGFFD G FP 
Sbjct: 61  DATGASVEQFLAFLQPDAGFSKRPAGQSDGAFPPQGSSIPLLGFAQAGAGGFFDDGGFPA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G  W+ V  P          A ++     + Q  SM+PLYR GD+LI+    QV   DR+
Sbjct: 121 GQGWDVVEFPA-------APAQKSAVYALEVQGESMMPLYRDGDVLIVEPGAQVRRNDRV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++   G+++AKVL+ +  RSI+LMSLN  +P  T+E+SD++WIARI+WASQ
Sbjct: 174 VVRTCEGEVMAKVLLRQSPRSIELMSLNPEHPNRTLELSDVDWIARIIWASQ 225


>gi|209966574|ref|YP_002299489.1| peptidase family S24, putative [Rhodospirillum centenum SW]
 gi|209960040|gb|ACJ00677.1| peptidase family S24, putative [Rhodospirillum centenum SW]
          Length = 214

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 88/223 (39%), Positives = 131/223 (58%), Gaps = 11/223 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H +IW AIDR+A RH L+ SGLA++ GLDPT+FN+SKR   +G+ RWPSTES+ K+L
Sbjct: 1   MIKHAEIWRAIDRLAARHGLSASGLAKRGGLDPTTFNRSKRVTHDGKLRWPSTESLAKVL 60

Query: 63  AATNETICQLLD--LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            ATN T   L+        G+      + +P++ +  +GS GFFD   +P GN W+ +  
Sbjct: 61  EATNSTFADLVALAGDGPVGQAAPVHVQRVPVIGYAQAGSDGFFDDAGYPVGNGWDELEF 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P +  P              +    SM PLYR GD++I++    V  GDR++++ R G++
Sbjct: 121 PHLGDP---------NAYALEISGDSMEPLYRDGDVIIVSPGASVRRGDRVVVRTREGEV 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +AK L       ++L SLN  +P  T+ M+++ W+ARILWASQ
Sbjct: 172 MAKQLARLTANRLELQSLNKAHPDRTLAMTEVAWMARILWASQ 214


>gi|326403286|ref|YP_004283367.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
 gi|325050147|dbj|BAJ80485.1| putative peptidase S24 [Acidiphilium multivorum AIU301]
          Length = 223

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 86/227 (37%), Positives = 116/227 (51%), Gaps = 11/227 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL- 62
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL 
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 63  ------AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
                  A    +      P    R      + +PL     +G GGFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAVRTVPLASLAQAGQGGFFDEGGNPTGGGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            + +P      +   A          Q  SM P+YR GDI++++ A  V  GDR++I+  
Sbjct: 121 RIALPVG----DAGIAGDPHAFALTIQGDSMDPVYRDGDIIVVSPASPVRTGDRVVIRTA 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 177 GGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|148259746|ref|YP_001233873.1| putative phage repressor [Acidiphilium cryptum JF-5]
 gi|146401427|gb|ABQ29954.1| putative phage repressor [Acidiphilium cryptum JF-5]
          Length = 223

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 85/227 (37%), Positives = 115/227 (50%), Gaps = 11/227 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL- 62
             H+ IW AID +A +  L+ S LAR AGLDPTSFN SKR   +GR RWPSTESI KIL 
Sbjct: 1   MQHEDIWRAIDALAAQRGLSASALARSAGLDPTSFNPSKRRTPDGRLRWPSTESIAKILS 60

Query: 63  ------AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
                  A    +      P    R      + +PL     +G  GFFD G  PTG  W+
Sbjct: 61  ASSIGIEAFAALVGGRSTTPAGTSRPRRPAMRTVPLASLAQAGQDGFFDEGGNPTGGGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            + +P      +   A          Q  SM P+YR GDI++++ A  V  GDR++I+  
Sbjct: 121 RIALPVG----DAGIAGDPHAFALTIQGDSMDPVYRDGDIIVVSPASPVRTGDRVVIRTA 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++A+ L+ R    +DL   N  YP       +I  + RI+WASQ
Sbjct: 177 GGEVMARQLLRRTVSRVDLGCFNPAYPPRGFMTEEIGALHRIVWASQ 223


>gi|295687529|ref|YP_003591222.1| putative phage repressor [Caulobacter segnis ATCC 21756]
 gi|295429432|gb|ADG08604.1| putative phage repressor [Caulobacter segnis ATCC 21756]
          Length = 214

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 77/225 (34%), Positives = 122/225 (54%), Gaps = 13/225 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTESI 58
           M + SH +IW AID +A+R ++TPS +AR AGLDPTSFN+SKR     +GR RWPSTES+
Sbjct: 1   MATLSHGEIWRAIDALADRFDMTPSAMARMAGLDPTSFNRSKRGSTEADGRARWPSTESL 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            K+L AT     +   L           ++  PL+    +G  GFFD+   P G+ W+ V
Sbjct: 61  AKLLEATGVNFSEFAALTEQSPGAGAGGKRGAPLIGLAQAGQEGFFDAAGMPVGSGWDEV 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P+          +       +    ++ P+YR GD L+++  ++   GDR++ +   G
Sbjct: 121 AAPD----------LGQGLFALEVSGETLAPVYRDGDRLLVSPTVEPRKGDRVVARTHAG 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++ + L     R+I+L++L        +   ++ WIARI+WASQ
Sbjct: 171 EVLVRELGRVTARTIELLAL-GRESDRLLSRDEVAWIARIVWASQ 214


>gi|315122107|ref|YP_004062596.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495509|gb|ADR52108.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 216

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 180/223 (80%), Positives = 194/223 (86%), Gaps = 7/223 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT FSH+KIWEAID+MA+RHNLTPSGLARKAGLDPTSFNKSKRFG+EGRNRWPSTESI K
Sbjct: 1   MTKFSHEKIWEAIDQMAKRHNLTPSGLARKAGLDPTSFNKSKRFGVEGRNRWPSTESISK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL ATNETICQ   + F + +  EKKEKEIPLL FPPS S GFFDSG FP GNKWNTVGV
Sbjct: 61  ILEATNETICQFFGILFLEEKNIEKKEKEIPLLDFPPSESSGFFDSGGFPAGNKWNTVGV 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           PEIRSPHNGIYA        + QDTSMLPLYRKGDILILN+AIQVNCGDR+LIKP  GDI
Sbjct: 121 PEIRSPHNGIYA-------IQIQDTSMLPLYRKGDILILNAAIQVNCGDRVLIKPHEGDI 173

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            AKVLIS+RGRSIDLMSLNCCYPVDT++ SDIEWIA+ILWASQ
Sbjct: 174 EAKVLISQRGRSIDLMSLNCCYPVDTIDASDIEWIAKILWASQ 216


>gi|254690871|ref|ZP_05154125.1| Peptidase family S24 [Brucella abortus bv. 6 str. 870]
 gi|260756453|ref|ZP_05868801.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260676561|gb|EEX63382.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 218

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 97/227 (42%), Positives = 130/227 (57%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH+ +W AID +AERH+L+ SGLAR+AGLDPT+FNKSKR+  +GR RWPSTES+ K++
Sbjct: 1   MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAADGRARWPSTESLAKVM 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT  T  +                   +    IPLL    +G+GG+FD   FP G  W+
Sbjct: 61  EATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
            V  P                   +    SMLPLYR GD LI+     V  GDR++++ R
Sbjct: 121 IVEFPARTGEG---------VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTR 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            G+++AK+L  +  R+I+L SL+  +P    E  DIEWIARILWASQ
Sbjct: 172 DGEVMAKILHRQTPRTIELHSLDPEHPNRIFESKDIEWIARILWASQ 218


>gi|328544878|ref|YP_004304987.1| peptidase S24-like domain protein [polymorphum gilvum SL003B-26A1]
 gi|326414620|gb|ADZ71683.1| Peptidase S24-like domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 215

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 82/224 (36%), Positives = 124/224 (55%), Gaps = 12/224 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+++W AID +A R  L+PSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+L
Sbjct: 1   MLSHERVWAAIDALATRKGLSPSGLARRAGLDPTTFNPSKRIAGDGRPRWPSTESLAKVL 60

Query: 63  AATNETICQLL---DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            AT   + + +       +D          +P          G+FD    P G  W+ + 
Sbjct: 61  EATGAPLAEFVALAAPLETDSAPPATSPMTVPFAGLDRVACEGYFDPTGNPIGRNWDEIP 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P++R                +    ++LP+YR GDIL++   + V  GDR+++K ++G+
Sbjct: 121 FPDLRGEI---------LYALEVSGNALLPVYRDGDILVVAPDVPVRRGDRVIVKVKSGE 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++ ++L  R  R+++L SL     V   E+  IEWIARI+WASQ
Sbjct: 172 VIIRLLHRRTARTVELHSLAPSGTVHQCELDSIEWIARIVWASQ 215


>gi|16124337|ref|NP_418901.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|221233019|ref|YP_002515455.1| LexA-like transcriptional repressor [Caulobacter crescentus NA1000]
 gi|13421181|gb|AAK22069.1| hypothetical protein CC_0082 [Caulobacter crescentus CB15]
 gi|220962191|gb|ACL93547.1| LexA-related transcriptional repressor [Caulobacter crescentus
           NA1000]
          Length = 213

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 77/224 (34%), Positives = 116/224 (51%), Gaps = 12/224 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE-GRNRWPSTESIF 59
           M + SH +IW AID +AER ++TPS +AR AGLDPTSFN+SKR   E G  RWPSTES+ 
Sbjct: 1   MATLSHGEIWRAIDALAERFDMTPSAMARMAGLDPTSFNRSKRGSAETGHARWPSTESLS 60

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K+L AT     +   L            +  PL+    +G  GFFD    P G  W+   
Sbjct: 61  KLLEATGVNFSEFAALTER-SPVRAPGRRGAPLIDLAQAGKDGFFDEAGMPVGAGWDEAP 119

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            P+          +       +     + P+YR GD L+++  ++   GDR++ +   G+
Sbjct: 120 APD----------LGEGLFALEVTGDDLAPVYRDGDRLLVSPTLEPRKGDRVVTRTHGGE 169

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++ + L     RSI+L++L+       +   ++ WIARI+W SQ
Sbjct: 170 VLVRELGRVTARSIELLALDRVSGERLLSRDEVAWIARIVWVSQ 213


>gi|302383458|ref|YP_003819281.1| phage repressor [Brevundimonas subvibrioides ATCC 15264]
 gi|302194086|gb|ADL01658.1| putative phage repressor [Brevundimonas subvibrioides ATCC 15264]
          Length = 211

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 83/224 (37%), Positives = 122/224 (54%), Gaps = 17/224 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFK 60
           S SH ++W A+D +A R  L+ S LARKAGLD T+FN SKRFG     R RWPSTES+  
Sbjct: 2   SLSHDRLWTALDTLARRQGLSSSALARKAGLDATAFNPSKRFGPGVPPRPRWPSTESLNL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL AT  ++ +   L          +    PLL    +G+ GFFD    PTG+ W    +
Sbjct: 62  ILEATGTSLAEFAALAD----DAPARIATAPLLGMAQAGADGFFDDAGLPTGDGWEQTDL 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGD 179
           P          + +           SM+PLYR+GD ++++     V  GDR++ + R+G+
Sbjct: 118 P----------SPKESLFSLLISGDSMVPLYREGDRVLVDRERTDVRKGDRVVARTRSGE 167

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            +AK + +   R++ L S+N  YP   +  +D++W+ARILW SQ
Sbjct: 168 TLAKQIEALTARTVTLASINPAYPPRVLARADVDWMARILWVSQ 211


>gi|254420759|ref|ZP_05034483.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
 gi|196186936|gb|EDX81912.1| Peptidase S24-like domain protein [Brevundimonas sp. BAL3]
          Length = 211

 Score =  178 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 86/224 (38%), Positives = 118/224 (52%), Gaps = 17/224 (7%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI--EGRNRWPSTESIFK 60
             SH K+W+A+D +A R  L+PSGLAR+AGLD TSFN SKRFG     R RWPSTES+  
Sbjct: 2   PLSHAKLWKAVDALARREGLSPSGLARRAGLDATSFNPSKRFGAGDPPRPRWPSTESMTL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L AT  ++ +   L              +PLL    +G  GFFD    P G+ W+   +
Sbjct: 62  MLQATGVSLAEFAALAD----DAPPTSTTVPLLGLARAGLDGFFDDAGLPVGDGWDQTEL 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV-NCGDRLLIKPRTGD 179
           P           +       +    SM PLYR+GD +I++        GDR++ +  +G+
Sbjct: 118 PR----------VNATTFSLRISGDSMAPLYREGDRVIVDRGDPAVRRGDRVVARLTSGE 167

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +VAK L     R+  L S+N  YP   V   +IEW+ARILW SQ
Sbjct: 168 VVAKELTGLTARAATLSSINPDYPPRIVPRREIEWMARILWVSQ 211


>gi|90418702|ref|ZP_01226613.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336782|gb|EAS50487.1| putative transcription regulator [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 215

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 97/224 (43%), Positives = 135/224 (60%), Gaps = 12/224 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSH +IW AID +A RH ++PSGLAR+AGLDPT+FNKSKR   +GR RWPSTESI K++
Sbjct: 1   MFSHDRIWLAIDALATRHRMSPSGLARRAGLDPTTFNKSKRNASDGRPRWPSTESIAKVI 60

Query: 63  AATNETICQL---LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           AAT  +I +    +         +      +PLL F  +G GGFFD   FP G  W+ + 
Sbjct: 61  AATGTSIEEFAALMRGETPGVPRSPSPAMSVPLLGFAEAGGGGFFDDSGFPAGQGWDEIA 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           +P                   +    SM+PLYR GDILI++ A  V  GDR++++ R G+
Sbjct: 121 LPSTGDE---------TVYALEVSGQSMMPLYRDGDILIVSPAAAVRRGDRVVVRTREGE 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           ++AK+L  +  R+I+L S N  +P    +M ++EW+ARILWASQ
Sbjct: 172 VMAKILQRQTSRTIELASTNPDFPDRQFQMDEVEWMARILWASQ 215


>gi|27376249|ref|NP_767778.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349389|dbj|BAC46403.1| bll1138 [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 122/220 (55%), Gaps = 13/220 (5%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +H +IW A+DR+A R  L+PSGLA++AGLDPT+FN+SKR   +GR RWPSTESI K LA
Sbjct: 11  LTHDQIWVALDRLAARAGLSPSGLAKRAGLDPTTFNRSKRVTSDGRERWPSTESIAKALA 70

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A   +    +D+            + +PLL    +G+ G FD    P+G  W  + +P  
Sbjct: 71  AAGAS----IDVFAGLISDETGNSRSVPLLGLAQAGASGAFDESGLPSGKGWTELALPT- 125

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
                   A  +Q    +    ++ P YR GD+++++    +  GDR+++  + G++   
Sbjct: 126 --------AEDSQTFALEIAGDALAPTYRNGDVILVSPGTPIRKGDRVVVTTKAGEVTVA 177

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
            L  R  +++DL+ L+      T+   ++ W+ARI+WASQ
Sbjct: 178 TLKRRTAKALDLLPLDASQAERTIAAGELAWVARIVWASQ 217


>gi|296532329|ref|ZP_06895067.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
 gi|296267353|gb|EFH13240.1| S24 family peptidase [Roseomonas cervicalis ATCC 49957]
          Length = 216

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 89/225 (39%), Positives = 127/225 (56%), Gaps = 14/225 (6%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H  IW A+D +A  H L+PSGLARKAGLDPT+FN SKR G +GR RWPSTES+ KILA
Sbjct: 1   MRHDDIWRAVDALAAEHGLSPSGLARKAGLDPTAFNPSKRLGTDGRARWPSTESVAKILA 60

Query: 64  ATNETICQLLDLPFS-----DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           AT   +     L        +        + IPL+    +G  G+F  G +P G  W+ +
Sbjct: 61  ATGTDMESFAALVTGAAAALNRSPRSMPGRRIPLIGLAQAGGDGYFGDGGYPVGAGWDEI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             PE+  P              +    SM P++R GDI+I++    V  GDR++++   G
Sbjct: 121 STPELSDP---------NAYALEISGDSMEPVFRDGDIIIVSPNAPVRRGDRVVVRTLKG 171

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +++AK L+ +  R I+L SLN  +P  + ++++I WI RILWASQ
Sbjct: 172 EVMAKELLRQSARRIELASLNPAHPGYSFDLAEIAWIHRILWASQ 216


>gi|304394055|ref|ZP_07375978.1| dna-binding protein rdga [Ahrensia sp. R2A130]
 gi|303293495|gb|EFL87872.1| dna-binding protein rdga [Ahrensia sp. R2A130]
          Length = 232

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 84/241 (34%), Positives = 126/241 (52%), Gaps = 29/241 (12%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FSHK++W AID +A+ ++++ S LAR AGLD T+FNKSKR G +GR RWPSTES+ KI+
Sbjct: 1   MFSHKQVWAAIDALAQDNDMSVSKLARTAGLDATTFNKSKRIGADGRQRWPSTESLSKIM 60

Query: 63  AATNETICQLLDLPFS--------------------DGRTTEKKEKEIPLLYFPPSGSGG 102
            AT   I   +                                    IPLL    +GSGG
Sbjct: 61  DATKTDIDGFMATMRDGQASFAAGFAGMSETGGTYVPDAPGHPVPVSIPLLGLAQAGSGG 120

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
           FFD    PTG  W  V  P+         + +      +    SM PLYR GD ++++  
Sbjct: 121 FFDDAGLPTGEGWEAVEFPQ---------SDREPLYALEIAGDSMEPLYRDGDRIVVSPT 171

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             V  GDR++++   G+I+AK L  +  ++++L S N  +   T ++++++W+ARI+W S
Sbjct: 172 ASVRRGDRVVVRTSDGEIMAKTLARQTAKTVELDSENPEHQKRTFDLTEVDWVARIMWVS 231

Query: 223 Q 223
           Q
Sbjct: 232 Q 232


>gi|254504422|ref|ZP_05116573.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
 gi|222440493|gb|EEE47172.1| Peptidase S24-like domain protein [Labrenzia alexandrii DFL-11]
          Length = 221

 Score =  168 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 80/224 (35%), Positives = 119/224 (53%), Gaps = 13/224 (5%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              SH+K+W AID +A  + +TPSGLA++AGLDPT+FN+SKRF  +GR RWPSTES+ KI
Sbjct: 9   PMLSHEKVWAAIDALASYNEMTPSGLAKRAGLDPTTFNRSKRFAGDGRPRWPSTESLAKI 68

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L AT E++        +           +P+  F        FD+   PTG  W T+  P
Sbjct: 69  LEATGESLKSFAGRVEAPELRPSTTLSALPVAGFSNVHEENAFDTTGRPTGEHWETIVFP 128

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
              +               +    ++LPLYRKGD++++  +  V  GDR+++KP  G + 
Sbjct: 129 TDHTQ---------NIFALEVSGDALLPLYRKGDLIVVAPSAAVRRGDRIVLKPSEGGLA 179

Query: 182 AKVLISRRGRSIDL--MSLNCCYPVDTVEMSDIEWIARILWASQ 223
              L+ R  +++ +  +  N       +  S IEW ARI+WASQ
Sbjct: 180 VYTLLKRTPKTLQVQTIGDNP--ENAALLHSAIEWTARIIWASQ 221


>gi|307941488|ref|ZP_07656843.1| peptidase family S24 [Roseibium sp. TrichSKD4]
 gi|307775096|gb|EFO34302.1| peptidase family S24 [Roseibium sp. TrichSKD4]
          Length = 218

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 76/227 (33%), Positives = 120/227 (52%), Gaps = 15/227 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SHK+IW AID +A R+ L+PSGLAR+AGLDPT+FN SKRFG +GR RWPSTES+ KIL
Sbjct: 1   MLSHKQIWAAIDTLAARNGLSPSGLARRAGLDPTTFNPSKRFGGDGRPRWPSTESLSKIL 60

Query: 63  AATNETICQLLD------LPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            AT E++  L++                +  + +P+  F  +     FD    P+   W+
Sbjct: 61  QATGESLETLMEVLLGLAPTGPRAAPLAQDGRMVPIAGFSDANQQAAFDPTGRPSSPMWD 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           ++  P+           +      +     + P YR GDILI+     +  GDR+L++  
Sbjct: 121 SLLFPDP---------KEKNLFALEINSDDLTPYYRSGDILIVAPVQAIRRGDRVLVRQT 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +G +   ++  +   + D  +L   +    +E + I+W+AR++W SQ
Sbjct: 172 SGALQLFLMDRQNPSAFDFHALTPPHETVHLERTKIDWVARVMWVSQ 218


>gi|118589338|ref|ZP_01546744.1| repressor protein CI [Stappia aggregata IAM 12614]
 gi|118438038|gb|EAV44673.1| repressor protein CI [Stappia aggregata IAM 12614]
          Length = 227

 Score =  157 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 76/222 (34%), Positives = 110/222 (49%), Gaps = 11/222 (4%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           T  SH+K+W AID +A ++ LTPSGLAR+AGLDPT+FN SKR   +GR RWPSTES+ K+
Sbjct: 17  TVLSHEKVWAAIDALASQNGLTPSGLARRAGLDPTAFNPSKRVAGDGRPRWPSTESLAKV 76

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           LAAT E +        ++   +      +P+     +     FD+   P+G  W     P
Sbjct: 77  LAATGEALNTFAARVETEDAPSGSVPALVPVAALEAASDRNAFDAAGRPSGATWQQFSFP 136

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                  +  +    PLYR GDI+++     +  GDRL +K  +G + 
Sbjct: 137 Q-----------PGASFALQVSNEDFQPLYRNGDIVVVAPDAPLRTGDRLALKLTSGRLS 185

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
              L    G  + + ++           S IEW ARI+WASQ
Sbjct: 186 LYTLQEAGGEELSVRTIGENSHSLRFRHSAIEWTARIIWASQ 227


>gi|114569067|ref|YP_755747.1| putative phage repressor [Maricaulis maris MCS10]
 gi|114339529|gb|ABI64809.1| putative phage repressor [Maricaulis maris MCS10]
          Length = 208

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 74/222 (33%), Positives = 108/222 (48%), Gaps = 15/222 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKI 61
             +H  IW  IDR+A     +PSGLAR+AGLD T+FN SKR   +G + RWPSTESI K 
Sbjct: 1   MLTHDDIWRGIDRLARHAQTSPSGLARRAGLDSTTFNPSKRISADGTKPRWPSTESIAKA 60

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           LAA +        L     RT     +               FD+  +P G  W+ +  P
Sbjct: 61  LAAAHLDFDDFAGLISGQPRTGALPSRA-----LADGEEQDPFDATGYPAGPDWDAIPFP 115

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +            +      QDT MLP+YR GD L+++       GDR++++ R G   
Sbjct: 116 GLA---------PGEAFALTVQDTHMLPVYRPGDRLVVSHEAPTRVGDRVVVQRRDGSRS 166

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           A  L  +  +++ L  L+   P  T+ ++ + W+ARI+W SQ
Sbjct: 167 AWTLSEKTVQALRLAPLDPLQPALTLPLTQVAWLARIVWVSQ 208


>gi|220924406|ref|YP_002499708.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
 gi|219949013|gb|ACL59405.1| peptidase S24/S26 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
          Length = 209

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 104/219 (47%), Gaps = 12/219 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH++IW AID +A+RH LTPSGLAR+AGLD TSFN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLSHERIWLAIDHLAQRHGLTPSGLARRAGLDATSFNRSKRIAPDGRKRWPSTESLAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            AT  ++   L L              I           G       P G  W  +  P+
Sbjct: 61  TATGASLDDFLQLVEPRPAPPPAILPLIGSAALAAGRRIG---PDGRPAGAGWEEMEFPD 117

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           + +               + Q   +LPLY  GD+L++ +      GDR L+      + A
Sbjct: 118 LGAQ---------SCFAIEVQGEGLLPLYHDGDVLVVCATAPARRGDRTLVCLDGEGLFA 168

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
             L  R  R+ +        PV TV  + I W+AR++W 
Sbjct: 169 ADLRRRTVRTTEFAGRTPGEPVRTVPTARIAWMARVMWV 207


>gi|254471620|ref|ZP_05085021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
 gi|211958822|gb|EEA94021.1| dna-binding protein rdga [Pseudovibrio sp. JE062]
          Length = 214

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 102/221 (46%), Gaps = 7/221 (3%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H+ +W A+D+MA+RH LTPSGLAR+AGLDPTSFN SKRF  +GR RWPSTES+ K+L
Sbjct: 1   MLDHENLWAALDKMAKRHQLTPSGLARRAGLDPTSFNPSKRFAADGRPRWPSTESLAKVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
             T  T      L       +    +  P        +            + +      +
Sbjct: 61  EVTQMTFVDFAGLLQDKTEISGTHFRSFP----AYLCTSDELREVDLEDLSGFQLDKFCD 116

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                +   +   +    +    S  P YR+G ILI++    +   D +LI  +TGD+  
Sbjct: 117 SFIFPS---SQSEKFFALEVSSNSFEPYYREGQILIVSPESSLRRNDHVLIATKTGDLHC 173

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             L  +    I+            V+++D+ W ARILW SQ
Sbjct: 174 GPLQRQTNERIEFRRHTPDDTPRVVQVADLVWTARILWVSQ 214


>gi|170741440|ref|YP_001770095.1| peptidase S24/S26 domain-containing protein [Methylobacterium sp.
           4-46]
 gi|168195714|gb|ACA17661.1| peptidase S24 and S26 domain protein [Methylobacterium sp. 4-46]
          Length = 209

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 81/219 (36%), Positives = 117/219 (53%), Gaps = 12/219 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH +IW AID +A+RH LTPSGLA++AGLDPTSFN+SKR   +GR RWPSTES+ KIL
Sbjct: 1   MLSHDRIWSAIDHLAQRHRLTPSGLAKRAGLDPTSFNRSKRVAPDGRRRWPSTESLAKIL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           AAT  T+ + + L              +PL+        G       PTG+ W+ +  P+
Sbjct: 61  AATGATLDEFVQLVS---PRAAAGAAVVPLIGSAALAVAGRIGPDGRPTGSAWDELDFPD 117

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           + +               + Q   + PLY  GD+L++ +   +  GDR+L+  RTG +V 
Sbjct: 118 LGTQ---------DCFAIEVQGNDLRPLYHDGDVLVVCATAPMRRGDRILVSLRTGALVG 168

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWA 221
            VL  R  R  DL  +       ++  ++I W+ARI+W 
Sbjct: 169 AVLRRRTARVADLAPVMPGEAARSIATAEIAWMARIMWV 207


>gi|114328547|ref|YP_745704.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
 gi|114316721|gb|ABI62781.1| DNA-binding protein RDGA [Granulibacter bethesdensis CGDNIH1]
          Length = 221

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 73/225 (32%), Positives = 106/225 (47%), Gaps = 9/225 (4%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
             H+ IW AID +A    L+ SGLAR+AGLD T+FN SKR   +GR RWPSTESI KIL 
Sbjct: 1   MKHEDIWRAIDTLAAIKGLSTSGLARRAGLDATTFNLSKRQMPDGRQRWPSTESISKILV 60

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           AT E++     L       +    +        P  S           G       +P  
Sbjct: 61  ATGESLGAFTSLVNGAETLSADSGQNTHYGRRIPLFSLPELRDLPIK-GEGN---ALPSA 116

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG----- 178
           R   +       +    +  DTS+ PL+R+G ILI++    +  GDR++++         
Sbjct: 117 RDETSLPDVADREAYGIEIHDTSLAPLFREGTILIVSPNAPLRRGDRVIVRLAAHDGEPS 176

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           + V      R  R +D+ SLN      ++ ++ + WI RI+WASQ
Sbjct: 177 ETVFGHFHRRSARWMDISSLNGDKAERSISLTSLVWIHRIVWASQ 221


>gi|160932990|ref|ZP_02080379.1| hypothetical protein CLOLEP_01832 [Clostridium leptum DSM 753]
 gi|156868064|gb|EDO61436.1| hypothetical protein CLOLEP_01832 [Clostridium leptum DSM 753]
          Length = 222

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 68/213 (31%), Gaps = 21/213 (9%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +  + E   L+  G A K G+  ++    +       +R P+ +++ +I      ++  
Sbjct: 20  RLKELRENAGLSQYGFAEKIGISQSTVGNWEAG-----SREPNFKTMERIADFFGVSVDY 74

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
           LL      G   E        +             G  P G     +             
Sbjct: 75  LLGRETVAGGPPEPSVPGSKWIPVI----------GTIPAGTPVEAIEDILDYEEITPQM 124

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
           A Q +    K +  SM P    GD++I+        G+  ++     +   K +  +   
Sbjct: 125 ASQGEHFALKIKGQSMEPKISDGDVVIVRKQDDCENGEIAVVLVNGDEATVKRI-KKGPE 183

Query: 192 SIDLMSLNCCYPVDTVEMSDIE-----WIARIL 219
            + L+  N  Y       ++IE      I +++
Sbjct: 184 GLMLIPNNPAYEPMFYSNAEIESLPVSIIGKVV 216


>gi|238021090|ref|ZP_04601516.1| hypothetical protein GCWU000324_00988 [Kingella oralis ATCC 51147]
 gi|237868070|gb|EEP69076.1| hypothetical protein GCWU000324_00988 [Kingella oralis ATCC 51147]
          Length = 351

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/237 (12%), Positives = 61/237 (25%), Gaps = 25/237 (10%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           SH  + + +    E+  ++   L +      ++    +    +G        +I KI   
Sbjct: 118 SHSTLKDRLIYAREQKGISQEQLGKAINKSQSAIAALETGRNQGST------NIAKIAEV 171

Query: 65  TNETICQLLDLPFSDGRTTEKK-------------EKEIPLLYFPPSGSGGFFDSGVFPT 111
              +   L          +                      L         F        
Sbjct: 172 LGVSAIWLETGQGEMYPQSTTPRINEITDIHRPILWSSNTPLPEDDYVFVPFLKETELRG 231

Query: 112 GNKWNTVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
           G     +       +P  +S  +    +            SM P   +   + ++  I+ 
Sbjct: 232 GAGSFEIPDYNGFRLPFGKSTLHRKGIMPDNVICCTLTGDSMEPRIPEYATIAVDKGIER 291

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
               ++           K L    G  + + S N  Y  + V   +I  I R+ W S
Sbjct: 292 IRDGKIYAFQHDDLFRVKYLYRLPGNKVRIRSDNENYEDEIVSGEEIRVIGRVFWWS 348


>gi|330992988|ref|ZP_08316928.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
 gi|329759941|gb|EGG76445.1| hypothetical protein SXCC_02890 [Gluconacetobacter sp. SXCC-1]
          Length = 223

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/183 (31%), Positives = 74/183 (40%), Gaps = 12/183 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH  IW AIDR+A    LTPSGLAR AGLD T+FN SKR    GR RWP TES+ + L
Sbjct: 1   MISHDDIWRAIDRLAAERGLTPSGLARAAGLDSTTFNPSKRITPSGRPRWPGTESLARTL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLL---YFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +AT  +      L                 L    F        FD    P G +W    
Sbjct: 61  SATGISFEGFSRLLSGHHDPETTNRAHHSHLKIAPFSQLAHPELFDETGLPEGERWEKWE 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              +   H                  +M P++RKG  L+++    +   DR+L+    G 
Sbjct: 121 FHGMADHH---------SYAVHVDCDTMEPIFRKGGTLVVSPTAAIRVHDRVLLHTPQGT 171

Query: 180 IVA 182
              
Sbjct: 172 ACC 174


>gi|229528221|ref|ZP_04417612.1| hypothetical protein VCG_001301 [Vibrio cholerae 12129(1)]
 gi|261212926|ref|ZP_05927210.1| predicted transcriptional regulator [Vibrio sp. RC341]
 gi|297580070|ref|ZP_06941997.1| HTH-type transcriptional regulator PrtR [Vibrio cholerae RC385]
 gi|229334583|gb|EEO00069.1| hypothetical protein VCG_001301 [Vibrio cholerae 12129(1)]
 gi|260837991|gb|EEX64668.1| predicted transcriptional regulator [Vibrio sp. RC341]
 gi|297535716|gb|EFH74550.1| HTH-type transcriptional regulator PrtR [Vibrio cholerae RC385]
          Length = 237

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 67/239 (28%), Gaps = 25/239 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + + I E I R+ +   LT   +A   G+ PTS    +R         P   ++  +  
Sbjct: 1   MTRETIGERIRRVRKELKLTQQQVASSIGVSPTSLVFWERNETT-----PKGSNLIALCK 55

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-------FFDSGVFPTGNKWN 116
                   L     +   T    E    +  +  +   G       F        GN + 
Sbjct: 56  KLRVDPLWLQTGKGTQDSTAGNAELLGNMQVWDSNTPLGDDEVAVPFLSDVRLSAGNGFV 115

Query: 117 TVGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           +    +         +                    SM P+   G  + ++   +     
Sbjct: 116 SDSESDNGFRLRFAKSTLRRYNVDPENAVCVAITGDSMEPVLPNGSTVGIDCGDKTLIDG 175

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIE-----WIARILWAS 222
           ++      G++  K L    G  + + S N   YP        +       + R+ W S
Sbjct: 176 KIYAINHNGELFIKKLYRLPGGGLRIYSFNEIEYPPREYSQEQVAEQQISIVGRVFWYS 234


>gi|295103878|emb|CBL01422.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Faecalibacterium prausnitzii SL3/3]
          Length = 210

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 68/211 (32%), Gaps = 17/211 (8%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + +  ++  ++ + LA + G+   +  K +          P   ++ +I    N T   L
Sbjct: 7   LKQCRKKQGVSQAELASRLGVTQQAVGKWESGKS-----SPDPSTVARIAELLNTTADYL 61

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L L       +  +E+             G            +  +   E          
Sbjct: 62  LGLYRPVSNVSAPEERFFGSYTESLIPVIGT-------VKAGYGALAFEEDYGQEYARVK 114

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGR 191
             +       +  SM P  + GD+ +++    +  GD  +LI    G+   K  I +RG 
Sbjct: 115 DPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGEGTLKRYI-QRGN 173

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
            + L   N  Y    +   D   +    R++
Sbjct: 174 CVVLQPFNPAYHEMVIRGEDLNHLHIAGRVV 204


>gi|160942797|ref|ZP_02090038.1| hypothetical protein FAEPRAM212_00274 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445962|gb|EDP22965.1| hypothetical protein FAEPRAM212_00274 [Faecalibacterium prausnitzii
           M21/2]
          Length = 210

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 67/211 (31%), Gaps = 17/211 (8%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + +  ++  ++ + LA + G+   +  K +          P   ++ +I    N T   L
Sbjct: 7   LKQCRKKQGVSQAELASRLGVTQQAVGKWESGKS-----SPDPSTVARIAELLNTTADYL 61

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L L       +  +E+             G            +  +   E          
Sbjct: 62  LGLYRPVSNVSAPEERFFGSYTESLIPVIGT-------VKAGYGALAFEEDYGQEYARVK 114

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGR 191
                     +  SM P  + GD+ +++    +  GD  +LI    G+   K  I +RG 
Sbjct: 115 DPANYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGEGTLKRYI-QRGN 173

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
            + L   N  Y    +   D   +    R++
Sbjct: 174 CVVLQPFNPAYHEMVIRGEDLNHLHIAGRVV 204


>gi|313114612|ref|ZP_07800120.1| helix-turn-helix protein [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623076|gb|EFQ06523.1| helix-turn-helix protein [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 210

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 69/211 (32%), Gaps = 17/211 (8%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + +  ++  ++ + LA K G+   +  K +          P   ++ +I    N T   L
Sbjct: 7   LKQCRKKQGISQAELASKLGVTQQAVGKWESGKS-----SPDPSTVARIAELLNTTADYL 61

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L L       +  +E+             G            +  +   E          
Sbjct: 62  LGLYRPVSNVSAPEERFFGSYSESLIPVIGT-------VKAGYGALAFEEDYGQEYARVK 114

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGR 191
             +       +  SM P  + GD+ +++    +  GD  +LI    G+   K  I +RG 
Sbjct: 115 DPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLIYGDEGEGTLKRYI-QRGN 173

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
            + L   N  Y    ++  D   +    R++
Sbjct: 174 CVVLQPFNPAYSEMVIKGEDLNHLHIAGRVV 204


>gi|153001880|ref|YP_001367561.1| putative phage repressor [Shewanella baltica OS185]
 gi|151366498|gb|ABS09498.1| putative phage repressor [Shewanella baltica OS185]
          Length = 229

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/228 (14%), Positives = 71/228 (31%), Gaps = 21/228 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E I +  +    T   +A+K GL   + +  +          P  E++  +  A + +  
Sbjct: 4   ERIKQRRKELGFTQPAIAKKIGLTKATVSLWESGST-----SPKGENLHALAKALSCSPE 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSG------SGGFFDSGVFPTGNKW-NTVGV--- 120
            LL         +  +      ++   +          F+       G+   ++      
Sbjct: 59  YLLFGNKETKPESNAEWAGGFEIWDSDTPLGEDEVEIPFYMEVELAAGDGILDSREFKGP 118

Query: 121 --PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
                +S               K    SM P+      + ++++       ++      G
Sbjct: 119 KLRFTKSTLKRQGVNSDYAACVKVNGNSMEPILPHSSTVGVDTSATDVIDGKMYAVNHDG 178

Query: 179 DIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMS---DIEWIARILWAS 222
            +  KVL    G  + L S N   YP + ++      ++ I ++ W S
Sbjct: 179 MLRIKVLYKLPGGGLRLRSYNTDEYPDERLDAEQVKQVKVIGKVFWYS 226


>gi|262402969|ref|ZP_06079529.1| predicted transcriptional regulator [Vibrio sp. RC586]
 gi|262350468|gb|EEY99601.1| predicted transcriptional regulator [Vibrio sp. RC586]
          Length = 237

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 68/239 (28%), Gaps = 25/239 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + + I E I R+ +   LT   +A   G+ PTS    +R         P   ++  +  
Sbjct: 1   MTRETIGERIRRVRKELKLTQQQVASSIGVSPTSLVFWERNETT-----PKGSNLIALCK 55

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-------FFDSGVFPTGNKWN 116
                   L     +   T    E    +  +  +   G       F        GN + 
Sbjct: 56  KLRVDPLWLQTGKGTQDSTAGNAELLGNMQVWDSNTPLGDDEVAVPFLSDVRLSAGNGFV 115

Query: 117 TVGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           +    +         +                    SM P+   G  + ++   +     
Sbjct: 116 SDSESDNGFRLRFAKSTLRRYNVDPENAVCVAITGDSMEPVLPNGSTVGIDCGDKTLIDG 175

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDT-----VEMSDIEWIARILWAS 222
           ++      G++  K L    G  + + S N   YP        V    I  + R+ W S
Sbjct: 176 KIYAINHNGELFIKKLYRLPGGGLRIYSFNEIEYPPREYLQEQVAEQQISIVGRVFWYS 234


>gi|315650040|ref|ZP_07903120.1| LexA repressor [Eubacterium saburreum DSM 3986]
 gi|315487810|gb|EFU78113.1| LexA repressor [Eubacterium saburreum DSM 3986]
          Length = 213

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 72/216 (33%), Gaps = 16/216 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I +      L+   +A + G +  +  + +   IE      + E I KIL  T   
Sbjct: 3   IGERIKQRRRELGLSVDEVADRLGKNRATVYRYESNDIENFPVG-TLEPIAKILETTPAK 61

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +              E  EK   +             +   P     + +   EI    +
Sbjct: 62  LMGWNSNDNLPNGNPEPHEKPRGVKIPVLGDV-----AAGIPIEAIEDIIDYEEI----D 112

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
              A + +    + +  SM P  + GD++I+      + GD ++ K    D   K L   
Sbjct: 113 EDLARRGEFFGLRIKGNSMSPRIQNGDVVIVRVQPDADSGDIVITKVNGYDACCKRLQKH 172

Query: 189 RGRSIDLMSLNCCYPVDTVEMSD-----IEWIARIL 219
               I L+SLN  Y        D     +  I +++
Sbjct: 173 DDG-ISLISLNPDYEPMFFSKKDIIDLPVNIIGKVV 207


>gi|160876601|ref|YP_001555917.1| putative phage repressor [Shewanella baltica OS195]
 gi|160862123|gb|ABX50657.1| putative phage repressor [Shewanella baltica OS195]
 gi|315268797|gb|ADT95650.1| putative phage repressor [Shewanella baltica OS678]
          Length = 229

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/228 (14%), Positives = 72/228 (31%), Gaps = 21/228 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E I +  +    T   +A+K GL   + +  +          P  E++  +  A + +  
Sbjct: 4   ERIKQRRKELGFTQPAIAKKIGLTKATVSLWESGST-----SPKGENLHALAKALSCSPE 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSG------SGGFFDSGVFPTGNKW-NTVGV--- 120
            LL         +  +      ++   +          F+       G+   ++      
Sbjct: 59  YLLFGNKETKPESNAEWAGGFEIWDSDTPLGEDEVEIPFYMEVELAAGDGILDSREFKGP 118

Query: 121 --PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
                +S               K    SM P+   G  + ++++       ++      G
Sbjct: 119 KLRFTKSTLKRQGVNSDYAACVKVNGNSMEPILPHGSTVGVDTSATDVIDGKMYAVNHDG 178

Query: 179 DIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDI---EWIARILWAS 222
            +  KVL    G  + L S N   YP + ++   +   + I ++ W S
Sbjct: 179 MLRIKVLYKLPGGGLRLRSYNTDEYPDERLDTDQVKQIKVIGKVFWYS 226


>gi|220935647|ref|YP_002514546.1| putative phage repressor [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996957|gb|ACL73559.1| putative phage repressor [Thioalkalivibrio sp. HL-EbGR7]
          Length = 230

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 74/230 (32%), Gaps = 25/230 (10%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I  +      + + LA++ G+   S    +R       R P  + + K++ A    
Sbjct: 5   IGERIAHIRGSR--SQAALAQQLGVHKNSIGNYERGE-----RTPDADFLRKLMDAGYNA 57

Query: 69  IC----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK--------WN 116
                 +             +   E  +       +           G+          +
Sbjct: 58  NWVITGEGPMRLGEPEPAAPQAAPEHMIQEVGEEYALVPLYDVRAAAGHGAVVEEEQVTD 117

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS-AIQVNCGDRLLIKP 175
           ++        H  ++A             SM P  R GD+++++  + Q    D + +  
Sbjct: 118 SLAFKRQWI-HQELHANPADLYLIYVDGESMEPTLRPGDVILVDRRSAQAVPRDGIYVLR 176

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV----EMSDIEWIARILWA 221
             G ++ K L    GR + + S N  Y    +       D+  I R++W+
Sbjct: 177 MDGSLLVKRLQRLPGRKVKVTSDNPAYEPFELALDTPGEDLAIIGRVVWS 226


>gi|170023456|ref|YP_001719961.1| XRE family transcriptional regulator [Yersinia pseudotuberculosis
           YPIII]
 gi|169749990|gb|ACA67508.1| transcriptional regulator, XRE family [Yersinia pseudotuberculosis
           YPIII]
          Length = 209

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 82/210 (39%), Gaps = 14/210 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + I + I R  E  +++ + LA++ G      ++S+    E  +R  S E    +  A N
Sbjct: 2   ETIGQRIKRFREELSISQAELAQRCGW----LSQSRIGNYETDSRKVSVEDAVVLAKALN 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
               +L+     +   T   E+ +PL+ +  +G+       +         V      S 
Sbjct: 58  VNPGELILGTPDNASFTSAGERYLPLVSYVQAGTFTEP-DNLLSAEGAKGHVMYDGPISE 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                         K +  SM P +++GD +I++  +  + G+ ++ K    +   K   
Sbjct: 117 V---------AFALKIKGDSMEPEFKEGDTIIIDPMVAPHPGEFVIAKNGDHEATFKKYR 167

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
            +   S +L+ LN  YP    ++  ++ I 
Sbjct: 168 LKANGSFELVPLNPDYPTIDSDIQPVKIIG 197


>gi|254240372|ref|ZP_04933694.1| hypothetical protein PA2G_01019 [Pseudomonas aeruginosa 2192]
 gi|126193750|gb|EAZ57813.1| hypothetical protein PA2G_01019 [Pseudomonas aeruginosa 2192]
          Length = 243

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 71/237 (29%), Gaps = 29/237 (12%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I   +  +   H ++P+ L+R+ G+  ++ ++       G+   P  E ++ I      +
Sbjct: 6   IQHILAALLAEHGISPTELSRRTGVGQSTISRILN----GKIATPKDEQVYPIAEYFGLS 61

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKW 115
             QL               +E       P                  F        G+  
Sbjct: 62  TDQLRGRVSIGTAPIPAVVREPEATMDGPIEVWDDSTPLPSDEVLVPFLKEVELAAGSGK 121

Query: 116 NTVGVPEIRSPHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
            +V +   RS   G Y++                  SM P+ R G  + ++         
Sbjct: 122 MSVEMNSRRSLRFGKYSLKKQGVDPANARCVTITGNSMEPVLRNGATVGVDVGNTRIVDG 181

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMS-----DIEWIARILW 220
            L      G +  K      G  I L S N   +P +          +IE I R+ W
Sbjct: 182 DLYAINHGGLLRVKQTYRLPGGGIRLRSFNRDEHPDEEYSKDEIVAQEIEIIGRVFW 238


>gi|295101168|emb|CBK98713.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Faecalibacterium prausnitzii L2-6]
          Length = 210

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 69/211 (32%), Gaps = 17/211 (8%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + +  ++  ++ + LA K G+   +  K +          P   ++ +I    + T   L
Sbjct: 7   LKQCRKQKGISQAELASKLGVTQQAVGKWESGKS-----SPDPATVARIAEILSTTADFL 61

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L L       T  +E+             G            +  +   E          
Sbjct: 62  LGLYRPVSNVTTPEERFFGNYAESLIPVIGT-------VKAGYGALAFEEDYGQEYARVK 114

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGR 191
             +       +  SM P  + GD+ +++    +  GD  +L+    G+   K  I +RG 
Sbjct: 115 DPSNYFYLVVRGDSMEPRIQDGDLALVHKQDTLENGDLGVLVYGDEGEGTLKRYI-QRGN 173

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
            + L   N  Y    ++  D   +    R++
Sbjct: 174 CVVLQPFNPAYNELVIKGEDLNRLHIAGRVV 204


>gi|91794616|ref|YP_564267.1| transciptional regulator [Shewanella denitrificans OS217]
 gi|91716618|gb|ABE56544.1| transciptional regulator [Shewanella denitrificans OS217]
          Length = 229

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 69/228 (30%), Gaps = 21/228 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E I +  +   LT   +A+  GL   + +  +          P  E++  +  A      
Sbjct: 4   ERIKQRRKELGLTQPSIAKTIGLTKATISLWESGST-----SPKGENLHALAKALRCAPE 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSG------SGGFFDSGVFPTGNKWNTVG----- 119
            LL    S       +       +   S          F+       G+           
Sbjct: 59  FLLFGNDSIKPEPNAEWAGGFETWGSNSPLGDDEVEIPFYMEVELAAGDGIIDCREYQGP 118

Query: 120 -VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +   +S               K    SM P+   G  + +++A       ++      G
Sbjct: 119 KLRFAKSTLKRQGVTSDHAACVKVNGNSMEPVLPNGSTVGVDTAHTDIVDGKMYAINHDG 178

Query: 179 DIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD---IEWIARILWAS 222
            +  K+L    G  + L S N   YP + ++  +   ++ I ++ W S
Sbjct: 179 MLRVKMLYKLPGGGLRLRSYNLDEYPDERLDAEELKQVKVIGKVFWYS 226


>gi|9635582|ref|NP_061565.1| cI repressor protein [Pseudomonas phage D3]
 gi|2493333|sp|Q37906|RPC1_BPD3 RecName: Full=Repressor protein CI
 gi|1085700|pir||A55847 cI repressor homolog - Pseudomonas aeruginosa phage D3
 gi|403436|gb|AAA53553.1| cI repressor protein [Pseudomonas phage D3]
          Length = 223

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 75/220 (34%), Gaps = 11/220 (5%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ + I    +   LT + LA++ GLD TS +  ++   +G +       +      +  
Sbjct: 2   ELKDRIKAARKHAKLTQAQLAQRVGLDQTSISNLEQGKSQGTS---YIAQLASACGVSAL 58

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
            +        S+         E      P   + G    G F   +   T G+   R   
Sbjct: 59  WLAAGHGEMNSNKEALPGAPSEKDYALIPQYTARGECGDGYF-NDHVETTEGLVFKRDWL 117

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGDIVAKVLI 186
             + +             SM P   +GD+++ +++          +I+   G +  K L 
Sbjct: 118 KRVNSKPENLFVIYADGDSMEPYIFEGDVVLFDTSKTDPQDKQVYVIRRPDGGVSIKRLN 177

Query: 187 SRRGRSIDLMSLNCC---YPVDTVEMSDIE---WIARILW 220
            +   +  + S N     YP +    S +     I R++W
Sbjct: 178 QQLTGAWLIRSDNPDKSAYPDEMASESSVHELPIIGRVIW 217


>gi|331017574|gb|EGH97630.1| putative phage repressor [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 228

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 72/216 (33%), Gaps = 9/216 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
             + + I ++ +   L+   LA   G    +     ++       R PS + I KI    
Sbjct: 2   NTLGQHIRKLRKEKGLSQQALAHACGWESQSRIGNYEKGT-----RQPSLQDIRKIADTL 56

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS--GGFFDSGVFPTGNKWNTVGVPEI 123
             +   L+     + +    K K+        +         +        ++ +  P  
Sbjct: 57  GVSFVDLVAFTDDNAQPLVVKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPG 116

Query: 124 R-SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
               +  I++        K    SMLP  + G+ +++        GD ++++   G  + 
Sbjct: 117 HGDGYLNIHSDDPDAYGLKVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAGRTMI 176

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           K  I  R       S+N  +P   +  ++I  I  +
Sbjct: 177 KEYIYLRDGMYRFDSVNAEHPPIHIAENEILEIHLV 212


>gi|289522427|ref|ZP_06439281.1| LexA repressor [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289504263|gb|EFD25427.1| LexA repressor [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 216

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 78/219 (35%), Gaps = 18/219 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E I  + ++  +T + LAR+    P+  ++ +R       + PS   + KI      +
Sbjct: 2   LGERIRTLRKKMRMTATELARRVKTSPSHISEIERGE-----KTPSLNLLVKIAKELQTS 56

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I  L  L     +     E  +       +       +GV+P       + VPE      
Sbjct: 57  IDYLTGLEGFSKKALNVTEVALLDQASVTAAGKALDQTGVYPV--VEEMIYVPEDALGPV 114

Query: 129 GIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
           G           +    SM+        I+++N   +V  GD + +     +   K + +
Sbjct: 115 GDIPP----FAVRISGESMIGAGITDNSIVVINPNAEVGQGD-VALVSIGNEWTVKYIYT 169

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARILWA 221
           +   S++L   N  Y     +  D     ++ I +++W 
Sbjct: 170 KADGSLELRPANPSYSPIFFDKEDLISGLVKVIGKVVWI 208


>gi|213968238|ref|ZP_03396382.1| phage repressor [Pseudomonas syringae pv. tomato T1]
 gi|301381283|ref|ZP_07229701.1| putative phage repressor [Pseudomonas syringae pv. tomato Max13]
 gi|302062899|ref|ZP_07254440.1| putative phage repressor [Pseudomonas syringae pv. tomato K40]
 gi|213926876|gb|EEB60427.1| phage repressor [Pseudomonas syringae pv. tomato T1]
          Length = 228

 Score =  117 bits (294), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 72/216 (33%), Gaps = 9/216 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
             + + I ++ +   L+   LA   G    +     ++       R PS + I KI    
Sbjct: 2   NTLGQHIRKLRKEKGLSQQALAHACGWESQSRIGNYEKGT-----RQPSLQDIRKISDTL 56

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS--GGFFDSGVFPTGNKWNTVGVPEI 123
             +   L+     + +    K K+        +         +        ++ +  P  
Sbjct: 57  GVSFVDLVAFTDDNAQPLVVKLKDSAPRLTGKAKEGRVPVVGTAQLGNEGYFDALDFPPG 116

Query: 124 R-SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
               +  I++        K    SMLP  + G+ +++        GD ++++   G  + 
Sbjct: 117 HGDGYLNIHSDDPDAYGLKVTGDSMLPRIKNGEFVLIEPNKSYVSGDEVMVRTAAGRTMI 176

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           K  I  R       S+N  +P   +  ++I  I  +
Sbjct: 177 KEYIYLRDGMYRFDSVNAEHPPIHIAENEILEIHLV 212


>gi|313885531|ref|ZP_07819281.1| peptidase S24-like protein [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619261|gb|EFR30700.1| peptidase S24-like protein [Eremococcus coleocola ACS-139-V-Col8]
          Length = 213

 Score =  117 bits (294), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 72/213 (33%), Gaps = 16/213 (7%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPT-SFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
            + +  +  +  +T   +A   G   T S +  +          P+  +I KI +     
Sbjct: 8   GKNLKYLRNKKGITQQEIADLIGRKSTGSVSDWEAGRTT-----PNAGNISKIASYFGLK 62

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I  +++       +       I      P        + +    N  +++  P    P  
Sbjct: 63  IDAMVEYDLQTQASAPSNLIPIKQTKLIPVIGRIACGAPILADQNIIDSIAFPVELLPS- 121

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLIS 187
                  +    + +  SM+P  +   ++++     V  G+  +++     +   K +  
Sbjct: 122 ------GEIFFLECRGDSMMPTIQDKALVMVRKQENVEDGEIAVVLLNGDEEATLKRIKR 175

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
           + G  I L+  N  +P   ++ +D I  + + +
Sbjct: 176 Q-GDLIMLLPDNTNHPPIVIQPTDTIRIVGKAI 207


>gi|148912804|ref|YP_001293383.1| Repressor protein [Pseudomonas phage F10]
          Length = 224

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 82/223 (36%), Gaps = 17/223 (7%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ ++I    +   LT + LA++ GLD TS +  ++   +G      T  I ++ AA   
Sbjct: 2   ELKDSIKAARKHAKLTQAQLAQRVGLDQTSISNLEQGKSQG------TAYIAQLAAACGV 55

Query: 68  TICQLLDLPFSDGRTTEKKEK---EIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
           +   L     S     E   +   E      P   + G    G F   +   T G+   R
Sbjct: 56  SALWLAAGHGSMNNNEEVPPRAPSEKDYALIPQYTARGECGDGYF-NDHVETTEGLVFKR 114

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAK 183
                + +          +  SM P   +GD+++ + A  +       +I+   G I  K
Sbjct: 115 DWLKRVNSKPENLFVIYAEGDSMEPYIFEGDVVLFDVAKIEPQDKQVYVIRRPDGGISIK 174

Query: 184 VLISRRGRSIDLMSLNCC---YPVDTVEMSDIE---WIARILW 220
            L  +   +  + S N     YP +    + +     I R++W
Sbjct: 175 RLNQQLSGAWLIRSDNPDKTAYPDEIASETSVHDLPIIGRVIW 217


>gi|169832055|ref|YP_001718037.1| putative prophage repressor [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638899|gb|ACA60405.1| putative prophage repressor [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 196

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 66/211 (31%), Gaps = 26/211 (12%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E I R+ E   L+   LARKAGL     +  +          PS +S+ K+  A    
Sbjct: 4   VGETIRRLREESGLSQRALARKAGLSSQYLSDIEVGRT-----SPSLKSLEKLAGALQVA 58

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
             QLL              +    +   P          V       + + +P   +   
Sbjct: 59  PGQLLQGQD----------RFSSQVVEVPVLGRVPAGGPVVSEEVILDYLPLPRKLAS-- 106

Query: 129 GIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                       + +  SM       GD +++        G  ++ +   G++  K    
Sbjct: 107 ------EDTFCLEVRGESMQDLGIDSGDYVLVRLQPTAENGQVVIAR-VEGEVTCKRYYR 159

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              R + L   N  +    +E  +IE +  +
Sbjct: 160 -TDRVVSLEPANRRFRPLRLEAGEIEIVGVV 189


>gi|218133316|ref|ZP_03462120.1| hypothetical protein BACPEC_01181 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992189|gb|EEC58193.1| hypothetical protein BACPEC_01181 [Bacteroides pectinophilus ATCC
           43243]
          Length = 217

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 73/218 (33%), Gaps = 21/218 (9%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            +++ I        ++   LA   G  D +S  K ++  ++      S   I +   A  
Sbjct: 9   NLYKNIRERRIELKMSQDTLAELTGYRDRSSIAKIEKGEVD-----ISESKIREFAKALK 63

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +  +L+     + +T    +    ++              +  T +  +T  +PE    
Sbjct: 64  VSPGELMGWDEHNSQTEHTPQGHKGVV--INVLGRVAAGIPIEATTDIIDTEEIPEEM-- 119

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                A        K +  SM P    GD++I+    +   GD ++      D   K L 
Sbjct: 120 -----AKTGDFFALKIKGNSMEPRIMDGDVVIVRKQDEAENGDVIIAMVNGDDATCKRLR 174

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARIL 219
             +   I+L+S N  Y        D     +  I +++
Sbjct: 175 KYKDG-IELISNNPSYKPMFFSDMDVQTKPVRIIGKVV 211


>gi|257440049|ref|ZP_05615804.1| SOS-response transcriptional repressor [Faecalibacterium
           prausnitzii A2-165]
 gi|257197401|gb|EEU95685.1| SOS-response transcriptional repressor [Faecalibacterium
           prausnitzii A2-165]
          Length = 209

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 68/211 (32%), Gaps = 18/211 (8%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + +  ++ +++ + LA   G+   +  K +          P   ++ K+     +T    
Sbjct: 7   LRQCRKQKHMSQAELASLLGVTQQAVGKWESGKS-----SPDPTTVAKLAEIL-DTTADY 60

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L   F      + +E+      +      G            +  +   E          
Sbjct: 61  LLGLFDPTAEGQTEERFFGSYVYSLIPVIGT-------VKAGYGALAYEEDYGKEYARVK 113

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRRGR 191
             +       +  SM P    GD+ +++    +  GD  +LI    G+   K  + +RG 
Sbjct: 114 DPSSYFYLVVRGDSMEPRIHDGDLALVHRQDTLENGDLGVLIYGDEGEGTLKRYL-QRGN 172

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
            + L   N  Y    ++  +   +    R++
Sbjct: 173 CVVLQPFNPAYKEMVIKGEELNHLHIAGRVV 203


>gi|167769359|ref|ZP_02441412.1| hypothetical protein ANACOL_00685 [Anaerotruncus colihominis DSM
           17241]
 gi|167668327|gb|EDS12457.1| hypothetical protein ANACOL_00685 [Anaerotruncus colihominis DSM
           17241]
          Length = 205

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/212 (11%), Positives = 59/212 (27%), Gaps = 25/212 (11%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +  + +   ++   LA++ G+   +  K +          P   ++  I      +  
Sbjct: 10  ERLKALRKECGISQRALAQRLGVSQQAVAKWEAASST-----PGPNALATIADVLGVSSD 64

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            LL          +   +   L                      +      E        
Sbjct: 65  YLLGRERDFQDGAQDTARLPVLGT----------------VKAGYGAYAFEEDYGTAPAQ 108

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
                       +  SM P    GD+ +++    V  G+  ++     +   K +I +  
Sbjct: 109 VRDPRDYFYLIVRGDSMEPRIHSGDLALVHRQPDVESGELAVVLVAGEEGTLKRVIKKE- 167

Query: 191 RSIDLMSLNCCYPVDTV---EMSDIEWIARIL 219
            ++ L   N  Y        E+  +  I +++
Sbjct: 168 GAVILQPFNQAYQPQVFIGEELEQLVIIGKVV 199


>gi|254494052|ref|ZP_05107223.1| transcriptional regulator [Neisseria gonorrhoeae 1291]
 gi|226513092|gb|EEH62437.1| transcriptional regulator [Neisseria gonorrhoeae 1291]
          Length = 243

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 68/234 (29%), Gaps = 28/234 (11%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA------- 63
           + +    +  NL+   LA+ A +  ++    +    +      +   + KIL        
Sbjct: 13  DRLKEARKNKNLSQENLAKLAEVSQSTIAALESGRNKKAT---NIAKLAKILDVSAFWLE 69

Query: 64  --------------ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
                              +  +              +  + + Y   S   G   +   
Sbjct: 70  TGEGSRNTPVLINPDLPHEVKDIHRPMMWSSNDPLPDDDYVFVPYLKESCFKGGAGAYEI 129

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P  N +    +P  +S                    SM     +   + +++        
Sbjct: 130 PDYNGY---RLPFGKSTLRRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTGETAIRDG 186

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
           ++    + G    K LI + G S+ + S N   YP +T  +  +  I R+ W S
Sbjct: 187 KIYAFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYPDETASLDSLTVIGRVFWWS 240


>gi|331674164|ref|ZP_08374924.1| 26 kDa repressor protein (Regulatory protein CI) [Escherichia coli
           TA280]
 gi|331068258|gb|EGI39653.1| 26 kDa repressor protein (Regulatory protein CI) [Escherichia coli
           TA280]
          Length = 229

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 73/226 (32%), Gaps = 15/226 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +    +    I ++ +    + + LARK G+   S              +P    + +
Sbjct: 1   MKNLKSTE--NRITKLLQEKGWSQAELARKLGVSAQSVQYWTTGKT-----FPRGNRLAQ 53

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWN--- 116
           +   +       L    S   ++++K +              F    G    G+  +   
Sbjct: 54  LSEISGYPQSWFLGEITSRQFSSKEKHQTRTDSVVFNVLDVEFSCGDGTHVRGDFIDVVR 113

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           ++ +    +                 +  SM P    GD+L L+  +    GD +     
Sbjct: 114 SIELDPEYARRLVGNRAFQNIEIGNARGDSMAPTIAPGDLLFLDKTVNYFDGDGIYAFCF 173

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARIL 219
            G+   K L    G  I ++S N  Y   ++E   +E     ++++
Sbjct: 174 DGECYVKRLQKI-GSKIMVLSDNPNYQSWSIEKDALELLYIQSKVI 218


>gi|221213964|ref|ZP_03586937.1| HTH-type transcriptional regulator PrtR (Pyocin repressor protein)
           [Burkholderia multivorans CGD1]
 gi|221166141|gb|EED98614.1| HTH-type transcriptional regulator PrtR (Pyocin repressor protein)
           [Burkholderia multivorans CGD1]
          Length = 257

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 30/236 (12%), Positives = 71/236 (30%), Gaps = 21/236 (8%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           S + +   +        L+   LAR+ G+      + +    +G        ++ + L  
Sbjct: 17  SMETLGSRVKAARLDAKLSQEALARQVGVSQGLIGQIESGKNQGSKH---LAALARALGV 73

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS--------GGFFDSGVFPTGNKWN 116
           + + +              +  E +  +L +                     F  G    
Sbjct: 74  SADWLETGKGPRERAVGQHKIPEDQGNVLVWEHPDDLPPDENRVWLDRYDYRFSAGTGLI 133

Query: 117 TVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                    +P        + +        +    SM P     D++++++A       +
Sbjct: 134 QWEVRQKKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTAKTHIRDGK 193

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEM---SDIEWIARILWAS 222
           +      G+ + K +  + G SI L S+N   YP   V       +  +  +++ S
Sbjct: 194 VYAIYFEGEPLVKQIFKQAGGSICLHSINSGKYPDKIVTPELMESVTIMGEVIYRS 249


>gi|312967403|ref|ZP_07781618.1| helix-turn-helix family protein [Escherichia coli 2362-75]
 gi|312287600|gb|EFR15505.1| helix-turn-helix family protein [Escherichia coli 2362-75]
          Length = 255

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 73/226 (32%), Gaps = 15/226 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +    +    I ++ +    + + LARK G+   S              +P    + +
Sbjct: 27  MKNLKSTE--NRITKLLQEKGWSQAELARKLGVSAQSVQYWTTGKT-----FPRGNRLAQ 79

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWN--- 116
           +   +       L    S   ++++K +              F    G    G+  +   
Sbjct: 80  LSEISGYPQSWFLGEITSRQFSSKEKHQARTDSVVFNVLDVEFSCGDGTHVRGDFIDVVR 139

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           ++ +    +                 +  SM P    GD+L L+  +    GD +     
Sbjct: 140 SIELDPEYARRLVGNRAFQNIEIGNARGDSMAPTIAPGDLLFLDKTVNYFDGDGIYAFCF 199

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARIL 219
            G+   K L    G  I ++S N  Y   ++E   +E     ++++
Sbjct: 200 DGECYVKRLQKI-GSKIMVLSDNPNYQSWSIEKDALELLYIQSKVI 244


>gi|126175811|ref|YP_001051960.1| putative phage repressor [Shewanella baltica OS155]
 gi|125999016|gb|ABN63091.1| putative phage repressor [Shewanella baltica OS155]
          Length = 233

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 74/234 (31%), Gaps = 23/234 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E      +  NLT   L++K G+   + ++ +          P  E+++K+  A  
Sbjct: 2   KTLGERSKERRKIINLTQLQLSKKVGVSSVTISQWESGDT-----SPKGENLYKLAQALQ 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG--------SGGFFDSGVFPTGNKW-NT 117
            +   L+     + +  E   +         +            F+       G      
Sbjct: 57  CSPDWLMFGDSKNTKKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYMDVELSAGEGIAEG 116

Query: 118 VG-----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           V      +   +S               K    SM P+   G  + ++++       ++ 
Sbjct: 117 VEYKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMY 176

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARILWAS 222
                G +  K+L    G  + L S N   +P + +       I+ I ++ W S
Sbjct: 177 AINHDGMMRVKMLYKLPGGGLRLRSYNTDEWPDEHINNEQLKNIKVIGKVFWYS 230


>gi|296114602|ref|ZP_06833255.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978958|gb|EFG85683.1| hypothetical protein GXY_02456 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 221

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/181 (29%), Positives = 81/181 (44%), Gaps = 10/181 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             SH+ IW A+D +A    +TPSGLAR AGLD T+FN SKR    GR RWP TES+ + L
Sbjct: 1   MISHEDIWRALDLLATERGMTPSGLARAAGLDSTTFNPSKRMTSSGRPRWPGTESLARTL 60

Query: 63  AATNETICQL-LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +AT  ++      +     R        + ++ F   G    FD    P+G++W T    
Sbjct: 61  SATGISLEGFGRLMTGHGDRLGGTHHAHLMIVPFSELGQAELFDESGLPSGDRWETWDFH 120

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
            +   H                  +M P++R G +L+++    +   DR+L+        
Sbjct: 121 GLADHH---------SYAVLVDSDNMEPIFRAGTVLVVSPTAAIRQHDRVLLHGPDSHAC 171

Query: 182 A 182
            
Sbjct: 172 C 172


>gi|162145992|ref|YP_001600450.1| hypothetical protein GDI_0160 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209544371|ref|YP_002276600.1| hypothetical protein Gdia_2230 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161784566|emb|CAP54103.1| conseved protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532048|gb|ACI51985.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 217

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 65/234 (27%), Positives = 93/234 (39%), Gaps = 34/234 (14%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H  +W+A+D +A    LTPSGLAR AGLD TSFN SKR    GR RWP TES+ ++L
Sbjct: 1   MMRHDDLWQALDNLAAERGLTPSGLARAAGLDSTSFNPSKRVTPAGRPRWPGTESLARVL 60

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS---GGFFDSGVFPTGNKWNTVG 119
            AT  T+     L          +      L          GG FD+   P G  W +  
Sbjct: 61  DATGLTLESFGRLMAGQALPRASRAAGRSRLRLSALSHLEQGGMFDAAGLPVGRHWESWD 120

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           VP +            +         +  P++R G  L+++SA  +   DR+++      
Sbjct: 121 VPGLGD---------AELYAVMVDTDAFEPVFRAGAFLVVSSAAAIRRQDRVILHRADAT 171

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPV------------DTVEMSDIEWIARILWA 221
           + A VL  R G           Y                +E    + + RI+ A
Sbjct: 172 LCAVVLDPRPG----------AYDPGPLLGGIGARDGMEIETGPTDHLHRIMMA 215


>gi|238762739|ref|ZP_04623708.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
 gi|238699044|gb|EEP91792.1| Phage-related repressor protein [Yersinia kristensenii ATCC 33638]
          Length = 240

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 7/207 (3%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
                 ++ +  +H ++ S LA+ +G+      +      +     P  E + KI    N
Sbjct: 21  DDFAARLNSLMSKHEISVSSLAKLSGVSYEMARRYTLGTAK-----PRDEKMLKIADHLN 75

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L     +   T    +          + +G  + +  FP     +++ +PE +  
Sbjct: 76  VSPAFLDYGTMTGRDTEADSKVVKLRQLEVFASAGHGYINNEFPA--VISSIEIPEDKIY 133

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                              SM+P     D+L +++ I    GD + +         K L 
Sbjct: 134 ELFGRKSLDGIHLMNVDGDSMMPTLHPRDLLFIDTKIDHFNGDGVYVFNFEDSTFVKRLQ 193

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE 213
             +GR + ++S N  YP   +E +++ 
Sbjct: 194 KVKGRRLSVLSDNDKYPPFFIEANEMN 220


>gi|152999279|ref|YP_001364960.1| putative phage repressor [Shewanella baltica OS185]
 gi|151363897|gb|ABS06897.1| putative phage repressor [Shewanella baltica OS185]
          Length = 240

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/232 (12%), Positives = 71/232 (30%), Gaps = 21/232 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + + I    +   +T   L    G+   +  + ++         P   ++F +  +  
Sbjct: 11  KTLGQRIREKRKELGITQKALGALVGVSAVAVTQWEKDET-----APKGANLFALAKSLK 65

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYF------PPSGSGGFFDSGVFPTGNKW-NTVG 119
             +  LL+   +    +  +      L+              F+       G      + 
Sbjct: 66  CDLSWLLNGQIATKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYVDIELSAGEGIVEGIE 125

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   +S               K    SM P+   G  + ++++       ++   
Sbjct: 126 YKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMYAI 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMS---DIEWIARILWAS 222
              G +  K+L    G  + L S N   YP + ++      ++ I ++ W S
Sbjct: 186 NHDGMMRVKMLYKLPGGGLRLRSYNLDEYPDERLDADQLKQVKVIGKVFWYS 237


>gi|239999287|ref|ZP_04719211.1| putative phage repressor protein, putative phage associated protein
           [Neisseria gonorrhoeae 35/02]
          Length = 236

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 68/234 (29%), Gaps = 28/234 (11%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA------- 63
           + +    +  NL+   LA+ A +  ++    +    +      +   + KIL        
Sbjct: 6   DRLKEARKNKNLSQENLAKLAEVSQSTIAALESGRNKKAT---NIAKLAKILDVSAFWLE 62

Query: 64  --------------ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
                              +  +              +  + + Y   S   G   +   
Sbjct: 63  TGEGSRNTPVLINPDLPHEVKDIHRPMMWSSNDPLPDDDYVFVPYLKESCFKGGAGAYEI 122

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P  N +    +P  +S                    SM     +   + +++        
Sbjct: 123 PDYNGY---RLPFGKSTLRRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTGETAIRDG 179

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
           ++    + G    K LI + G S+ + S N   YP +T  +  +  I R+ W S
Sbjct: 180 KIYAFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYPDETASLDSLTVIGRVFWRS 233


>gi|160875134|ref|YP_001554450.1| putative phage repressor [Shewanella baltica OS195]
 gi|160860656|gb|ABX49190.1| putative phage repressor [Shewanella baltica OS195]
 gi|315267325|gb|ADT94178.1| putative phage repressor [Shewanella baltica OS678]
          Length = 233

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 74/234 (31%), Gaps = 23/234 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E      +  NLT   L++K G+   + ++ +          P  E+++K+  A  
Sbjct: 2   KTLGERSKERRKTINLTQLQLSKKVGVSSVTISQWESGDT-----SPKGENLYKLAQALQ 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG--------SGGFFDSGVFPTGNKW-NT 117
            +   L+     + +  E   +         +            F+       G      
Sbjct: 57  CSPDWLMFGDSKNTKKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYVDIELSAGEGIVEG 116

Query: 118 VG-----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           V      +   +S               K    SM P+   G  + ++++       ++ 
Sbjct: 117 VEYKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMY 176

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARILWAS 222
                G +  K+L    G  + L S N   +P + +       I+ I ++ W S
Sbjct: 177 AINHDGMMRVKMLYKLPGGGLRLRSYNTDEWPDEHINNEQLKNIKVIGKVFWYS 230


>gi|217971957|ref|YP_002356708.1| putative phage repressor [Shewanella baltica OS223]
 gi|217497092|gb|ACK45285.1| putative phage repressor [Shewanella baltica OS223]
          Length = 233

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 74/234 (31%), Gaps = 23/234 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E      +  NLT   L++K G+   + ++ +          P  E+++K+  A  
Sbjct: 2   KTLGERSKERRKIINLTQLQLSKKVGVSSVTISQWESGDT-----SPKGENLYKLAQALQ 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG--------SGGFFDSGVFPTGNKW-NT 117
            +   L+     + +  E   +         +            F+       G      
Sbjct: 57  CSPDWLMFGDSKNTKKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYVDIELSAGEGITEG 116

Query: 118 VG-----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           V      +   +S               K    SM P+   G  + ++++       ++ 
Sbjct: 117 VEYKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMY 176

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARILWAS 222
                G +  K+L    G  + L S N   +P + +       I+ I ++ W S
Sbjct: 177 AINHDGMMRVKMLYKLPGGGLRLRSYNTDEWPDEHINNEQLKNIKVIGKVFWYS 230


>gi|255282221|ref|ZP_05346776.1| LexA repressor [Bryantella formatexigens DSM 14469]
 gi|255267169|gb|EET60374.1| LexA repressor [Bryantella formatexigens DSM 14469]
          Length = 206

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 68/218 (31%), Gaps = 26/218 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           +I   I    E   +T   LA K G  + +S  K +    +          + +   A N
Sbjct: 3   EIGIRIREQREAIGMTQEELASKLGYKNKSSIAKIETGAND-----IVQSKVIEFADALN 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            T+  L+          +                       +    +  +T  +PE    
Sbjct: 58  TTVSYLMGW-------EKTNVNSRKKGVTINVLGRVAAGIPIEAITDIIDTEEIPEEM-- 108

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                A   +    +    SM P + +GD++I+        GD ++      D   K L 
Sbjct: 109 -----AATGEFFGLQIHGDSMEPKFSEGDVVIVRQQDDAESGDIVIAMINGDDATCKRLR 163

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE-----WIARIL 219
             R   I+L+S N  Y        DIE      I +++
Sbjct: 164 KYRDG-IELVSTNPSYEPMFFSNEDIEQKPVKIIGKVV 200


>gi|218665577|ref|YP_002425471.1| transcriptional regulator, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|218517790|gb|ACK78376.1| transcriptional regulator, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 243

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 75/232 (32%), Gaps = 20/232 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H++I  AI    ++   T + LA K G+   S ++     I  R   PS E++F++ 
Sbjct: 1   MELHERIKFAI----KQSGFTQNALAEKLGISRGSISQWVSGNIATRT-VPSRENLFRLA 55

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG----FFDSGVFPTGNKW--- 115
             +   I  L     S     +K E  + +  +      G       +     G      
Sbjct: 56  ELSGVPIEWLWSGRESAAHKPQKPEGSLSVSEYQDEEGLGDGEVEIPALNLQVGAGSRIV 115

Query: 116 -----NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                        RS             R +    SM P  + G  + ++ +       +
Sbjct: 116 CETIQEERKFRYARSWLQKYGLDSKYLFRVRVYGDSMEPYIKNGAWITVDKSRTNIQNGK 175

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
           + +     +I  K L  R    I + S N  YP   V  +D   I  I  ++
Sbjct: 176 IYVLRSGEEIQVKALFKRPDSGIIIRSNNPAYPDVQVSATDMEHIAIIGEVI 227


>gi|317054052|ref|YP_004118077.1| putative phage repressor [Pantoea sp. At-9b]
 gi|316952047|gb|ADU71521.1| putative phage repressor [Pantoea sp. At-9b]
          Length = 230

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 83/208 (39%), Gaps = 10/208 (4%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +D + +  NL+ + LAR AG+ P + N   + G  G+      +S  KI AAT   +  
Sbjct: 14  RLDELLKAANLSKADLARIAGVSPQAVNNWFKRGEIGK------DSAIKISAATGLDLSW 67

Query: 72  LLDLPFSDGR-TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
           +L           +K   E+ ++    +G        V       + +           I
Sbjct: 68  VLGESDQMYSTPHQKPASEVEVVGNIMNGVIPVKGDAVLGMDGLIDMMEFHAGWL---RI 124

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           Y+   +    + +  SM P  + G+ +++    +V+ GD + I+   G  + K+L   R 
Sbjct: 125 YSDDREAYGVRVRGDSMWPRIQSGEFVVIEPNTKVHPGDEVFIRTSDGHNMIKILNYNRA 184

Query: 191 RSIDLMSLNCCYPVDTVEMSDIEWIARI 218
                 S+N  +   T+ ++ ++ I  +
Sbjct: 185 GDYQFTSINNDHKPFTLPVNQVDKIHFV 212


>gi|114562824|ref|YP_750337.1| putative phage repressor [Shewanella frigidimarina NCIMB 400]
 gi|114334117|gb|ABI71499.1| putative phage repressor [Shewanella frigidimarina NCIMB 400]
          Length = 230

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 68/232 (29%), Gaps = 22/232 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + + I    +   LT   LA +A +     +K      +  ++      +  I     
Sbjct: 2   KTLAQNIQEKLKASGLTQKELAERANISQVMVHKLISGKAKESSK------LVAIAGVLG 55

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFP------PSGSGGFFDSGVFPTGNKWNTVG- 119
            T  +L+        T+  +       +              F+       G+       
Sbjct: 56  CTAEELMYGLEKHVPTSNAEWAGPMETWDSNTPLNDDEVEIPFYMEVELAAGHGIAEASE 115

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   +S         T     +    SM P+   G  + ++++       ++   
Sbjct: 116 YHGPKLRFAKSTLRKSSVDPTNAACVRVSGNSMEPVLPSGSTVGVDTSQTDVIDGKMYAI 175

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMS---DIEWIARILWAS 222
              G +  K L    G  + L S N   +P +  E      I+ I ++ W S
Sbjct: 176 NHDGMLRVKTLYKLPGGGLRLRSYNIDEWPDERYEGEAIKQIKIIGKVFWYS 227


>gi|260844262|ref|YP_003222040.1| putative phage repressor CI [Escherichia coli O103:H2 str. 12009]
 gi|257759409|dbj|BAI30906.1| putative phage repressor CI [Escherichia coli O103:H2 str. 12009]
          Length = 229

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 64/204 (31%), Gaps = 10/204 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             I  M +    T + LARK G+   S              +P ++ +  +   +     
Sbjct: 9   NRIAAMLKAKGWTQAQLARKLGVSAQSVQYWTTGKT-----FPRSDKLAHLSEISGYPQS 63

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWN---TVGVPEIRSP 126
             L    S   ++++K +              F    G    G+  +   ++ +    + 
Sbjct: 64  WFLGEDSSPTFSSQEKHQTRTDSVVFNVLDVEFSCGDGTHVRGDLIDVVRSIELDPEYAR 123

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                           +  SM P    GD+L L+  +    GD +      G+   K L 
Sbjct: 124 RLVGNRAFKNIEIGNARGDSMAPTISPGDLLFLDKTVTYFDGDGIYAFCFDGECYVKRLQ 183

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMS 210
              G  I ++S N  Y   ++E  
Sbjct: 184 KI-GSKIMVLSDNPNYQPWSIEKE 206


>gi|188492663|ref|ZP_02999933.1| regulatory protein [Escherichia coli 53638]
 gi|188487862|gb|EDU62965.1| regulatory protein [Escherichia coli 53638]
 gi|315615351|gb|EFU95983.1| helix-turn-helix family protein [Escherichia coli 3431]
          Length = 229

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/204 (16%), Positives = 64/204 (31%), Gaps = 10/204 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             I  M +    T + LARK G+   S              +P ++ +  +   +     
Sbjct: 9   NRIAAMLKAKGWTQAQLARKLGVSAQSVQYWTTGKT-----FPRSDKLAHLSEISGYPQS 63

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWN---TVGVPEIRSP 126
             L    S   ++++K +              F    G    G+  +   ++ +    + 
Sbjct: 64  WFLGEDSSPTFSSQEKHQTRTDSVVFNVLDVEFSCGDGTHVRGDLIDVVRSIELDPEYAR 123

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                           +  SM P    GD+L L+  +    GD +      G+   K L 
Sbjct: 124 RLVGNRAFKNIEIGNARGDSMAPTISPGDLLFLDKTVTYFDGDGIYAFCFDGECYVKRLQ 183

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMS 210
              G  I ++S N  Y   ++E  
Sbjct: 184 KI-GSKIMVLSDNPNYQPWSIEKE 206


>gi|59800917|ref|YP_207629.1| putative lambda repressor protein cI, putative phage associated
           protein [Neisseria gonorrhoeae FA 1090]
 gi|254493392|ref|ZP_05106563.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|268594521|ref|ZP_06128688.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268598656|ref|ZP_06132823.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601679|ref|ZP_06135846.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603328|ref|ZP_06137495.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681808|ref|ZP_06148670.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684029|ref|ZP_06150891.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|291044180|ref|ZP_06569892.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398777|ref|ZP_06642945.1| lambda repressor protein cI [Neisseria gonorrhoeae F62]
 gi|59717812|gb|AAW89217.1| putative lambda repressor protein cI, putative phage associated
           protein [Neisseria gonorrhoeae FA 1090]
 gi|226512432|gb|EEH61777.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|268547910|gb|EEZ43328.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268582787|gb|EEZ47463.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585810|gb|EEZ50486.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268587459|gb|EEZ52135.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622092|gb|EEZ54492.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624313|gb|EEZ56713.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|291011897|gb|EFE03890.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610779|gb|EFF39886.1| lambda repressor protein cI [Neisseria gonorrhoeae F62]
          Length = 238

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 78/220 (35%), Gaps = 11/220 (5%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
             FS +++ +AI    +R N++   +A   G+   S +   + G   +        + K+
Sbjct: 18  KMFSGEQLGQAISEAIKRKNVSQKEVADHFGVKQPSVSGWIKNGRIDKKH------LDKL 71

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +   ++ +        +       ++  I         + G             + V V 
Sbjct: 72  IDYFSDVVTPSHFGIETFRVLKSNEQSSIRFPRLNAEATCGAGTINDHYIE-VVDYVTVA 130

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
              +       +         +  SM P    GD++ +++A++   GD L +      + 
Sbjct: 131 AAWAREKLGGNLNK-IQVITARGDSMEPTIENGDVMFVDTAVEAFDGDGLYLLWYIDGLK 189

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI 218
           AK L S  G  + ++S N  Y  +TV   D   +  I RI
Sbjct: 190 AKRLQSTVGGGLMIISDNSSYRTETVRGEDLNAVRIIGRI 229


>gi|85058915|ref|YP_454617.1| hypothetical protein SG0937 [Sodalis glossinidius str. 'morsitans']
 gi|84779435|dbj|BAE74212.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 236

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 68/238 (28%), Gaps = 28/238 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             I E +  +  +  L     A K  + P + +   +          S ES  K+     
Sbjct: 2   NNITERLKHVMAQEGLNQRAFAEKLNVSPQTLHNWLKRNA------ISRESAQKLSTLFG 55

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGN 113
            ++  LL+   +    +    +  P   +   GS               F+       G 
Sbjct: 56  YSLDWLLNGKGATKAASNNNSEVPPEDEWGRIGSWDRKTPLNNDEVEIPFYKDIELAAGG 115

Query: 114 K-WNTVG-------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
             +  V          +      G  +         T   SM P    G  + ++   + 
Sbjct: 116 GCFENVDYNSFLLRFSKSTLRRVGADSSGHGVICFTTHGNSMEPFIPDGTCVAIDCNNKH 175

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIEWIARILWAS 222
                +      G    K L  R    I + S N   YP +  +  +++ I R+ W S
Sbjct: 176 VHDGDVYAININGLKRIKQLYMRPKGKIVVRSFNRLEYPDEEFDEQEVDIIGRLFWTS 233


>gi|261381037|ref|ZP_05985610.1| transcriptional regulator, Cro/CI family [Neisseria subflava
           NJ9703]
 gi|284796072|gb|EFC51419.1| transcriptional regulator, Cro/CI family [Neisseria subflava
           NJ9703]
          Length = 228

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 73/226 (32%), Gaps = 14/226 (6%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           +I + +        L+ +GL++  G+   S    +    +   R  +  SI K L  +  
Sbjct: 3   EIKDRLREARRNKGLSQAGLSKLLGVSQASIAAIEAGRNK---RPTNLVSIAKALDVSPY 59

Query: 68  T---ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW-NTVG---- 119
                 +  ++  +     + +E +              +       GN + + +     
Sbjct: 60  WLETGKEDKEIISNATPLGKIEEWDNDTPLSEDDCEAPLYKDVKLSAGNGFADDIEDYNG 119

Query: 120 --VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
             +   R+                    SM P++  G  L +++  +     ++      
Sbjct: 120 YKLRFSRNTLRKHGISPENVVCVMADGDSMEPVFPSGATLGIDTGSKNIRDGQIYAINHG 179

Query: 178 GDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIEWIARILWAS 222
           G +  K+L       + + S N   YP +   + D+  I R+ W S
Sbjct: 180 GLLRTKILHKLPENKVRIRSYNQSEYPDEEASLDDLSVIGRVFWWS 225


>gi|315266122|gb|ADT92975.1| putative phage repressor [Shewanella baltica OS678]
          Length = 240

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 71/232 (30%), Gaps = 21/232 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + + I    +   +T   L    G+   +  + ++         P   ++F +  +  
Sbjct: 11  KTLGQRIREKRKELGITQKALGALVGVSAVAVTQWEKDET-----APKGANLFALAKSLK 65

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYF------PPSGSGGFFDSGVFPTGNKW-NTVG 119
             +  LL+   +    +  +      L+              F+       G      V 
Sbjct: 66  CDLSWLLNGQVAVKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYVDIELSAGEGITEGVE 125

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   +S               K    SM P+   G  + ++++       ++   
Sbjct: 126 YKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMYAI 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD---IEWIARILWAS 222
              G +  K+L    G  + L S N   YP + ++      I+ I ++ W S
Sbjct: 186 NHDGMMRVKMLYKLPGGGLRLRSYNLDEYPDEHLDTEKLKHIKIIGKVFWYS 237


>gi|304409163|ref|ZP_07390784.1| putative phage repressor [Shewanella baltica OS183]
 gi|307303166|ref|ZP_07582921.1| putative phage repressor [Shewanella baltica BA175]
 gi|304352984|gb|EFM17381.1| putative phage repressor [Shewanella baltica OS183]
 gi|306913526|gb|EFN43948.1| putative phage repressor [Shewanella baltica BA175]
          Length = 233

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 74/234 (31%), Gaps = 23/234 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E      +  NLT   L++K G+   + ++ +          P  E+++K+  A  
Sbjct: 2   KTLGERSKERRKTINLTQLQLSKKVGVSSVTISQWESGDT-----SPKGENLYKLAQALQ 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG--------SGGFFDSGVFPTGNKW-NT 117
            +   L+     + +  E   +         +            F+       G      
Sbjct: 57  CSPDWLMFGDSKNTKKPESNAEWAGGFDLWDNDSPLGDDEVEIPFYVDIELSAGEGIVEG 116

Query: 118 VG-----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           V      +   +S               K    SM P+   G  + ++++       ++ 
Sbjct: 117 VEYKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIVDGKMY 176

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARILWAS 222
                G +  K+L    G  + L S N   +P + +       I+ I ++ W S
Sbjct: 177 AINHDGIMRVKMLYKLPGGGLRLRSYNTDEWPDEHINNEQLKNIKVIGKVFWYS 230


>gi|194098221|ref|YP_002001276.1| Putative lambda repressor protein cI, putative phage associated
           protein [Neisseria gonorrhoeae NCCP11945]
 gi|193933511|gb|ACF29335.1| Putative lambda repressor protein cI, putative phage associated
           protein [Neisseria gonorrhoeae NCCP11945]
 gi|317163946|gb|ADV07487.1| putative lambda repressor protein cI, putative phage associated
           protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 220

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 78/219 (35%), Gaps = 11/219 (5%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            FS +++ +AI    +R N++   +A   G+   S +   + G   +        + K++
Sbjct: 1   MFSGEQLGQAISEAIKRKNVSQKEVADHFGVKQPSVSGWIKNGRIDKKH------LDKLI 54

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
              ++ +        +       ++  I         + G             + V V  
Sbjct: 55  DYFSDVVTPSHFGIETFRVLKSNEQSSIRFPRLNAEATCGAGTINDHYIE-VVDYVTVAA 113

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
             +       +         +  SM P    GD++ +++A++   GD L +      + A
Sbjct: 114 AWAREKLGGNLNK-IQVITARGDSMEPTIENGDVMFVDTAVEAFDGDGLYLLWYIDGLKA 172

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI 218
           K L S  G  + ++S N  Y  +TV   D   +  I RI
Sbjct: 173 KRLQSTVGGGLMIISDNSSYRTETVRGEDLNAVRIIGRI 211


>gi|152985545|ref|YP_001349953.1| transcriptional regulator [Pseudomonas aeruginosa PA7]
 gi|150960703|gb|ABR82728.1| probable transcriptional regulator [Pseudomonas aeruginosa PA7]
          Length = 237

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 69/239 (28%), Gaps = 30/239 (12%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ + I    +  NL+   LA+  G+  TS +  +R           T  + +I  A   
Sbjct: 2   ELKDRIKAARKHANLSQVQLAQAVGMTQTSISDLERGKSRA------TSFVAQIAGACGV 55

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNK 114
               L +          +        +     S               F+       G  
Sbjct: 56  NPLWLAEGRGEMLAERGQANAGPNASWLGAVESWDDETPLDADEIELPFYKEIELSGGKG 115

Query: 115 WNTVGVPEIRSPHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
              +     R    G Y +                  SM P+   G  + ++++ +    
Sbjct: 116 STVILQTGGRKLRFGKYTLRKKNIDPASAACVTVSGNSMEPVLPDGSTVGVDTSARTIRD 175

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
             +      G +  K+L    G  + + S N   +P +  E  +    I  I R+ W S
Sbjct: 176 GDMYAFDHDGQLRVKLLYRLPGGGLRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|49081996|gb|AAT50398.1| PA0906 [synthetic construct]
          Length = 238

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 69/239 (28%), Gaps = 30/239 (12%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ + I    +  +L+   LA+  G+  TS +  +R           T  + +I  A   
Sbjct: 2   ELKDRIKAARKHAHLSQVQLAQAVGMTQTSISDLERGKSRA------TSFVAQIAGACGV 55

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNK 114
               L +          +        +     S               F+       G  
Sbjct: 56  NPLWLAEGRGEMLAERGQANAGPNASWLGAVESWDDETPLDADEIELPFYKEIELSGGKG 115

Query: 115 WNTVGVPEIRSPHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
              +     R    G Y +                  SM P+   G  + ++++ +    
Sbjct: 116 STVILQTGGRKLRFGKYTLRKKNIDPASAACVTVSGNSMEPVLPDGSTVGVDTSARTIKD 175

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
             +      G +  K+L    G  + + S N   +P +  E  +    I  I R+ W S
Sbjct: 176 GDMYAFDHDGQLRVKLLYRLPGGGLRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|15596103|ref|NP_249597.1| transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|107100364|ref|ZP_01364282.1| hypothetical protein PaerPA_01001389 [Pseudomonas aeruginosa PACS2]
 gi|116048830|ref|YP_792370.1| transcriptional regulator [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893125|ref|YP_002441994.1| putative transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|254239258|ref|ZP_04932581.1| hypothetical protein PACG_05450 [Pseudomonas aeruginosa C3719]
 gi|296390740|ref|ZP_06880215.1| putative transcriptional regulator [Pseudomonas aeruginosa PAb1]
 gi|313105790|ref|ZP_07792053.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
 gi|9946808|gb|AAG04295.1|AE004525_3 probable transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|115584051|gb|ABJ10066.1| probable transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126171189|gb|EAZ56700.1| hypothetical protein PACG_05450 [Pseudomonas aeruginosa C3719]
 gi|218773353|emb|CAW29165.1| probable transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|310878555|gb|EFQ37149.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
          Length = 237

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 69/239 (28%), Gaps = 30/239 (12%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ + I    +  +L+   LA+  G+  TS +  +R           T  + +I  A   
Sbjct: 2   ELKDRIKAARKHAHLSQVQLAQAVGMTQTSISDLERGKSRA------TSFVAQIAGACGV 55

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNK 114
               L +          +        +     S               F+       G  
Sbjct: 56  NPLWLAEGRGEMLAERGQANAGPNASWLGAVESWDDETPLDADEIELPFYKEIELSGGKG 115

Query: 115 WNTVGVPEIRSPHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
              +     R    G Y +                  SM P+   G  + ++++ +    
Sbjct: 116 STVILQTGGRKLRFGKYTLRKKNIDPASAACVTVSGNSMEPVLPDGSTVGVDTSARTIKD 175

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
             +      G +  K+L    G  + + S N   +P +  E  +    I  I R+ W S
Sbjct: 176 GDMYAFDHDGQLRVKLLYRLPGGGLRIRSFNSDEHPDERYEPQEAAEHINVIGRVFWYS 234


>gi|149186070|ref|ZP_01864384.1| putative transcriptional regulator, repressor [Erythrobacter sp.
           SD-21]
 gi|148830101|gb|EDL48538.1| putative transcriptional regulator, repressor [Erythrobacter sp.
           SD-21]
          Length = 212

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 74/220 (33%), Gaps = 13/220 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   S ++    +  + E+   + + L+   G +P+   +  R   +G  R        +
Sbjct: 1   MADMSPER--ARLVELTEKSRTSLASLSSILGRNPSYLQQFVR---KGSPRKLEEADRRR 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +         +L   P        +    +P L    S   G F +        +++   
Sbjct: 56  LAEFFGVDEVELGADPARPTPRESEDFVAVPRLALDASAGPGSFSAEEIS----FDSFRF 111

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                   G+       +  + +  SM P  R GD + ++       G+ + +      +
Sbjct: 112 SRRWLREMGL--DGADLSAIRVEGDSMEPTLRSGDEIFVDRNK--RVGEGVHVVRIGDTL 167

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
             K + +     I L+S N  Y    +   ++E I R++W
Sbjct: 168 HVKQVQASAPGRIALISANEAYAPIELARDEVEIIGRVVW 207


>gi|85709159|ref|ZP_01040225.1| transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85690693|gb|EAQ30696.1| transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 227

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/214 (14%), Positives = 71/214 (33%), Gaps = 5/214 (2%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +  +A+    + + L+   G + +   +  + G   +      + + +    +   + 
Sbjct: 14  QRLLDLAQERGASLASLSVLIGRNASYLQQFIKKGSPRKLEEGDRKVLAQFFGISEIELG 73

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-FDSGVFP-TGNKWNTVGVPEIRSPHN 128
               +      TT     +          + G     G  P     ++T           
Sbjct: 74  GTESVAQEISYTTGSGSADSTQWVVVQRLAIGASAGPGALPTEEAAFDTFRFSRRWLAEQ 133

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           G+     + +    +  SM PL   GD ++++   +    D + +      ++ K +   
Sbjct: 134 GL--SNAKLSAITVEGDSMEPLLNDGDEILIDRTERAFR-DGVHVVRLGETLMVKRVARA 190

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
                 L+S N  YP   V   ++E I R++W S
Sbjct: 191 GAGRFALLSQNLAYPPVEVAADELEIIGRVVWKS 224


>gi|327197613|ref|YP_004301304.1| gp28 [Brochothrix phage NF5]
 gi|296245436|gb|ADH03050.1| gp28 [Brochothrix phage NF5]
          Length = 232

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 67/236 (28%), Gaps = 22/236 (9%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  +K I   I +  + +N+T   LA K G+ P++ +             PS   I K
Sbjct: 1   MDTNRNKIISSNIKKYIKENNITQKELANKVGISPSTMSDYMNLRSN-----PSHGVIQK 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN---- 116
           I          +          +    +                           +    
Sbjct: 56  IADYFGILKSDIDTTYKEPNGISNIYSQLNEERQTKVYNYASRQLEEQNSNVTSIDKKKV 115

Query: 117 -----TVGVPEIRSPHNGIY-------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
                T   P   S  + +Y         +  D     Q  SM PL   G I+      +
Sbjct: 116 YVLGKTAANPTEVSYGDAVYDETIDTNVPRNADCALVIQGDSMEPLLHDGSIVFYKQQCE 175

Query: 165 VNCGDRLLIKPRTGDIVAKVLIS-RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           V  G+  ++      +  K +        + L SLN  Y    +    +  I +++
Sbjct: 176 VENGEIAILDIDGNGVTCKKVYFNYDDNIVILKSLNSKYDDRELSPERVRVIGKVV 231


>gi|282599559|ref|ZP_05970999.2| transcriptional regulator, Cro/CI family [Providencia rustigianii
           DSM 4541]
 gi|282568492|gb|EFB74027.1| transcriptional regulator, Cro/CI family [Providencia rustigianii
           DSM 4541]
          Length = 233

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 67/226 (29%), Gaps = 15/226 (6%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I + +     +  ++ + LA K G+   S  K +        R      I K +  + + 
Sbjct: 8   IAKRLLDARIKAGMSQADLAEKVGVSQQSIQKIEAGQTNSPRR---ISDIAKAVNVSAQW 64

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW-------NTVGVP 121
           +              E KE E                      G               P
Sbjct: 65  LQFGTRDGNGLKTEFEVKEWEDIPNCSDVDFVDIPVLDIELAAGGGSNAEIIESEEYTYP 124

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
             R          +     K    S+ P+   GD++ ++ + +      L        + 
Sbjct: 125 FRRDELRKYGVSASNARIVKIIGNSLYPVLNSGDLVAVDVSKRDIKDGDLYAIRDGVLLR 184

Query: 182 AKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
            K+L+ R    I + S N   YP + +  ++    +  I R+ W+S
Sbjct: 185 VKILVYRPDGGIIIRSFNKDEYPDEQLPRNEAAARVHVIGRVFWSS 230


>gi|238923636|ref|YP_002937152.1| SOS-response transcriptional repressor, LexA [Eubacterium rectale
           ATCC 33656]
 gi|238875311|gb|ACR75018.1| SOS-response transcriptional repressor, LexA [Eubacterium rectale
           ATCC 33656]
          Length = 213

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 67/225 (29%), Gaps = 24/225 (10%)

Query: 1   MTSFSHKKIW-EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M     K I+ E ++    +   T   +A+  G+ P +FN   +       R    +++ 
Sbjct: 1   MVKDKQKAIFSENLNSYIAKSEKTQLEIAKSIGVSPQTFNTWCKGIAI--PRMGKVQALA 58

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                    + +                K++ +   P          G    G     V 
Sbjct: 59  DYFNINKSDLIED---------------KKLNIDTVPIESGYTIPVLGRVAAGYGKEAVE 103

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
               +   +   A +        +  SM+P    GD +I+        GD ++      D
Sbjct: 104 EVIGQIEISPSMAAKGDYFGLLIKGDSMIPTLYDGDTVIVERTDDAESGDLVIALVNGSD 163

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARIL 219
              K L       I L+  N  Y       S+     ++ + +++
Sbjct: 164 ATCKRLQKY-AEGIALIPQNPVYEPMRFTESEIDTTPVKILGKVV 207


>gi|268595110|ref|ZP_06129277.1| transcriptional regulator [Neisseria gonorrhoeae 35/02]
 gi|268548499|gb|EEZ43917.1| transcriptional regulator [Neisseria gonorrhoeae 35/02]
          Length = 229

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 66/231 (28%), Gaps = 28/231 (12%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA---------- 63
               +  NL+   LA+ A +  ++    +    +      +   + KIL           
Sbjct: 2   KEARKNKNLSQENLAKLAEVSQSTIAALESGRNKKAT---NIAKLAKILDVSAFWLETGE 58

Query: 64  -----------ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                           +  +              +  + + Y   S   G   +   P  
Sbjct: 59  GSRNTPVLINPDLPHEVKDIHRPMMWSSNDPLPDDDYVFVPYLKESCFKGGAGAYEIPDY 118

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           N +    +P  +S                    SM     +   + +++        ++ 
Sbjct: 119 NGY---RLPFGKSTLRRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTGETAIRDGKIY 175

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
              + G    K LI + G S+ + S N   YP +T  +  +  I R+ W S
Sbjct: 176 AFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYPDETASLDSLTVIGRVFWRS 226


>gi|331685806|ref|ZP_08386387.1| transcriptional regulator, Cro/CI family [Escherichia coli H299]
 gi|324014328|gb|EGB83547.1| helix-turn-helix protein [Escherichia coli MS 60-1]
 gi|331077003|gb|EGI48220.1| transcriptional regulator, Cro/CI family [Escherichia coli H299]
          Length = 228

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 79/228 (34%), Gaps = 16/228 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    E+  ++ + LA K GL   S  K +    + + R    + I K+L  + 
Sbjct: 2   KTLAERLKSEREKAGMSQAQLAEKIGLSQQSVAKIENGETQ-QPR--KIKEIAKVLGVSQ 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-----VP 121
           + +   ++   S      K+ +   L     +             G     V       P
Sbjct: 59  KWLQLGIEDNASFPDLVVKEAESTALDPDIFANIPVLDVELSAGNGCLAEIVESTVDWFP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIKPRTGD 179
             R          +     K    S+LP+   GD + ++    + +  GD L        
Sbjct: 119 LRRIDLRKAGVCVSNAKIVKIWGNSLLPVLNNGDFVAVDVSQTVPIRDGD-LYAIRDGVL 177

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
           +  K+LI+     + L S N   YP + +   D    I  I R+ W+S
Sbjct: 178 LRVKILINLPDGGLILRSFNKDEYPDEILTFEDRRSRIHVIGRVFWSS 225


>gi|330999680|ref|ZP_08323389.1| peptidase S24-like protein [Parasutterella excrementihominis YIT
           11859]
 gi|329574186|gb|EGG55762.1| peptidase S24-like protein [Parasutterella excrementihominis YIT
           11859]
          Length = 226

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 72/218 (33%), Gaps = 8/218 (3%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           S K   + ++        +P+ +++  G+ P    K      +G    P  + +F + + 
Sbjct: 6   SQKTWTDRLNEALALRGKSPADISKATGITPAGIKKWI----DGDVSKPKFDDVFAVCSF 61

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
            + T   L+    S    T      + +      GS G              T+ V    
Sbjct: 62  LDITTEWLMKGIGSINDKTMPAANMVSIQQVDFYGSCGVGVMNFEDYPE-IKTLQVTPAW 120

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
              N  +              SM P  R GD + ++   +    D + +    G+   K 
Sbjct: 121 FSRNFAFYNPRDVKIITALGDSMEPEIRDGDAVFIDITDKETLRDGIYLLVVDGEAYIKR 180

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARIL 219
           +    G+ I L+S N  Y    + +    ++  I R++
Sbjct: 181 VQKLIGKKIALLSTNKAYKDIEISLDSDIEVRIIGRVI 218


>gi|261366571|ref|ZP_05979454.1| LexA repressor [Subdoligranulum variabile DSM 15176]
 gi|282571390|gb|EFB76925.1| LexA repressor [Subdoligranulum variabile DSM 15176]
          Length = 209

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/213 (11%), Positives = 65/213 (30%), Gaps = 17/213 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +    +    + + ++R  G+   +  K +          P  +++ ++         
Sbjct: 4   DRLKEARKAKKYSQAEISRMLGVTQQAVGKWETGRST-----PDPQTVARLAEIL----- 53

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
                        +   +   +  +  S         V      +  +   E        
Sbjct: 54  --DTTADVLLGLQKSPSEAPAVGRYAFSRYAECLIPVVGTVRAGYGALAFEEDYGKEYAS 111

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD-RLLIKPRTGDIVAKVLISRR 189
                       +  SM P    GD+ +++    ++ GD  +L+    G+   K  I +R
Sbjct: 112 VKDPQNYFYLVVKGDSMEPRISDGDLALVHRQNTLDNGDLGVLVYGADGEGTLKKYI-QR 170

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIE---WIARIL 219
           G S+ L   N  Y    ++  +++      +++
Sbjct: 171 GNSVVLHPFNPAYEELVIKGEELDHLYIAGKVV 203


>gi|296282441|ref|ZP_06860439.1| putative transcriptional regulator, repressor [Citromicrobium
           bathyomarinum JL354]
          Length = 231

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 72/214 (33%), Gaps = 5/214 (2%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET-I 69
             +  +A+    + + L++    + +   +  R G   +       ++ +         +
Sbjct: 18  ARLLELAQARGSSLAALSKLIDRNSSYLQQFIRKGSPRKLEEQDRRTLAQFFGVDESELV 77

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK-WNTVGVPEIRSPHN 128
            ++          +     +      P          G F  G   ++  G        N
Sbjct: 78  PEMSGAEEKSYGASRFSAGDEDFHAIPRLSLAAAAGPGQFANGEAPFDNFGFSGRWLREN 137

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           G        +    +  SM PL R GD ++++   +    D + +      ++ K L S 
Sbjct: 138 GF--DPKMLSALTVEGDSMEPLLRHGDEILIDRGSRFER-DGVHVVRMGDTLMVKRLASA 194

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
               I L+S N  YP   V + +IE + R++W S
Sbjct: 195 GAGRIALLSQNLAYPPVEVGLDEIEVLGRVVWKS 228


>gi|161525013|ref|YP_001580025.1| putative phage repressor [Burkholderia multivorans ATCC 17616]
 gi|160342442|gb|ABX15528.1| putative phage repressor [Burkholderia multivorans ATCC 17616]
          Length = 270

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/235 (14%), Positives = 72/235 (30%), Gaps = 21/235 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPS-----------TES 57
           + + +    E  +L+ + LA +AG+  T+    +    +G     S            ES
Sbjct: 28  LAQRLRDTREEKSLSQAQLATRAGVSQTTIANVESGRNQGSKHLLSIARALGVNPAWLES 87

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
                 A+     Q       + +      +    L    +          F  G     
Sbjct: 88  ESGPKDASAAAAPQPGIYKIPEDQGNVLVWEHPDDLPPDENRVWLDRYDYRFSAGTGLIQ 147

Query: 118 VG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
                   +P        + +        +    SM P     D++++++A       ++
Sbjct: 148 WEVRQKKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTAKNHIRDGKV 207

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEM---SDIEWIARILWAS 222
                 G+ + K +  + G SI L S+N   YP   V       +  +  +++ S
Sbjct: 208 YAIYFEGEPLVKQIFKQAGGSICLHSINAGKYPDKIVTPELMESVTIMGEVIYRS 262


>gi|146308997|ref|YP_001189462.1| putative phage repressor [Pseudomonas mendocina ymp]
 gi|145577198|gb|ABP86730.1| putative phage repressor [Pseudomonas mendocina ymp]
          Length = 240

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 32/224 (14%), Positives = 72/224 (32%), Gaps = 16/224 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + + + R+ +   ++   LA + G      ++S+    E   R PS   +  I  A  
Sbjct: 2   ETLGQRLKRLRKAKGMSQQALAEECGWA----SQSRIGNYEADLRAPSLSDLLLIAPALG 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK-----------W 115
            ++ +L       G    + + +   +            +                   +
Sbjct: 58  VSLAELAGSDEWTGAYGVQVQVKNHQVRESVGAETIEAGTAKEGAVPVVGNAKLGTDGYF 117

Query: 116 NTVGVPEIR-SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
             V  P      +  I++        K    SM P  + G+ +++        GD +++K
Sbjct: 118 EAVDFPVGHGDGYLLIHSDDPNAYGLKVLGDSMHPRIKNGEYVLIEPNKVFTSGDEVMVK 177

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            + G  + K  I  R       S+N  +    +    I+ I  +
Sbjct: 178 TKDGQAMIKEFIYLRDGMYRFDSVNQSHQPIHLPEDAIDKIHLV 221


>gi|251772691|gb|EES53255.1| putative phage repressor [Leptospirillum ferrodiazotrophum]
          Length = 227

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 28/221 (12%), Positives = 61/221 (27%), Gaps = 9/221 (4%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA---T 65
           + + +     +  L+ + L+ K+G+   + +  +    +             I      T
Sbjct: 4   LGDRLKEARTKRKLSQTALSEKSGVPQQTIHAIENKKAKSTGHLFPLAKALHINPEWLST 63

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
            E   +   L  S            P      + + G        +      V       
Sbjct: 64  GEGEMERKPLEESFLGEPASPGYGAPFSIPVFAITAGMGRGRFLDSEQVLKIVVFDPATL 123

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
               +               SMLP      I+ ++   +    D + +      I  K L
Sbjct: 124 RDMNLSGSVHGIVAVYADGESMLPTIPPKSIVFVDRNQRDLR-DGVYLVRLEEMIYVKRL 182

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEM---SDIEWIARI--LWA 221
                  + ++S N  Y    V++    D E + ++  +W 
Sbjct: 183 QRLPNHKVKVISDNPVYQPFEVDLKNGDDFEILGKVLRVWI 223


>gi|170080892|ref|YP_001730212.1| repressor protein CI [Escherichia coli str. K-12 substr. DH10B]
 gi|133351|sp|P14819|RPC1_BPPH8 RecName: Full=Repressor protein CI
 gi|14804|emb|CAA31471.1| unnamed protein product [Enterobacteria phage phi80]
 gi|169888727|gb|ACB02434.1| repressor protein CI [Escherichia coli str. K-12 substr. DH10B]
          Length = 236

 Score =  111 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 66/233 (28%), Gaps = 25/233 (10%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I  +  R  L    LA      P + N   +          S E+  +I      +
Sbjct: 4   ISERIKFLLAREGLKQRDLAEALSTSPQTVNNWIKRDA------LSREAAQQISEKFGYS 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPS-----------GSGGFFDSGVFPTGNKWNT 117
           +  LL+   S  +  E             +               F     F  G+    
Sbjct: 58  LDWLLNGEGSPKKDLESNIPPESEWGTVDAWDKNTPLPDDEVEVPFLKDIEFACGDGRVH 117

Query: 118 VG--------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
                       +      G  +  +          SM P+   G  + +++  +     
Sbjct: 118 DEDHNGFKLRFSKATLRRVGANSDGSGVLCFPASGDSMEPVIPDGATVAVDTGNKRVIDG 177

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
            L    +      K L  + G  I + S+N  Y  +  + +D+E I  + W S
Sbjct: 178 ELYAINQGDLKRIKQLYRKPGGKILIRSINRDYDDEEADEADVEIIGFVFWYS 230


>gi|224825138|ref|ZP_03698244.1| putative phage repressor [Lutiella nitroferrum 2002]
 gi|224602809|gb|EEG08986.1| putative phage repressor [Lutiella nitroferrum 2002]
          Length = 227

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/226 (14%), Positives = 74/226 (32%), Gaps = 20/226 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   +  +     ++   L+ K G+   S             R PS +++ KI+A+    
Sbjct: 3   VSARLGHVIAEKGMSIKALSEKTGIPYRSLQNYFSGE-----REPSFDNLRKIVASLGVD 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS---GVFPTGNK---WNTVGVPE 122
               L    +       +     +   P   S   F          GN     +   +  
Sbjct: 58  ANWFLFGENAQTGVFAAEVGVSDVKGHPVDLSEYVFIPRYRVQASAGNGRVLSDEDYMHS 117

Query: 123 IRSPH----NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +        N ++A          +  SM P  +  D+++L+++ +    + + +     
Sbjct: 118 MAFRRYWVSNYLHAEPANLAIISVEGDSMEPTLKDHDVIMLDTSRRDPNVEGIYVLRLDD 177

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVE----MSDIEWIARILW 220
            ++ K +       I + S N  YP   V+      D+  I +++W
Sbjct: 178 ALLVKQVQRIP-GKIRVSSANPAYPPFDVDLSNPAEDVAIIGKVVW 222


>gi|319789030|ref|YP_004150663.1| transcriptional regulator, XRE family [Thermovibrio ammonificans
           HB-1]
 gi|317113532|gb|ADU96022.1| transcriptional regulator, XRE family [Thermovibrio ammonificans
           HB-1]
          Length = 222

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 78/212 (36%), Gaps = 9/212 (4%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E + ++ E   L+ S +A++ G+   ++ + ++ G +   R     ++ +I A  N  
Sbjct: 3   VNERLRKLREHLGLSQSKMAKELGVSLKTYQRYEQVGYDIPER-----ALRQIEATFNVN 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              L        R   + +      +              F  G     +  P+      
Sbjct: 58  PEWLRQGKGEMFRPKTEAQIIATPEFVVKPIPLIAEGEAGF--GQFIPNLVEPDKVVWFP 115

Query: 129 GIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
              ++   +    K    SM P   +GDI++++    V  GD +    + G +V K    
Sbjct: 116 VPTSLANHRLFFIKVVGNSMEPRIFEGDIVLVDKDATVGKGDLVAALLKDGTLVVKRYWK 175

Query: 188 RRG-RSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             G  ++ L S+N  YP   V   ++  IA +
Sbjct: 176 NNGDGTVVLESINPSYPPIVVRPKELRDIALV 207


>gi|197105225|ref|YP_002130602.1| SOS-response transcriptional repressor, LexA [Phenylobacterium
           zucineum HLK1]
 gi|229621740|sp|B4RBX6|LEXA_PHEZH RecName: Full=LexA repressor
 gi|196478645|gb|ACG78173.1| SOS-response transcriptional repressor, LexA [Phenylobacterium
           zucineum HLK1]
          Length = 229

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 59/223 (26%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQHELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHRLITALEERGFLRRLPHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNT 117
            + L             P       + +  E        +         G    G     
Sbjct: 61  ARALEVVRLPQQATAAAPPKGRAPFKPQLVEAGQAMPVAANDTRELPILGKIAAGTPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           +     R P         +    + Q  SM+      GD +++      N GD ++    
Sbjct: 121 IQQERDRLPVPEAMLGAGEHFVLEIQGDSMINAGILDGDFVVIRRTDSANSGDIVVALVD 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K L  +   SI L + N  Y         +    R++
Sbjct: 181 GEEATLKRLRKKGA-SIALEAANPAYETRIFGPDRVAVQGRLV 222


>gi|156523050|ref|YP_950425.2| putative c repressor [Pseudomonas phage DMS3]
 gi|156513709|gb|ABG66655.2| putative c repressor [Pseudomonas phage DMS3]
          Length = 236

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 79/215 (36%), Gaps = 12/215 (5%)

Query: 11  EAIDRMAERHNL--TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
             I+R+     +  + S LAR AG+      +  + G       P+   +  +  A   +
Sbjct: 23  AFIERLRSIVAIAGSASALARNAGISQGGLQRYLKGG------EPTRRVLISLAKAAGVS 76

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +  L+    S     ++       +Y P   +      G +  G    T  +   R   +
Sbjct: 77  LGWLMTGEGSQKPEEQEATGSDQYVYVPLYDARVSAGHGSWSEGAHVLT-QLAFTRYSLS 135

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                 T+ +  +    SM PL   GD ++++  ++    + + +      + AK L  +
Sbjct: 136 KKGLEPTRMSAVRVGGDSMEPLLSDGDAVVIDHDLRTVRDEAIYVIRVGDQLYAKRLQRQ 195

Query: 189 RGRSIDLMSLNCCYPVDTVEMS---DIEWIARILW 220
              SI ++S N  Y    V      D++ I R++W
Sbjct: 196 FDGSIAIISENKAYKDMVVPKDQLSDLDIIGRVVW 230


>gi|85374557|ref|YP_458619.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
 gi|84787640|gb|ABC63822.1| putative transcriptional regulator, repressor [Erythrobacter
           litoralis HTCC2594]
          Length = 220

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 69/212 (32%), Gaps = 7/212 (3%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +  +A+   +  S L+   G + +   +  R    G  +         +         +
Sbjct: 12  RLLELAQEKGVGLSKLSALIGRNSSYLQQFVRR---GSPKKLEEGDRRLLAEFFGVDESE 68

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP-TGNKWNTVGVPEIRSPHNGI 130
           L          +     +   +  P          G F    + ++  G        +G 
Sbjct: 69  LGANKEKSYNASPSLLADEDFVAIPRLSIAVAAGPGQFAGDESPFDNFGFSGRWLRDHGF 128

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
                  +    +  SM PL R GD ++++ +         +++     ++ K L     
Sbjct: 129 --DPKMLSSVTVEGDSMEPLLRDGDEILVDRSPGPLRDGIHVVR-LGETLMVKRLSRSGQ 185

Query: 191 RSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             I L+S N  YP   + + D+E I R++W S
Sbjct: 186 GRISLLSQNLAYPPLDMALEDVEVIGRVVWKS 217


>gi|253582988|ref|ZP_04860206.1| peptidase [Fusobacterium varium ATCC 27725]
 gi|251835194|gb|EES63737.1| peptidase [Fusobacterium varium ATCC 27725]
          Length = 229

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 65/220 (29%), Gaps = 15/220 (6%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    + + LA+  G+  + +N  +R  +         + +  IL  T +   +
Sbjct: 6   FLRNRREEMGYSQNKLAKAIGITQSYYNTIERGEVRNPPSEEILDKMIAILQLTTKEAAE 65

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----------GVFPTGNKWNTVGV 120
              L   +   T   E+   L     +                        G    T   
Sbjct: 66  FKYLAAIERTPTLILEELKKLEKQKDATPKVNVSELKDLDNYIPLYSRISAGIGVFTEEA 125

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       G+  ++        +  SM P  +   I++    ++V  G+         + 
Sbjct: 126 PVDFISIPGVRNVE-TLFAVNVKGDSMEPTIKNSSIILCRKGVEVRNGEIGAFIVN-EES 183

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
             K L    G  I L+S N  Y    +    +   + ++L
Sbjct: 184 YVKRL-KVTGNYIALISDNPNYQPIYIGPGEEFSVVGKVL 222


>gi|160873890|ref|YP_001553206.1| putative phage repressor [Shewanella baltica OS195]
 gi|160859412|gb|ABX47946.1| putative phage repressor [Shewanella baltica OS195]
          Length = 240

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 70/232 (30%), Gaps = 21/232 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + + I    +   +T   L    G+   +  + ++         P   ++F +  +  
Sbjct: 11  KTLGQRIREKRKELGITQKALGALVGVSAVAVTQWEKDET-----APKGANLFALAKSLK 65

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYF------PPSGSGGFFDSGVFPTGNKW-NTVG 119
             +  LL+   +    +  +      L+              F+       G      V 
Sbjct: 66  CDLSWLLNGQVAAKPESNAEWAGGFDLWDNDSPLGEDEVEIPFYVDIELSAGEGIAEGVE 125

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   +S               K    SM P+   G  + ++++       ++   
Sbjct: 126 YKGPKLRFAKSSLKRQGVNTDHAACVKVNGNSMEPVLPHGSTVGVDTSATEIIDGKMYAI 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD---IEWIARILWAS 222
              G +  K+L    G  + L S N   +P + +       I+ I ++ W S
Sbjct: 186 NHDGMMRVKMLYKLPGGGLRLRSYNLDEWPDEHISHEQLKHIKIIGKVFWYS 237


>gi|189350245|ref|YP_001945873.1| putative bacteriophage repressor protein CI [Burkholderia
           multivorans ATCC 17616]
 gi|189334267|dbj|BAG43337.1| putative bacteriophage repressor protein CI [Burkholderia
           multivorans ATCC 17616]
          Length = 246

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/235 (14%), Positives = 72/235 (30%), Gaps = 21/235 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPS-----------TES 57
           + + +    E  +L+ + LA +AG+  T+    +    +G     S            ES
Sbjct: 4   LAQRLRDTREEKSLSQAQLATRAGVSQTTIANVESGRNQGSKHLLSIARALGVNPAWLES 63

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
                 A+     Q       + +      +    L    +          F  G     
Sbjct: 64  ESGPKDASAAAAPQPGIYKIPEDQGNVLVWEHPDDLPPDENRVWLDRYDYRFSAGTGLIQ 123

Query: 118 VG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
                   +P        + +        +    SM P     D++++++A       ++
Sbjct: 124 WEVRQKKALPFDIGFFRALGSKPKDCKLVRVHGDSMEPYLFDRDMIMVDTAKNHIRDGKV 183

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEM---SDIEWIARILWAS 222
                 G+ + K +  + G SI L S+N   YP   V       +  +  +++ S
Sbjct: 184 YAIYFEGEPLVKQIFKQAGGSICLHSINAGKYPDKIVTPELMESVTIMGEVIYRS 238


>gi|77164141|ref|YP_342666.1| peptidase S24, S26A and S26B [Nitrosococcus oceani ATCC 19707]
 gi|254435083|ref|ZP_05048590.1| Peptidase S24-like domain protein [Nitrosococcus oceani AFC27]
 gi|76882455|gb|ABA57136.1| phage repressor protein, Serine peptidase, MEROPS family S24
           [Nitrosococcus oceani ATCC 19707]
 gi|207088194|gb|EDZ65466.1| Peptidase S24-like domain protein [Nitrosococcus oceani AFC27]
          Length = 225

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 85/231 (36%), Gaps = 25/231 (10%)

Query: 1   MTSFSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTES 57
           MT   H +I    ++ +      + + LAR AG + +  ++ +      +G  R    E 
Sbjct: 1   MT-LKHNQIRLHNLEVLITEAG-SAAKLARMAGTNSSYLSQVRNQLPTKKGTPRSIGDEL 58

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKE--------IPLLYFPPSGSGGFFDSGVF 109
             K+  A  +    +  LP       E+             PL+ +  +G+         
Sbjct: 59  AGKLEKAMKKPQGWMDTLPADGTTPQEENNAHDGPDLRSLHPLISWVQAGNWYEVSESFV 118

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
           P       +  P   SP         +    + + +SM P + + D++ ++  +  + G 
Sbjct: 119 PA-YGSELLPCPVRCSP---------ESFVLRVRGSSMEPKFHEDDLIFVDPNVSADHGK 168

Query: 170 RLLIKPRT-GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++++     +   K LI   G+   L +LN  +P   +E+ +   I  ++
Sbjct: 169 YVVVRLDESNEATFKQLIIEDGKQY-LKALNPDWPNRIIEVDEEATICGVI 218


>gi|83858367|ref|ZP_00951889.1| LexA repressor [Oceanicaulis alexandrii HTCC2633]
 gi|83853190|gb|EAP91042.1| LexA repressor [Oceanicaulis alexandrii HTCC2633]
          Length = 227

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 64/222 (28%), Gaps = 5/222 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I++      ++PS    K  L+  S +   R       R         
Sbjct: 1   MLTKKQHELLLYINKRLSEDGVSPSFDEMKEALNLASKSGVHRLVSALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + L           + P          +    +     S        G    G     +
Sbjct: 61  ARALEVLKLPQGGSGNSPAPSKTNVVSADFGSSV-SDERSHGVEVPVLGRIAAGVPIEAI 119

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                R P         +    +    SM       GD++I+      N GD ++     
Sbjct: 120 QHETDRLPVPAEMISGGEHFALEVHGDSMIEAGILDGDLVIIKRGDTANTGDIVVALVHD 179

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +   K L  ++G SI L + N  Y       ++++   R++
Sbjct: 180 EEATLKKL-RKKGGSIALEAANPAYETRIFGPNEVKVQGRLV 220


>gi|260868456|ref|YP_003234858.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
 gi|257764812|dbj|BAI36307.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
          Length = 229

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 54/203 (26%), Gaps = 8/203 (3%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             I  M +    + + LARK G+   S             R      +  I         
Sbjct: 9   NRIAMMLKTKGWSQAELARKLGVSAQSVQYWTTGKT--FPRSDKLAQLSVISGYPQSWFL 66

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN---TVGVPEIRSPH 127
                            ++  +              G    G+  +   ++ +    +  
Sbjct: 67  GEDASSTFSSAEKHHTREDSVVFNVLDVEFS--CGDGTHVRGDLIDVVRSIELDPEYARR 124

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                          +  SM P    GD+L L+  +    GD +      G+   K L  
Sbjct: 125 LVGNRAFKNIEIGNARGDSMAPTISPGDLLFLDKTVTYFDGDGIYAFCFDGECYVKRLQK 184

Query: 188 RRGRSIDLMSLNCCYPVDTVEMS 210
             G  I ++S N  Y   ++E  
Sbjct: 185 I-GSKIMVLSDNPNYQPWSIEKE 206


>gi|89054365|ref|YP_509816.1| LexA repressor [Jannaschia sp. CCS1]
 gi|122999507|sp|Q28R71|LEXA_JANSC RecName: Full=LexA repressor
 gi|88863914|gb|ABD54791.1| SOS-response transcriptional repressor, LexA [Jannaschia sp. CCS1]
          Length = 228

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/223 (12%), Positives = 61/223 (27%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   + + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQRDLLEFIHKRMQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +                     ++       +    + +      G    G     +
Sbjct: 61  ARAIEIVKMPDAMTGGGFEPRVIDGDRGPAPANAMAVRAAPAREVPVMGQIAAGVPIEAI 120

Query: 119 GVPEIRSP-HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
                       +          + +  SM+      GDI+++      + GD ++    
Sbjct: 121 SQVASHVAVPEQMLGAGGNHYALEVKGDSMIDAGINDGDIVVIEEGNTADNGDIVVALVE 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K L  + G  I L + N  Y         ++   +++
Sbjct: 181 DHEATLKRLRRK-GGMIALEAANPAYETRVFRDDQVKVQGKLV 222


>gi|296136472|ref|YP_003643714.1| putative phage repressor [Thiomonas intermedia K12]
 gi|295796594|gb|ADG31384.1| putative phage repressor [Thiomonas intermedia K12]
          Length = 224

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 74/224 (33%), Gaps = 11/224 (4%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             + K++  AI+    +  ++   LAR   + P S       G   ++R     ++F+  
Sbjct: 1   MLTGKELGAAIEAARLKKGVSKVTLARAMEIKPPSVQDWIHHGRVAKSR---LGALFQYF 57

Query: 63  AATNETICQLLDLPFSDGRTTE--KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +         +   +    +         +P      +   G +       G       +
Sbjct: 58  SDVVGPEHWGVREEWGYNPSLRIVDGMVTLPQYDLKAAAGPGRYLEAQLRVGAVQVCQDI 117

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                 ++G+    T          SM P    GDI++++ +++    D + +     + 
Sbjct: 118 VARILRNSGV--ALTSLALVTVAGDSMEPTINDGDIVVIDRSVETIDRDGVYLFTFGDET 175

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARILWA 221
             K +     +S+ + S N  Y    +   +   +    R++WA
Sbjct: 176 FIKRIQRMP-KSLSVNSDNGLYKGWEISSEETSSLHVHGRVIWA 218


>gi|217975711|ref|YP_002360310.1| putative phage repressor [Shewanella baltica OS223]
 gi|217501061|gb|ACK48948.1| putative phage repressor [Shewanella baltica OS223]
          Length = 231

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/214 (11%), Positives = 69/214 (32%), Gaps = 13/214 (6%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + ++      +     R+ G+  ++ ++ +    + R ++     I KI+        
Sbjct: 25  RNLKQLRIDLGFSQEEFGRRIGVTKSTISQWEAGKSQARRKF-----IKKIIETF----- 74

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG--VPEIRSPHN 128
           +L D  F      E                  F+       G+ +         I     
Sbjct: 75  ELEDNYFDIVDREEANVDSCKSNCESSFKRIPFYSDVKVAAGSGYCNREEVYELILVKDL 134

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
              +   +         SM P  + G +++++    V    ++ +  +   +  K     
Sbjct: 135 PALSNYKKLFCITVTGDSMEPALKDGSLIVVDPTQTVVRDGKIYVFRQGDVLRVKAFSYE 194

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
           + + +   S N  Y  +   + ++E + R++++S
Sbjct: 195 K-QMVKAKSYNEFYKDELYRLDELELLGRVVFSS 227


>gi|329115279|ref|ZP_08244034.1| Phage Repressor [Acetobacter pomorum DM001]
 gi|326695722|gb|EGE47408.1| Phage Repressor [Acetobacter pomorum DM001]
          Length = 214

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 87/231 (37%), Gaps = 29/231 (12%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
               ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R    G  RWP+  S+ + L
Sbjct: 1   MIPAERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGHGVWRWPALPSLLRAL 60

Query: 63  AATNETICQLLDLPFSDGRTT---EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                ++ Q     +   +           +  L       GG  D    P G  W    
Sbjct: 61  DVLRVSLAQFEAHLWGYEQPDGAKTPAPCFMRSLPLSWLDQGGVLDRAGLPAGGLWEQEE 120

Query: 120 VPEIRSPHNGIYAIQ-TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
                      +++  +     +     M P+ R G  L++  A+     DR+++     
Sbjct: 121 T---------FFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALHPRGADRVVLIRAGQ 171

Query: 179 DIVAKVLISRRGRSID------LMSLNCCYPVDTVEMSDI-EWIARILWAS 222
             V  +L  +  R+I       L           V  +    W+ RI+  S
Sbjct: 172 APVVGILQEKPVRAIQPFGRSALQP---------VPAAAAGVWLHRIVLIS 213


>gi|153000490|ref|YP_001366171.1| putative phage repressor [Shewanella baltica OS185]
 gi|151365108|gb|ABS08108.1| putative phage repressor [Shewanella baltica OS185]
          Length = 263

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/236 (14%), Positives = 75/236 (31%), Gaps = 20/236 (8%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
             + I + I    +   LT   +A    + P+S  + +      + +  +  ++ K L  
Sbjct: 23  QGEMIGDRIRSRRKELKLTQKNVAETVKVTPSSITQWELGMSTPKGK--NLINLSKALNC 80

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG--------GFFDSGVFPTGNKWN 116
           + E +    +   +   T E   +           +          F+       GN   
Sbjct: 81  SPEWLLSGKEDNQARVSTVESNAEWHAGFDLWDGDTPLRDDEVALPFYREVELAAGNGST 140

Query: 117 TVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            V       +   +S                    SMLP+ + G  + ++++ +     +
Sbjct: 141 FVQENGGCKLRFAKSTLKKSNVDPQYAACVTVSGDSMLPVLQDGTTVGVDTSKKNIIDGK 200

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARILWAS 222
           +      G +  K+L    G  I + S N   YP + ++      I+ I  + W S
Sbjct: 201 MYAIDHDGMLRVKILYRMPGGGIRIKSYNNDEYPDEFIQPEQMSNIKIIGWVFWWS 256


>gi|226940913|ref|YP_002795987.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
 gi|226715840|gb|ACO74978.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
          Length = 262

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/237 (14%), Positives = 74/237 (31%), Gaps = 30/237 (12%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++   +  + +  N++ +  A   G+  ++    +        R P    +   +     
Sbjct: 27  ELGARLKEVRKARNVSRNEAAAAVGVSVSTMQAWEAGE-----REPDATKLSSFVRHYGV 81

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFP-------------PSGSGGFFDSGVFPTGNK 114
               LL       +     + E P                           +     G+ 
Sbjct: 82  RADWLLFGDGGMFKPAAPTQAESPRSEVDCPCLDTLGNPVNLQDFVFIPRYNLKASAGHG 141

Query: 115 WNTVGVPEIRSPHNGIYAI-------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
            +  G   I S     Y I           +    +  SM  +    D++++N A     
Sbjct: 142 LDANGEKPIFSMAFRRYWIDNFLRIDPHDLSVLSVKGDSMEGVLNDRDVILINHADNA-P 200

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI----EWIARILW 220
            D L +    GD+V K L  + G  I ++S N  Y    ++++D+      + R++W
Sbjct: 201 KDGLYVLRIDGDLVVKRLQRKPGGKIGIISANEAYAPYDIDLNDLPNDFAIVGRVVW 257


>gi|145298596|ref|YP_001141437.1| phage repressor [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851368|gb|ABO89689.1| phage repressor [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 227

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 75/219 (34%), Gaps = 20/219 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF------KIL 62
           I + I       NL+ + LA+  G+   S  K +    + + R+ +  +         +L
Sbjct: 3   ISDRIFSRRTALNLSKTALAKAIGVSDVSVGKWESGLNQPKGRYLNDLAAALGVTVDWLL 62

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           A + +   Q +    +       + + IP++ +  +G+                 V    
Sbjct: 63  AGSGDGPEQPIPGYHNVEPAVIPQGRRIPVISYVHAGNWREMCEQATTFDGNVEYVTASV 122

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
              P                +  SMLP +++GD++I++       GD ++ +    +   
Sbjct: 123 DIGP---------CGFGLWMRGDSMLPQFKEGDLIIVDPDEVPQPGDYVVARNGNNEATF 173

Query: 183 KVLISRRGRS-----IDLMSLNCCYPVDTVEMSDIEWIA 216
           K    R          +L+ LN  YP    +   I+ I 
Sbjct: 174 KKYRPRGVDENGQEVFELVPLNDDYPSMHSDRQHIQIIG 212


>gi|163795623|ref|ZP_02189589.1| LexA repressor [alpha proteobacterium BAL199]
 gi|159179222|gb|EDP63755.1| LexA repressor [alpha proteobacterium BAL199]
          Length = 241

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/236 (12%), Positives = 57/236 (24%), Gaps = 18/236 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +    ++   I +  E   ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQHELLAFIQKRIEESGVSPSFDEMKDALDLKSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  ---------STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF 104
                    + + + +   +                                   S    
Sbjct: 61  ARALEVLRTADQVVARGARSDRPAARGFTPNVIPGNFPFRGDPPVAAPTPGEGPESIDLP 120

Query: 105 DSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAI 163
             G    G     +  P           +       +    SM+      GD +I+    
Sbjct: 121 MYGRIAAGTPIEALRDPSTSIAVPASMLVGGDHYALEVSGDSMIDAGILDGDTIIIRQCD 180

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               G  ++      +   K L  + G+SI L   N  Y         ++   +++
Sbjct: 181 TAENGSIVVALVDEQEATLKRLRRK-GQSIALEPANSAYETRIFGPDRVKVQGKLV 235


>gi|227514731|ref|ZP_03944780.1| possible repressor lexA [Lactobacillus fermentum ATCC 14931]
 gi|227086935|gb|EEI22247.1| possible repressor lexA [Lactobacillus fermentum ATCC 14931]
          Length = 212

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 76/217 (35%), Gaps = 22/217 (10%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           S++++ + ++ + ++  ++ S LARK  +  ++ ++       G+ ++P           
Sbjct: 10  SNEEVIKYLNELRKQQKISISELARKVDMSKSTVSQYFN----GKLQFP-LNRAHDFARV 64

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
              T   LL L  S      +       L   P          +    N  + +  P   
Sbjct: 65  LGVTTDDLLGLDLSKVNPINR-------LTKIPLLGTIACGDPILADENITDYLTEPVD- 116

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAK 183
                 Y    +    + +  SM P  + G ++++    +V  G+   ++     +   K
Sbjct: 117 ------YLPSGKLFYLRAKGQSMEPTIKNGSLVLIRQQPEVEDGEIAAVLFTDDDEATLK 170

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
            +    G ++ L+  N  Y    V   + +  + + +
Sbjct: 171 RVKR-SGDTMILLPDNRRYEPIIVSKDNPVRILGKAV 206


>gi|154148443|ref|YP_001405854.1| hypothetical protein CHAB381_0248 [Campylobacter hominis ATCC
           BAA-381]
 gi|153804452|gb|ABS51459.1| conserved hypothetical protein [Campylobacter hominis ATCC BAA-381]
          Length = 233

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 75/234 (32%), Gaps = 30/234 (12%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++   I ++ +    T   LA  +G+   S    +      + +  +TE++ KI  A + 
Sbjct: 2   ELSNRIKQLRDIKGWTQQELADYSGVSIDSIKGYE----SKKTKNITTENLNKIAKAFDL 57

Query: 68  TICQLLDLPFSDGRTTEKK--------------EKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            I    +   S     +                     L     + S  +FD      G 
Sbjct: 58  NISNFYNNDLSVSEIEKCPLGVHKSSVSDKKSVVTPPNLKMSQDNFSVPYFDDVYASAGG 117

Query: 114 KWNTVGVPEIRSPHNGIYAIQ-------TQDTRHKTQDTSMLPLYRKGDILILNSAIQVN 166
            +     P      +  +          ++    K++  SM P   K  +L +     V 
Sbjct: 118 GYINDENPPKMIEFSKSFLRDYLGTVEFSRLNIIKSKGDSMEPTIPKNALLFIRLG-DVE 176

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
            G   + +    ++  K L  R    + L+S N  Y   T++  +  E I  ++
Sbjct: 177 EGQICVARID-DELYVKRLQKRP--VVKLISDNPDYDPITLQPDENFEIIGCVI 227


>gi|315268235|gb|ADT95088.1| transcriptional regulator, XRE family [Shewanella baltica OS678]
          Length = 204

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 72/214 (33%), Gaps = 19/214 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I E + R+ +   +T   LA       TS  K +R   +   R  + E++ K L  T  
Sbjct: 2   DIAERVKRLRKALGMTQYELADLVSTAQTSIQKLERGDTK-NPR--NIEALAKALQTTP- 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
              + L     +             L        G +                P   S H
Sbjct: 58  ---EFLRFGVGELDNATVVASAGNYLPLISMVQAGVWTEIQELPPLDVELYPCPIKCSQH 114

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLI 186
                        + +  SMLP + +GD++ ++   QV  G  ++ +         K LI
Sbjct: 115 ---------SFIVRVEGESMLPRFEEGDLIYVDPDAQVENGSYVVARLDDENQATFKQLI 165

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
               +   L +LN  +P   VE++ +   + +++
Sbjct: 166 IDGNKKY-LKALNPDWPNKFVEINGNCTIVGKVV 198


>gi|326795087|ref|YP_004312907.1| phage repressor like transcriptional regulator, XRE family
           [Marinomonas mediterranea MMB-1]
 gi|326545851|gb|ADZ91071.1| phage repressor like transcriptional regulator, XRE family
           [Marinomonas mediterranea MMB-1]
          Length = 216

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 61/216 (28%), Gaps = 13/216 (6%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I E +        LT + LA K G+   S  K +    + R   P    +  +  A   
Sbjct: 2   NIAERVKTQRIHLGLTQTELANKVGISQQSLQKIE----DARTSNPR--KLLALAKALEC 55

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           T   L            +   E      P                   +   + +     
Sbjct: 56  TPEWLQFGIEGVSSGEAESNVEAAPFKAPSKKLPVVSHVQAGAWSEAIDYRSLADDIEWE 115

Query: 128 NGIYAIQTQDTRHKTQDTSML----PLYRKGDILILNSAIQVNCGDRLLIKPR-TGDIVA 182
              ++        K    SM         +G +++++  I  + G  ++ K   T ++  
Sbjct: 116 ESPFSASDNAFWLKVVGDSMTSPVGTSIPEGHLILVDPDIPADNGSLVVAKLDGTDEVTF 175

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           K L    G+   L  LN  Y    +  +    +  +
Sbjct: 176 KKLYIDAGQKY-LKPLNPNYRPFEINGN-CRIVGVV 209


>gi|160876037|ref|YP_001555353.1| XRE family transcriptional regulator [Shewanella baltica OS195]
 gi|160861559|gb|ABX50093.1| transcriptional regulator, XRE family [Shewanella baltica OS195]
          Length = 204

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 72/214 (33%), Gaps = 19/214 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I E + ++ +   +T   LA       TS  K +R   +   R  + E++ K L  T  
Sbjct: 2   DIAERVRKLRKALGMTQYQLADLVSTAQTSIQKLERGDTK-NPR--NIEALAKALQTTP- 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
              + L     D             L        G +                P   S H
Sbjct: 58  ---EFLRFGVGDMDNATVVASAGNYLPLISMVQAGVWTEIQELPPLDVELYPCPIKCSQH 114

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLI 186
                        + +  SMLP +R GD++ ++   QV  G  ++ +         K LI
Sbjct: 115 ---------SFIVRVEGESMLPDFRPGDLIYVDPDAQVENGSYVVARLDDENQATFKQLI 165

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
               +   L +LN  +P   VE++ +   + +++
Sbjct: 166 IDGNKKY-LKALNPDWPNKFVEINGNCTIVGKVV 198


>gi|240016860|ref|ZP_04723400.1| transcriptional regulator [Neisseria gonorrhoeae FA6140]
 gi|240113645|ref|ZP_04728135.1| transcriptional regulator [Neisseria gonorrhoeae MS11]
 gi|240116383|ref|ZP_04730445.1| transcriptional regulator [Neisseria gonorrhoeae PID18]
 gi|240117610|ref|ZP_04731672.1| transcriptional regulator [Neisseria gonorrhoeae PID1]
 gi|240123164|ref|ZP_04736120.1| transcriptional regulator [Neisseria gonorrhoeae PID332]
 gi|260439787|ref|ZP_05793603.1| putative phage repressor protein [Neisseria gonorrhoeae DGI2]
 gi|268599708|ref|ZP_06133875.1| transcriptional regulator [Neisseria gonorrhoeae MS11]
 gi|268602050|ref|ZP_06136217.1| transcriptional regulator [Neisseria gonorrhoeae PID18]
 gi|268603316|ref|ZP_06137483.1| transcriptional regulator [Neisseria gonorrhoeae PID1]
 gi|268681792|ref|ZP_06148654.1| transcriptional regulator [Neisseria gonorrhoeae PID332]
 gi|291043050|ref|ZP_06568780.1| transcriptional regulator [Neisseria gonorrhoeae DGI2]
 gi|268583839|gb|EEZ48515.1| transcriptional regulator [Neisseria gonorrhoeae MS11]
 gi|268586181|gb|EEZ50857.1| transcriptional regulator [Neisseria gonorrhoeae PID18]
 gi|268587447|gb|EEZ52123.1| transcriptional regulator [Neisseria gonorrhoeae PID1]
 gi|268622076|gb|EEZ54476.1| transcriptional regulator [Neisseria gonorrhoeae PID332]
 gi|291013025|gb|EFE05001.1| transcriptional regulator [Neisseria gonorrhoeae DGI2]
          Length = 238

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/242 (12%), Positives = 64/242 (26%), Gaps = 29/242 (11%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              H+ +    D    +   TP+  AR   +   +    +        R  S +++ ++ 
Sbjct: 1   MEKHETVIRLFDAAKTKGKNTPAETARLLNISQQTLKNWES-------RGISAKALPEVA 53

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG---------------GFFDSG 107
                +   L     S              +                        +    
Sbjct: 54  QVLGVSETWLRTGEGSRTAPVLINPDLPHEVKDIHRPMMWSSNDPLPDDDYVFVPYLKES 113

Query: 108 VFPTGNKWNTVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS 161
            F  G     +       +P  +S                    SM     +   + +++
Sbjct: 114 CFKGGAGAYEIPDYNGYRLPFGKSTLRRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDT 173

Query: 162 AIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILW 220
                   ++    + G    K LI + G S+ + S N   YP +T  +  +  I R+ W
Sbjct: 174 GETAIRDGKIYAFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYPDETAPLDSLSVIGRVFW 233

Query: 221 AS 222
            S
Sbjct: 234 WS 235


>gi|187733300|ref|YP_001879888.1| repressor protein C2 [Shigella boydii CDC 3083-94]
 gi|187430292|gb|ACD09566.1| repressor protein C2 [Shigella boydii CDC 3083-94]
          Length = 218

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 88/218 (40%), Gaps = 13/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    ++  LT   LA+KAG+   + +K+++       +  + +++FK+ AA  
Sbjct: 2   KSLGERLINARQKAGLTQDALAKKAGITRVAISKAEQGLT----KSFNGDTLFKVAAALG 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L +      +  E   K  P      S     +        +  +     +    
Sbjct: 58  CSPQWLQNGDEK-DKHWENNVKSCPQRDTAHSYPVINWVQAGLFATSGDDYNMYDQDNWR 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIKPR-TGDIV 181
           H+  YA + +    +    SM       + +G  +++N   +V  G  ++ + + T +  
Sbjct: 117 HSVKYAGE-RGFWLEVHGDSMTSPVGITFPEGMSILVNPDKEVFSGCYVIARKKSTNEAT 175

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 176 FKKYISDMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 211


>gi|170717358|ref|YP_001784466.1| phage repressor [Haemophilus somnus 2336]
 gi|168825487|gb|ACA30858.1| putative phage repressor [Haemophilus somnus 2336]
          Length = 229

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 61/228 (26%), Gaps = 22/228 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             +   ++ +  +  ++ S LAR  G+   S +K          R P   +I +I  A  
Sbjct: 2   NTLASRLNYLMNKIGVSQSELARYIGITQPSVHKILNGET----RNPK--NIVEIATALG 55

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             +  L         T       +                     G+       PE  S 
Sbjct: 56  VDVHWLKTGEGEPNITPHSSI-LVSNEPDEKHTHRINRYDFQLSAGDGIINSDYPETISS 114

Query: 127 HNGI---------YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                           +      K    SM P     D++ +++ I    GD +      
Sbjct: 115 IWLTPEGMMQIIGRYSEKGICIFKVPTDSMEPTISSKDLVFIDTNITYFAGDGIYAFRLN 174

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM---SDIEWIA---RIL 219
           G    K L       I  +S N  Y    +        E +    R++
Sbjct: 175 GKDYIKRLQQLPTGIIRALSDNKLYDPFDITEELFDTAEIVGKFIRVV 222


>gi|217973784|ref|YP_002358535.1| putative phage repressor [Shewanella baltica OS223]
 gi|217498919|gb|ACK47112.1| putative phage repressor [Shewanella baltica OS223]
          Length = 243

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 76/236 (32%), Gaps = 22/236 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + + I    +   L+   +A+  G++  S +  +  G  G    P   ++  +     
Sbjct: 3   KSMGKRIAERRKELGLSQDVVAKYVGINRVSVSNWETDGKNGT--SPKGANLIALAELLK 60

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFP----------PSGSGGFFDSGVFPTGNKWN 116
            T   LL+      +T  ++        F              +  F+       GN   
Sbjct: 61  CTPEWLLNGEDEALKTENRESNAQWHAGFELWDGDTPLRDDEVALPFYREVELAAGNGST 120

Query: 117 TVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            V       +   +S                    SMLP+ R G  + ++++ +      
Sbjct: 121 FVQENGGCKLRFAKSTLKKSNVDPQHAACVTVSGNSMLPVLRHGTTVGVDTSKKSIIDGE 180

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMS---DIEWIARILWAS 222
           +      G +  K+L    G  I + S N   +P + ++     +I+ I  + W S
Sbjct: 181 MYAIDHDGMLRVKMLYRTPGGGIRIKSYNNDEFPDEFIQPDKVSEIKIIGWVFWWS 236


>gi|209919283|ref|YP_002293367.1| putative phage repressor [Escherichia coli SE11]
 gi|209912542|dbj|BAG77616.1| hypothetical phage repressor [Escherichia coli SE11]
          Length = 218

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 87/218 (39%), Gaps = 13/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    ++  LT   LA+KAG+   + +K+++       +  + +++FK+ AA  
Sbjct: 2   KSLGERLINARQKAGLTQDALAKKAGVTRVAISKAEQGLT----KSFNGDTLFKVAAALQ 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L +      +  E   K  P      S     +           +     +    
Sbjct: 58  CSPQWLQNGDEK-DKHWENNVKSCPQRDTAHSYPVINWVQAGLFATAGDDYNMYDQDNWR 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIKPR-TGDIV 181
           H+  YA + +    +    SM       + +G  +++N   +V  G  ++ + + T +  
Sbjct: 117 HSVKYAGE-RGFWLEVHGDSMTSPVGITFPEGMSILVNPDKEVFSGCYVIARKKSTNEAT 175

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 176 FKKYISEMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 211


>gi|224823653|ref|ZP_03696762.1| putative phage repressor [Lutiella nitroferrum 2002]
 gi|224604108|gb|EEG10282.1| putative phage repressor [Lutiella nitroferrum 2002]
          Length = 324

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 64/232 (27%), Gaps = 23/232 (9%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           S   + + +    E   LT   LA++ G+   + N  +    +G      T+ +  I  A
Sbjct: 93  SMDTLGKRVTHARELKGLTQLELAKRVGVSAQTINFVENGRNKG------TKHLLAIAKA 146

Query: 65  TNETICQLLDLPFSDGRTTEKK-EKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
              +   L     S    + +  E          SG   F                    
Sbjct: 147 LGVSATWLDSGKGSMTEVSLRPIEVWEDEEQLAQSGEYIFLPELSVRPSAGPGAQVWHVD 206

Query: 124 RSPHNGIY---------AIQTQDTRHKTQDTSMLPLYRKGDILILN-SAIQVNCGDRLLI 173
            +     +                       SM P    GD ++++          ++ +
Sbjct: 207 TAGQRQAFTAKWARRMSIDPACAATMVVSGDSMEPRLLDGDSIVVDYCQNDTIIDGKVYV 266

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCC---YPVDTVEMSD---IEWIARIL 219
                ++  K L    G  + + S N     +P   V   +   +  + R++
Sbjct: 267 LVINDEVKVKRLFKAIGGGLIIRSDNPDKNTHPDLNVRAEEMMHVRIVGRVV 318


>gi|194466453|ref|ZP_03072440.1| transcriptional regulator, XRE family [Lactobacillus reuteri
           100-23]
 gi|194453489|gb|EDX42386.1| transcriptional regulator, XRE family [Lactobacillus reuteri
           100-23]
          Length = 220

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/216 (13%), Positives = 61/216 (28%), Gaps = 11/216 (5%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
              I   + R+ +    T + LA K  +   + +  +        + P   S+  +    
Sbjct: 3   ENTIASQLKRLRKSRGWTQTQLADKLSVSKQTISNWETGT-----KVPRMGSLQNLADLF 57

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
           +  I ++ +       T       I                G    G+        E   
Sbjct: 58  HVKIGEITNASIIKEETQSHLPTNIIYPLGDDFERISIPLIGEIACGDPITADENIEGYV 117

Query: 126 PHNGIYAIQ-TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAK 183
                  +        + +  SM P    G I+ +     V  G+   ++     +   K
Sbjct: 118 EEIFEKPVPKGNLFALRCKGKSMEPTIHDGSIVTIREQPTVEDGEIAAVLVDGDNEATLK 177

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +  + G  I LM  N  +    ++  +     RI+
Sbjct: 178 RVKHQ-GNLIMLMPDNKEFDPIILDKDN---PGRIV 209


>gi|57234333|ref|YP_181610.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57234921|ref|YP_181022.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57234968|ref|YP_180999.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57224781|gb|AAW39838.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57225369|gb|AAW40426.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
 gi|57225416|gb|AAW40473.1| transcriptional repressor LexA, putative [Dehalococcoides
           ethenogenes 195]
          Length = 217

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 74/217 (34%), Gaps = 18/217 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I   +  + ++  +T S LAR++G+D    ++ +     G+    +     K+    + +
Sbjct: 7   IGITLKELRKKIGMTQSELARRSGVDRAYISQLE----SGKTYSATLGIAQKLARGLDIS 62

Query: 69  ICQLLDLPFSDGRTTEKKE-----KEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
              LL            +      +   + + P  G        +       + V VP+ 
Sbjct: 63  TSALLGEKEESLGNLLSRAQAISRRMDDIEFIPVIGYIPAGYPELVDEEAASDYVPVPKE 122

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSML-PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
              +        +    +    S+       GDI+I++   ++  G    ++    ++ A
Sbjct: 123 LLKN-----ASKRVYALRVSGESLKGDGIENGDIIIVDKDSEMFEGKIYAVRTAHNEVTA 177

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K L       I L S N  Y    +  +D   + R++
Sbjct: 178 KHLY-LNNGQIILRSSNGDYKDLVMTNAD--ILGRVI 211


>gi|18249875|ref|NP_543063.1| putative lambda repressor [Enterobacteria phage phiP27]
 gi|18152342|emb|CAC83529.1| putative lambda repressor [Enterobacteria phage phiP27]
          Length = 218

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 86/218 (39%), Gaps = 13/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    ++  LT   LA+KAG+   + +K+++       +  + +++FK+ AA  
Sbjct: 2   KSLGERLINARQKAGLTQDALAKKAGVTRVAISKAEQGLT----KSFNGDTLFKVAAALQ 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L        +  E   K  P      S     +           +     +    
Sbjct: 58  CSPQWLQSGDEK-DKHWENNVKSCPQRDTAHSYPVINWVQAGLFATAGDDYNMYDQDNWR 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIKPR-TGDIV 181
           H+  YA + +    +    SM       + +G  +++N   +V  G  ++ + + T +  
Sbjct: 117 HSVKYAGE-RGFWLEVHGDSMTSPVGITFPEGMSILVNPDKEVFSGCYVIARKKSTNEAT 175

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 176 FKKYISEMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 211


>gi|254460292|ref|ZP_05073708.1| LexA repressor [Rhodobacterales bacterium HTCC2083]
 gi|206676881|gb|EDZ41368.1| LexA repressor [Rhodobacteraceae bacterium HTCC2083]
          Length = 232

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 66/229 (28%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I++  ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFINKRMQKDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +   T    +   F  G+      +    +    +        G    G
Sbjct: 61  ARAIEIVKLPDSLGMTPAGFVPRVFEGGKPDVPAPRNAQPVEAIHA--MELPVMGQIAAG 118

Query: 113 NKWNTVGVPEIRSPHN-GIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +            + +   +    + +  SM+      GD +++      + GD 
Sbjct: 119 VPIEAISHASHNVAVPSQMLSGPGEHYALEVKGDSMIDAGINDGDTVVIRETNTADNGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K      G +I L + N  Y         ++   R++
Sbjct: 179 VVALVEDQEATLKRFHR-NGTTIALEAANPAYETRFFSHEQVKVQGRLV 226


>gi|71901612|ref|ZP_00683692.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Ann-1]
 gi|71728622|gb|EAO30773.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Ann-1]
          Length = 406

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/250 (13%), Positives = 67/250 (26%), Gaps = 43/250 (17%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +        +T   LA   G+ P S +         + ++   E++ K   A N +
Sbjct: 153 LAERLRIAMIEAGMTQKQLADAVGVKPPSIHGWL----SSKAKFLRGENLLKAAKALNVS 208

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPP---------------------SGSGGFFDSG 107
              L          T    +E PL                          +         
Sbjct: 209 EKWLATGTGLMRAVTAIPAQETPLRQESQHINLDTYEFQAIDDGEALDPEANVLVDEVDV 268

Query: 108 VFPTGNKWNTVGV-------PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
           +   GN              P         +         +    SM       D +++N
Sbjct: 269 MLSAGNGVLIPEFIETKFQMPFPLPWLRHAHINPKDVKLMRVHGDSMERTLFDKDRVMVN 328

Query: 161 SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC--------YPVDTVEMSD- 211
            A       ++      G+   K L + R   + ++S N          Y  + V  S+ 
Sbjct: 329 FADTRVRDGKVYAIAIGGEAKVKRLYTLRNNGLRIVSDNQNKDSEGHRIYKDEIVPPSEM 388

Query: 212 --IEWIARIL 219
             ++ + R++
Sbjct: 389 ETVQVLGRVI 398



 Score = 43.6 bits (101), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 21/61 (34%), Gaps = 2/61 (3%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ + H +T   LA   G   +     +  G     R PS   I  I      T  
Sbjct: 77  ENLRRLRKSHGMTQEQLALTCGWGQSRIANYESRGSSA--REPSFNDIEIISRVLGVTKA 134

Query: 71  Q 71
           +
Sbjct: 135 E 135


>gi|56964628|ref|YP_176359.1| SOS-response transcriptional repressor [Bacillus clausii KSM-K16]
 gi|56910871|dbj|BAD65398.1| SOS-response transcriptional repressor [Bacillus clausii KSM-K16]
          Length = 209

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 25/215 (11%), Positives = 64/215 (29%), Gaps = 18/215 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E + +   R   + + LA    +   + ++ ++       R P  E +  I    + T
Sbjct: 8   LAENLMKARIRKGYSQTDLAEILNVSSATISQYEKG-----KRSPDVEKLHTIAKVLDTT 62

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I +L+     +       +  + +       +G    +     G  +             
Sbjct: 63  IPELIMGQSDNEALKLNMQSLVKIPILGTVRAGYNLLADENVIGYAY-----------AP 111

Query: 129 GIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                         +  SM+      GD +++      + G   ++     +   K +  
Sbjct: 112 KSDIGDGDYFYLNIEGDSMIDAGLNSGDRILVRKQNHTSDGSIAVVLINGEEATVKRVFF 171

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
              + I L   N        +  +I  + +++ AS
Sbjct: 172 DSNKVI-LSPENPHMRPQFYDEDEIRILGKVVSAS 205


>gi|295106591|emb|CBL04134.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Gordonibacter pamelaeae 7-10-1-b]
          Length = 215

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 67/220 (30%), Gaps = 22/220 (10%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++   I R+   H LT   L + AG+ P + ++ +          P   +I ++      
Sbjct: 2   ELGSNIKRLRVEHCLTQGELGKIAGVSPMAVSQWENGRAV-----PRMGAIQRMADYFGI 56

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           +          +             +    +   G         G+    + V E     
Sbjct: 57  SK----SSLIDNAADGFVAGSVHYEVTSLTAPVYG-----RISAGDALEMLPVTEEAYVI 107

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
             +               SM  +   G ++  + + +V  GD + +     D   K +  
Sbjct: 108 PPVAESHPDGFFLTVSGDSMDKIMPNGSLVYFDKSAEVRSGDIVAVTVNGDDATMKRIFF 167

Query: 188 RRGRSIDLMSL--NCCYPVDTVEMSD-----IEWIARILW 220
             G +I L     N  +   +++ SD     +  + + +W
Sbjct: 168 -AGDTIVLHPESNNPSHRDRSIDASDPDAPQVRILGKAVW 206


>gi|312897732|ref|ZP_07757148.1| LexA repressor family protein [Megasphaera micronuciformis F0359]
 gi|310621116|gb|EFQ04660.1| LexA repressor family protein [Megasphaera micronuciformis F0359]
          Length = 218

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/221 (13%), Positives = 66/221 (29%), Gaps = 18/221 (8%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTESIFKILAA 64
           + I + I    + H L+     ++ GL     +  +R       +   PS +++  I   
Sbjct: 2   ENIGDLIREYRQSHGLSMEEFGKRVGLSKAYISLIERGKNTRSNKPIVPSIDTMKAIADG 61

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
               +  LL       +          +                   G     V      
Sbjct: 62  LEMDLDVLLRSIDPSQKIKINNTHPKGVQIPVLGR---------VVAGVPLEAVEEILDY 112

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                  A   +    + +  SM P   +GD++I+     V+ GD  ++     +   K 
Sbjct: 113 EEITPELAATGEFFALQIRGRSMEPRMLEGDVVIVRRQSDVDSGDIAIVLVNGDEATVKR 172

Query: 185 LISRRGRSIDLMSLNCC-YPVDTVEMSD-----IEWIARIL 219
           +     R I L++ N   Y        +     ++ + +++
Sbjct: 173 VSK-SDRGITLIATNPNVYEPHFYSSEEINDLPVQILGKVV 212


>gi|183600843|ref|ZP_02962336.1| hypothetical protein PROSTU_04445 [Providencia stuartii ATCC 25827]
 gi|188019628|gb|EDU57668.1| hypothetical protein PROSTU_04445 [Providencia stuartii ATCC 25827]
          Length = 234

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/230 (12%), Positives = 65/230 (28%), Gaps = 23/230 (10%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + + + +  +   +T + LA+  G+   +  K +        R      + +I  A N  
Sbjct: 5   LAQRLKQARKNAGITQNELAKLVGVSQAAIQKIETGKAATSTR------LIEISKALNVD 58

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG--GFFDSGVFPTGNKWNTVG-VPEIRS 125
              L      +         +I L     +               G     +    E  +
Sbjct: 59  PEWLSVGTGDNPVPHISSSVKIELADDVGNIERYRVEVLDVEASAGEGVIVIDDFIETIT 118

Query: 126 PHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                     +               +  SM   +   D + ++       GD + +   
Sbjct: 119 SIEYSVEEAKRLFGGRPSNTIKMITVKGDSMAETFEPRDQIFVDITTNFFDGDGIYVFVL 178

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARILWASQ 223
              +  K L  +  + + ++S N  Y    ++   I      A++L  SQ
Sbjct: 179 DNQLYIKRLQKQY-KRLAVISDNPRYETWYLDEDAINGLYICAKVL-VSQ 226


>gi|114569948|ref|YP_756628.1| LexA repressor [Maricaulis maris MCS10]
 gi|122316090|sp|Q0APU7|LEXA_MARMM RecName: Full=LexA repressor
 gi|114340410|gb|ABI65690.1| SOS-response transcriptional repressor, LexA [Maricaulis maris
           MCS10]
          Length = 232

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 31/228 (13%), Positives = 67/228 (29%), Gaps = 12/228 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +    ++   I    +   ++PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQNELLLFIHNRIKETGVSPSFDEMKGALQLASKSGVHRLITALEERGFIRRLAHR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  +      +   +P  D      +             +      G    G
Sbjct: 61  ARALEVLKLPESAA--AHETPAIPKGDLGANVVRGNFAKPEPDARENTVDIPMLGRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
              + +     R P      +  +    + +  SM       GD +++        GD +
Sbjct: 119 VPISAIQHETDRFPVPADMVMGGEHFGLEVKGDSMIEAGIMDGDTVLIRRCQSAETGDIV 178

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K L  ++G S+ L + N  Y         ++   R++
Sbjct: 179 VALIDDEEATLKRL-RKKGGSVALEAANPEYETRIFPPDRVKVQGRLV 225


>gi|192291420|ref|YP_001992025.1| phage repressor [Rhodopseudomonas palustris TIE-1]
 gi|192285169|gb|ACF01550.1| putative phage repressor [Rhodopseudomonas palustris TIE-1]
          Length = 264

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/228 (14%), Positives = 70/228 (30%), Gaps = 18/228 (7%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE-----SIFKILAA 64
              I +  E+   +   LA + G+   +  K +          P         +  +  +
Sbjct: 33  GNIIRQAREQKGWSQKDLADRVGISQPAIRKIEGGSTVKSKHLPKIAQVLGLDLQHLDES 92

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS--------GSGGFFDSGVFPTGNKWN 116
            ++          S G     +     L     +               +G +    K  
Sbjct: 93  LDQLTNVESQAFSSTGDVNHHRPASGILEIDVRAGMGGGGSVEGREVVHNGRYSDPVKEE 152

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
               P        + A +++    +TQ  SM P    GD +I+++  ++   D +     
Sbjct: 153 AWHFPARFLREE-LRAPESRVQILETQGDSMAPTILSGDRVIIDTGHRLPSPDGIYAIRD 211

Query: 177 TGDI-VAKVLI---SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
                V K L         +I ++S N  +  + V   +I  + R+LW
Sbjct: 212 RFGAIVVKRLQVLRRGEPPTIRVISDNKAHDSEDVGADEIHIVGRVLW 259


>gi|320178346|gb|EFW53317.1| repressor protein c2, putative [Shigella boydii ATCC 9905]
          Length = 218

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 89/218 (40%), Gaps = 13/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    ++  LT   LA+KAG+   + +K+++       +  + +++FK+ AA  
Sbjct: 2   KSLGERLINARQKAGLTQDALAKKAGVTRVAISKAEQGLT----KSFNGDTLFKVAAALQ 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L +     G+  E   K  P      S     +      T    +     +    
Sbjct: 58  CSPQWLQNGDEK-GKHWENNVKSCPQRDTAHSYPVINWVQAGLFTTAGDDYNMYDQDNWR 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIKPR-TGDIV 181
           H+  YA + +    +    SM       + +G  +++N   +V  G  ++ + + T +  
Sbjct: 117 HSVKYAGE-RGFWLEVHGDSMTSPIGITFPEGMSILVNPDKEVFSGCYVIARKKSTNEAT 175

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 176 FKKYISEMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 211


>gi|188491927|ref|ZP_02999197.1| repressor protein C2 [Escherichia coli 53638]
 gi|194434099|ref|ZP_03066368.1| repressor protein C2 [Shigella dysenteriae 1012]
 gi|188487126|gb|EDU62229.1| repressor protein C2 [Escherichia coli 53638]
 gi|194417643|gb|EDX33743.1| repressor protein C2 [Shigella dysenteriae 1012]
 gi|332096959|gb|EGJ01947.1| repressor protein C2 [Shigella dysenteriae 155-74]
          Length = 218

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/218 (18%), Positives = 88/218 (40%), Gaps = 13/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    ++  LT   LA+KAG+   + +K+++       +  + +++FK+ AA  
Sbjct: 2   KSLGERLINARQKAGLTQDALAKKAGVTRVAISKAEQGLT----KSFNGDTLFKVAAALQ 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L +     G+  E   K  P      S     +           +     +    
Sbjct: 58  CSPQWLQNGDEK-GKYWENNVKSCPQRDTAHSYPVINWVQAGLFATAGDDYNMYDQDNWR 116

Query: 127 HNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIKPR-TGDIV 181
           H+  YA + +    +    SM       + +G  +++N   +V  G  ++ + + T +  
Sbjct: 117 HSVKYAGE-RGFWLEVHGDSMTSPIGITFPEGMSILVNPDKEVFSGCYVIARKKSTNEAT 175

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 176 FKKYISEMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 211


>gi|261318541|ref|ZP_05957738.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|265986342|ref|ZP_06098899.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|261297764|gb|EEY01261.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|264658539|gb|EEZ28800.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
          Length = 170

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 75/146 (51%), Gaps = 9/146 (6%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
                  +    IPLL    +G+GG+FD   FP G  W+ V  P                
Sbjct: 34  RHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTGEG---------V 84

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
              +    SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+L S
Sbjct: 85  YALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIELHS 144

Query: 198 LNCCYPVDTVEMSDIEWIARILWASQ 223
           LN  +P    E  DIEWIARILWASQ
Sbjct: 145 LNPEHPNRIFESKDIEWIARILWASQ 170


>gi|330897368|gb|EGH28787.1| peptidase [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 286

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 65/217 (29%), Gaps = 16/217 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +    +   L  + LA +AG+  TS +  +R   +       T  + KI         
Sbjct: 71  DRLKAARQHAKLNQAELAVRAGITQTSISDLERGKSKA------TAHVAKIADVCGVNAL 124

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-VPEIRSPHNG 129
            L D            E     +    S    +        G     V   P   +    
Sbjct: 125 WLSDGKGDMTAFITSNEPSNVSMAEQSSRMYRYPLVSWVAAGEWSEAVEPYPPGAADEYD 184

Query: 130 I--YAIQTQDTRHKTQDTSM----LPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVA 182
           +  Y  +        +  SM     P   +G  +++++  +V  G  ++     + +   
Sbjct: 185 VSDYKAKGPAFWLVVKGDSMTAPTAPSIPEGSQILIDTRAEVLPGKLVIAKLAGSNEATF 244

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K L+   G    L  LN  YP       D   I  ++
Sbjct: 245 KKLVEDGGVRY-LKPLNSAYPTVQCT-EDCRIIGVVV 279


>gi|114797550|ref|YP_760490.1| LexA repressor [Hyphomonas neptunium ATCC 15444]
 gi|122942416|sp|Q0C1A3|LEXA_HYPNA RecName: Full=LexA repressor
 gi|114737724|gb|ABI75849.1| LexA repressor [Hyphomonas neptunium ATCC 15444]
          Length = 227

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 61/222 (27%), Gaps = 5/222 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   K++   I+   +   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTTKQKELLLFINDRIKDTGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLANR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + L         +        R              P          G    G+  + +
Sbjct: 61  ARALEVLKLPDSAIPPPNARQRRDFRPALVTNQGAEAPRIAGMIPL-VGRIAAGSPISAI 119

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRT 177
                +    G           + Q  SM+      GD +IL        GD ++     
Sbjct: 120 QQENGQVASPGGLPEGDDYFALEVQGDSMIQAGILNGDTVILKRTNTAQTGDIVVALIDG 179

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +   K L  +   S+ L + N  +         +E   R++
Sbjct: 180 EEATLKRLRRKGA-SVALEAANPAFETRIFGPDRVEVQGRLV 220


>gi|119384874|ref|YP_915930.1| LexA repressor [Paracoccus denitrificans PD1222]
 gi|166224639|sp|A1B3Z0|LEXA_PARDP RecName: Full=LexA repressor
 gi|119374641|gb|ABL70234.1| SOS-response transcriptional repressor, LexA [Paracoccus
           denitrificans PD1222]
          Length = 232

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 61/229 (26%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGL---DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++ E I     R  + PS    K  L     +  ++      +R  I      
Sbjct: 1   MLTRKQIQLLEFIQARMARDGVPPSFDEMKLALDLRSKSGIHRLVTALEERGFIRRLPHR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I ++  + ++       +                +     +        G    G
Sbjct: 61  ARALEIVRLPESLSKGPGFQPRVIEGTMPDRPAPLPRGAMEVSVSAIELPVM--GRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +              + Q +    + +  SM       GD++++        GD 
Sbjct: 119 VPIEAISEISHHIAVPTTMLSGQDRHYALEVRGDSMIEAGINDGDVVVIREQNAAESGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    + G  I L + N  Y    +    +    R++
Sbjct: 179 VVALVDGYEATLKRYRRK-GNMIALEAANPAYETRVLPEDKVRIQGRLV 226


>gi|291326325|ref|ZP_06124059.2| peptidase, S24 family [Providencia rettgeri DSM 1131]
 gi|291314825|gb|EFE55278.1| peptidase, S24 family [Providencia rettgeri DSM 1131]
          Length = 229

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/233 (16%), Positives = 79/233 (33%), Gaps = 25/233 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  H++I +A  R+A++  +T + LA++ G+ P S  + +          P    + K
Sbjct: 1   MKTM-HERIKQA--RLAKK--MTQAELAQQLGVTPQSVQQWETST------EPRKNRVMK 49

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFP-------PSGSGGFFDSGVFPTGN 113
           I    +     LL           K  K   +  +              ++ S     GN
Sbjct: 50  IAEILSVDAEWLLFGTAKKDGVPAKDFKSREVDTWDSKTPLNDDEVEIPYYKSIELAAGN 109

Query: 114 KWNT------VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
             N         +   +S                    SM P+   G  + +N   +   
Sbjct: 110 GSNGGSDNNGYKLRFSKSTLKRYGISAKDVASFPVHGDSMEPVIPSGTTVFVNMGDKTIV 169

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIEWIARIL 219
              +    +   +  K+L+ + G  + + S N   YP +T+++  +  + R+ 
Sbjct: 170 DGGIYFIEQEDLLRVKILLRQPGGKLTIRSYNSIDYPDETIDIEKVRVVGRVF 222


>gi|161789249|ref|YP_001595597.1| hypothetical protein BMSA_0010 [Vibrio sp. 23023]
 gi|161761374|gb|ABX77020.1| H-T-H motif hypothetical protein [Vibrio sp. 23023]
          Length = 207

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 71/222 (31%), Gaps = 29/222 (13%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + + + +      LT   LA   G+   + +K +      + R    E + +IL      
Sbjct: 3   VSQILKKKRVEKGLTQQDLADAIGVSAVAVSKWELGQS--KPRKKFHEKLSEILG----- 55

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
                           +K                 + +     G+ +    + +      
Sbjct: 56  --------------VNEKVISGSEKITKSDYVEIPYYNVKAAAGHGYENDELYDREVELV 101

Query: 129 GI----YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
            I    YA ++     K    SM+P++  G  L ++S+  +     L +    G +  KV
Sbjct: 102 PIEALKYAQKSSVFCIKASGDSMVPVFFDGAKLAIDSSKTIVKDGDLYVVSYDGCLRVKV 161

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDI---EWIARILWASQ 223
           L       I L S N  +  +     ++     I +++W SQ
Sbjct: 162 LFKTLNG-IRLCSYNSMFKDEEYTHEELTTFRVIGKVIWYSQ 202


>gi|87200384|ref|YP_497641.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136065|gb|ABD26807.1| putative phage repressor [Novosphingobium aromaticivorans DSM
           12444]
          Length = 233

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 61/218 (27%), Gaps = 12/218 (5%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             +  +A    ++ + L+   G + T   +  R   +G  R         +         
Sbjct: 15  SRLVALASGRGVSLASLSALIGRNQTYLQQFVR---KGSPRKLEENDRRTLAEFFGVPES 71

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI------- 123
            L            +    +                           +   EI       
Sbjct: 72  DLGAPSRGSALVVGQGRGIVVPTTRAALAEWADIPRLPLGASAGPGALPAEEIPSGRLRF 131

Query: 124 -RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                 G        +  + +  SM P  R GD ++++   +       +I+     ++ 
Sbjct: 132 SHRWLKGQGLEPAMLSVIEVEGDSMEPTLRDGDEILVDRTARPMRAGIHVIRLD-DMLLV 190

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           K L    G  + ++S N  YP       ++E + R++W
Sbjct: 191 KRLEPGPGGILRVISDNGAYPRIERPAHEVEIVGRVVW 228


>gi|294853434|ref|ZP_06794106.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
 gi|294819089|gb|EFG36089.1| peptidase family S24 [Brucella sp. NVSL 07-0026]
          Length = 160

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 75/146 (51%), Gaps = 9/146 (6%)

Query: 78  SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQD 137
                  +    IPLL    +G+GG+FD   FP G  W+ V  P                
Sbjct: 24  RHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTGEG---------V 74

Query: 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMS 197
              +    SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+L S
Sbjct: 75  YALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIELHS 134

Query: 198 LNCCYPVDTVEMSDIEWIARILWASQ 223
           LN  +P    E  DIEWIARILWASQ
Sbjct: 135 LNPEHPNRIFESKDIEWIARILWASQ 160


>gi|46200913|ref|ZP_00056183.2| COG2932: Predicted transcriptional regulator [Magnetospirillum
           magnetotacticum MS-1]
          Length = 221

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 73/224 (32%), Gaps = 13/224 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT+     + + +    +   L P  +A  AG+  +      R    GR+  PS+E + +
Sbjct: 1   MTT----TLADRMRARMKELELRPLHVAEAAGVGRSFVYDILR----GRSADPSSEKLTR 52

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           + A     I  LL                   +  P          G             
Sbjct: 53  VAAVLQMPIEALLYDEDGKQAPAVTTPSRRDYVAVPFVDVEADMGGGAVAESE-EEGAPW 111

Query: 121 PEIRSPHNGIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              +S   G+  +        + +  SM P    GD+++L++   +     + +      
Sbjct: 112 HFPKSWLRGVLRLRPAGLRLIRVRGDSMEPTLLGGDVVMLDTTQTIPNPTGIFVLHDGFG 171

Query: 180 IVAKVLISRRGRSI---DLMSLNCCYPVDTVEMSDIEWIARILW 220
           +VAK L    G  I    ++S N  Y        +I  I RI+W
Sbjct: 172 LVAKRLERLAGGEIPSVRIISDNSRYSPYDRSGEEIRIIGRIVW 215


>gi|84515591|ref|ZP_01002953.1| LexA repressor [Loktanella vestfoldensis SKA53]
 gi|84510874|gb|EAQ07329.1| LexA repressor [Loktanella vestfoldensis SKA53]
          Length = 227

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 58/222 (26%), Gaps = 4/222 (1%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     +   I    +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLAFIHTRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + L         +           +K             GS      G    G     +
Sbjct: 61  ARALEILKLPDSMMGSGFQPRVIAGDKPASIPTAALPVEGGSMSLPVMGRIAAGVPIEAI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                          + +    + +  SM       GD++++      N GD ++     
Sbjct: 121 SEVSHHVHVPQSMLGKGEHYALEVKGDSMIEAGINDGDVVVIRETSVANNGDIVVALVEG 180

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +   K    R G +I L + N  Y         ++   R++
Sbjct: 181 QEATLKRF-RRTGSAIALEAANPAYETRVFRDDQVKVQGRLV 221


>gi|326386994|ref|ZP_08208604.1| putative phage repressor [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208175|gb|EGD58982.1| putative phage repressor [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 250

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 67/222 (30%), Gaps = 13/222 (5%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL----AATN 66
             +  +A    ++ S L+   G +     +  R G   +       ++        +   
Sbjct: 25  ARLVALARERGVSLSALSGMIGRNAAYLQQFVRKGSPRKLEENDRRTLAMFFGVDESELG 84

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE---- 122
                 + +  S GR    +         P                    T+ + E    
Sbjct: 85  APAANEVAVVQSGGRLAFARNGSARSASRPVEAEWVDIPRLALGASAGPGTLALDEAESG 144

Query: 123 ----IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
                +     +     Q +  +    SM P    GD ++++ + +       +++    
Sbjct: 145 RLRFSQRWLRTLGLDPGQLSVIEVAGDSMEPTLHDGDEILVDRSPRPWRDGIHVVRID-E 203

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILW 220
            ++ K L +    +I +MS N  YP       D+  I R++W
Sbjct: 204 VLLVKRLETGPAGTIRVMSDNPAYPRIERAYEDVAIIGRVVW 245


>gi|315656844|ref|ZP_07909731.1| LexA repressor [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492799|gb|EFU82403.1| LexA repressor [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 227

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 66/227 (29%), Gaps = 14/227 (6%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWP 53
           M+  +   +++   + R++++    PS   LA   GL   S  K     +  +    R P
Sbjct: 1   MSDLTKRQQEVLTTLYRLSQKLAYPPSVRELAEAMGLSSPSSVKHHLDVLTQKGYLRRAP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +T    + +        +        G +       IP+     + +      G    G 
Sbjct: 61  NTPRALEFVKLP--EGFETPSPDPVSGASQSATITTIPVGIADTAVATPVPLVGQIAAGA 118

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
                 + E        +    +      +  SM       GD +++    +   G+ + 
Sbjct: 119 PITAEEMVEDTFALPRRFTGSGELFMLTVKGDSMQEGGILDGDWVVVRHQNEARNGEIVA 178

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                G+   K         + L+  N  Y            + +++
Sbjct: 179 AMLD-GEATVKEFSR-ADGHVWLLPHNENYAPI--PGDTATILGKVV 221


>gi|157834973|ref|YP_001469130.1| c repressor [Phage MP22]
 gi|117373087|gb|ABH09825.1| c repressor [Pseudomonas phage MP22]
          Length = 209

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 74/201 (36%), Gaps = 10/201 (4%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           + S LAR AG+      +  + G       P+   +  +  A   ++  L+    S    
Sbjct: 10  SASALARNAGISQGGLQRYLKGG------EPTRRVLISLAKAAGVSLGWLMTGEGSKKPE 63

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
            ++       +Y P   +      G +  G    T  +   R   +      T+ +  + 
Sbjct: 64  EQEATGSDQYVYVPLYDARVSAGHGSWSEGAHVLT-QLAFTRYSLSKKGLEPTRMSAVRV 122

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM PL   GD ++++  ++    + + +      + AK L  +   SI ++S N  Y
Sbjct: 123 GGDSMEPLLSDGDAVVIDHDLRTVRDEAIYVIRVGDQLYAKRLQRQFDGSIAIISENKAY 182

Query: 203 PVDTVEMS---DIEWIARILW 220
               V      D++ I R++W
Sbjct: 183 KDMVVPKDQLSDLDIIGRVVW 203


>gi|323174633|gb|EFZ60254.1| repressor protein C2 [Escherichia coli LT-68]
          Length = 240

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 91/226 (40%), Gaps = 19/226 (8%)

Query: 5   SHKK------IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI 58
           SH++      + E +    ++  LT   LA+KAG+   + +K+++       +  + +++
Sbjct: 16  SHERRRKMKSLGERLINARQKAGLTQDALAKKAGVTRVAISKAEQGLT----KSFNGDTL 71

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           FK+ AA   +   L +     G+  E   K  P      S     +           +  
Sbjct: 72  FKVAAALQCSPQWLQNGDEK-GKYWENNVKSCPQRDTAHSYPVINWVQAGLFATAGDDYN 130

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLLIK 174
              +    H+  YA + +    +    SM       + +G  +++N   +V  G  ++ +
Sbjct: 131 MYDQDNWRHSVKYAGE-RGFWLEVHGDSMTSPIGITFPEGMSILVNPDKEVFSGCYVIAR 189

Query: 175 PR-TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            + T +   K  IS  G++  L  LN  YP+  ++ +D E +  ++
Sbjct: 190 KKSTNEATFKKYISEMGKAF-LKPLNPQYPIIEMD-NDCEIVGVVV 233


>gi|298346690|ref|YP_003719377.1| repressor lexA [Mobiluncus curtisii ATCC 43063]
 gi|304389601|ref|ZP_07371563.1| repressor LexA [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|298236751|gb|ADI67883.1| repressor lexA [Mobiluncus curtisii ATCC 43063]
 gi|304327154|gb|EFL94390.1| repressor LexA [Mobiluncus curtisii subsp. curtisii ATCC 35241]
          Length = 227

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 66/227 (29%), Gaps = 14/227 (6%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWP 53
           M+  +   +++   + R++++    PS   LA   GL   S  K     +  +    R P
Sbjct: 1   MSDLTKRQQEVLTTLYRLSQKLAYPPSVRELAEAMGLSSPSSVKHHLDVLTQKGYLRRAP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +T    + +        +        G +       IP+     + +      G    G 
Sbjct: 61  NTPRALEFVKLP--EGFEAPSPDPVSGASQSATITTIPVGIADTAVATPVPLVGQIAAGA 118

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
                 + E        +    +      +  SM       GD +++    +   G+ + 
Sbjct: 119 PITAEEMVEDTFALPRRFTGSGELFMLTVKGDSMQEGGILDGDWVVVRHQNEARNGEIVA 178

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                G+   K         + L+  N  Y            + +++
Sbjct: 179 AMLD-GEATVKEFSR-ADGHVWLLPHNENYAPI--PGDTATILGKVV 221


>gi|258541731|ref|YP_003187164.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256632809|dbj|BAH98784.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-01]
 gi|256635866|dbj|BAI01835.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-03]
 gi|256638921|dbj|BAI04883.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-07]
 gi|256641975|dbj|BAI07930.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-22]
 gi|256645030|dbj|BAI10978.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-26]
 gi|256648085|dbj|BAI14026.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-32]
 gi|256651138|dbj|BAI17072.1| transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654129|dbj|BAI20056.1| transcriptional regulator [Acetobacter pasteurianus IFO 3283-12]
          Length = 214

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 86/220 (39%), Gaps = 15/220 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           ++IW A+D +A+   LTPSGLAR AGLD T+FN S+R   +G  RWP+  S+ + L    
Sbjct: 5   ERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGQGVWRWPALPSLLRALDVLR 64

Query: 67  ETICQLLDLPFSDGRT---TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
            ++ Q     +   +           +  L        G  D    P G  W        
Sbjct: 65  VSLAQFEGHIWGYEQPDGVEAPAPCFMRSLPLSWLKQEGVLDRAGLPAGGLWEQEET--- 121

Query: 124 RSPHNGIYAIQ-TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                  +++  +     +     M P+ R G  L++  A+     DR+++       V 
Sbjct: 122 ------FFSLPSSSAYMLRVDTEGMEPILRLGCSLVVQPALYPRGADRVVLIRPGQAPVV 175

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
            +L  +   +I     +   PV         W+ RI+  S
Sbjct: 176 GILQEKPVLAIQPFGRSALQPVPQAAAG--VWLHRIVLIS 213


>gi|241759778|ref|ZP_04757878.1| peptidase, S24 family [Neisseria flavescens SK114]
 gi|241319786|gb|EER56182.1| peptidase, S24 family [Neisseria flavescens SK114]
          Length = 238

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 73/241 (30%), Gaps = 25/241 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKSKRFGIEGR---------- 49
           MT   H+   + +  +A+    L P+ +A +  +   +    +  GI  +          
Sbjct: 1   MTM--HET-TDRLFEIAKEQGVLKPADIAERLNISQQALKNWESRGIAAKALPEVARVFG 57

Query: 50  --NRWPSTESIFK-----ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG 102
               W  T    +     I       +  +             ++    + Y   S   G
Sbjct: 58  VSETWLRTGEGSRTVPVLIDPGLPHEVKDIHSPMMWSSNDPLPEDDYTFVPYLKESCFKG 117

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
              +   P  N +    +P  +S                    SM     +   + +++ 
Sbjct: 118 GTGAYEIPDYNGY---RLPFGKSTLKRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTG 174

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWA 221
                  ++    + G    K LI + G ++ + S N   YP +T  +  +  I R+ W 
Sbjct: 175 ETAIRDGKIYAFAQDGMFRVKYLIRQPGGNVLIRSHNSGFYPDETAPLDSLTVIGRVFWW 234

Query: 222 S 222
           S
Sbjct: 235 S 235


>gi|163854079|ref|YP_001642122.1| LexA repressor [Methylobacterium extorquens PA1]
 gi|218533024|ref|YP_002423840.1| LexA repressor [Methylobacterium chloromethanicum CM4]
 gi|163665684|gb|ABY33051.1| LexA repressor [Methylobacterium extorquens PA1]
 gi|218525327|gb|ACK85912.1| SOS-response transcriptional repressor, LexA [Methylobacterium
           chloromethanicum CM4]
          Length = 240

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/235 (13%), Positives = 68/235 (28%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + I +  +   + PS    K  LD  S +   R  +    R       + 
Sbjct: 1   MLTRKQLELLQFIQQRMQESGVPPSFDEMKDALDLKSKSGIHRLIMALEERGFLRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG----------- 107
            + +               S+ R       E  L   P +       +            
Sbjct: 61  ARAIEILRMPDMPAAKPASSEPRRFTPSVVEGGLSAKPAAPKPPMLQAHDGKGQSVMVPV 120

Query: 108 --VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
                 G   + +         +  +    +    + +  SM       GD+++++    
Sbjct: 121 MGRIAAGVPISAIESQSHSISMSPDFLSGGEHYALEVRGDSMIEAGILDGDLVVIHKQET 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N GD ++      +   K L  R G SI L + N  Y    +    +    +++
Sbjct: 181 ANNGDIIVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGKLV 234


>gi|331019765|gb|EGH99821.1| putative phage repressor [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 238

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 66/230 (28%), Gaps = 22/230 (9%)

Query: 11  EAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  +      L+    A + GLD +  ++      +   +  +T    KI       +
Sbjct: 6   QRISALRAAMAGLSQKDFANQHGLDASYLSQLLNGHRKLGEKAAATLE-EKINLHPGSLV 64

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH-- 127
              +                I       S                   V  PE       
Sbjct: 65  NPQVMSDSELTEAVMLDTPPIDSRTLMQSLGFITIPHLNVAASMGSGNVP-PESHIEVIR 123

Query: 128 ------------NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                          ++             SM   +R GD L+++  I     D + +  
Sbjct: 124 DITVHLDWLKTQGLAFSRIENLAIITGDGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFT 183

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI--LW 220
             GD+  K L    G S+ ++S N  YP   +E +D   +   AR+  +W
Sbjct: 184 LDGDLYIKRLQRMTGGSLRMISDNPLYPAIIIEGADLTKVHIQARVLLVW 233


>gi|188584409|ref|YP_001927854.1| LexA repressor [Methylobacterium populi BJ001]
 gi|179347907|gb|ACB83319.1| transcriptional repressor, LexA family [Methylobacterium populi
           BJ001]
          Length = 240

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/235 (13%), Positives = 70/235 (29%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++ + I +  +   + PS    K  LD  S +   R  +    R      P+ 
Sbjct: 1   MLTRKQLELLQFIQQRMQESGVPPSFDEMKDALDLKSKSGIHRLIMALEERGFLRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRT----------TEKKEKEIPLLYFPPSGSGGFFD 105
               +IL   +    + +                       +  +   +     S     
Sbjct: 61  ARAIEILRMPDLPAAKPVPSEPRRFTPSVVEGGLSGKPAAPKPPMLQAHDGNGQSVMVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
            G    G   + +         +  +    +    + +  SM       GD+++++    
Sbjct: 121 MGRIAAGTPISAIESQSHTISMSPDFLTGGEHYALEVRGDSMIEAGILDGDLVVIHKQDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N GD ++      +   K L  R G SI L + N  Y    +    +    +++
Sbjct: 181 ANNGDIIVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGKLV 234


>gi|59712644|ref|YP_205420.1| Cro/Cl family transcriptional regulator [Vibrio fischeri ES114]
 gi|59480745|gb|AAW86532.1| transcriptional repressor, Cro/CI family [Vibrio fischeri ES114]
          Length = 215

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 82/217 (37%), Gaps = 13/217 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
                 +  + +   LT S +A+ +G+  +S    ++   +     P  ES+  + +   
Sbjct: 2   DTFGSRLFHLRKARKLTQSSIAKASGVSRSSVTLWEQDTNK-----PKGESLMALASFLK 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             +  LL    S      K+E+E  ++       G +        G  WN + + ++   
Sbjct: 57  CDVNWLLTGQGS--PEPAKQEQETTVVSVALKPQGSYPVISWVQAG-GWNDIHLTDLHDA 113

Query: 127 HNGIYAIQ--TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAK 183
                 ++        K    SM P++R+G+++ ++  ++   G  ++ +         K
Sbjct: 114 DYYPCPVRCSKNTFLLKVVGKSMNPVFREGELIFVDPDVEAVNGKYVVARLDDENQATFK 173

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
            LI   G+   L + N  +P   + ++ +   +  ++
Sbjct: 174 QLIIEDGKKF-LQAANPDWPTPIIPINGNCTIVGVVI 209


>gi|257468732|ref|ZP_05632826.1| repressor LexA [Fusobacterium ulcerans ATCC 49185]
 gi|317062987|ref|ZP_07927472.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313688663|gb|EFS25498.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 229

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 63/220 (28%), Gaps = 15/220 (6%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    + + LA+  G+  + +N  +R  +         + +  IL  +++    
Sbjct: 6   FLRFKREELGYSQNKLAKTIGITQSYYNTIERGEVRNPPSEEILDKMIAILQLSDKEAAD 65

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----------GVFPTGNKWNTVGV 120
              L   +       E+   L     +                        G    T   
Sbjct: 66  FKYLAAIEKTPPLILEELKRLEKQKDAPPKADIYELKNFDNYIPLYSRISAGIGVFTEEG 125

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           P       GI  I         +  SM P  +   I++    ++V  G+        G+ 
Sbjct: 126 PVDFISIPGIRNID-TLFAVNVKGDSMEPTIKNSSIILCRKGVEVRNGEIGAFIVN-GES 183

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
             K L       I L+S N  Y    +    +   I ++L
Sbjct: 184 YVKRL-KITANYIALISDNPNYQPIYIGPGEEFSVIGKVL 222


>gi|324115562|gb|EGC09501.1| helix-turn-helix protein [Escherichia coli E1167]
          Length = 228

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 78/228 (34%), Gaps = 16/228 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    E+  ++ + LA K GL   S  K +        +    + I K+L  + 
Sbjct: 2   KTLAERLKIGREKAGMSQAQLAEKIGLSQQSVAKIENGET---LQPRKIKEIAKVLGVSQ 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-----VP 121
           + +   ++   S      K+ +   L                   G     V       P
Sbjct: 59  KWLQLGIEDNASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAEIVESAIDWFP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIKPRTGD 179
             R+         +     K    S+LP+   GD++ ++    + +  GD L        
Sbjct: 119 LRRADLRKSGVCASNAKIVKIWGNSLLPVLNNGDLVAVDISQTVPIRDGD-LYAVRDGVL 177

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
           +  K+LI+     + L S N   YP + +   D    I  I R+ W+S
Sbjct: 178 LRVKILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVFWSS 225


>gi|296160137|ref|ZP_06842956.1| putative phage repressor [Burkholderia sp. Ch1-1]
 gi|295889611|gb|EFG69410.1| putative phage repressor [Burkholderia sp. Ch1-1]
          Length = 222

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 76/223 (34%), Gaps = 26/223 (11%)

Query: 8   KIWEAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            + E I  + +    +    LA  AG+   + N+       G+ +    E    I     
Sbjct: 2   NLAERIQTVLDEVDGIDQVKLAEAAGVTKGTVNQWL----TGQIKSIKLEYAVGIQERFG 57

Query: 67  ETICQ-----------LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
                            +    +         K IP+L     G  GF+    +P G+  
Sbjct: 58  YNPVWLVMGKGSKKVPGIHHEDAFNPIPFPPGKRIPVLGMAQLGDNGFWAEVEYPVGHGE 117

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
             +  P                   +    SMLP  + G+ +++     V  GD +L+K 
Sbjct: 118 GYLDFPSR----------DRDAYGIRCVGDSMLPRIKDGEFVVIEPNHPVENGDEVLVKA 167

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           + G ++ K+L+ +R     LMS+N  +    +E   IE +  +
Sbjct: 168 KDGRVMIKILLYQRAGRTHLMSVNTEHAPLAIETEKIERLHYV 210


>gi|150021357|ref|YP_001306711.1| putative prophage repressor [Thermosipho melanesiensis BI429]
 gi|149793878|gb|ABR31326.1| putative prophage repressor [Thermosipho melanesiensis BI429]
          Length = 206

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 60/213 (28%), Gaps = 22/213 (10%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I E I  +  +  LT   L     +   + +  +          PS E +  +    + 
Sbjct: 2   NIGEKIKFLRLQKGLTQEQLGNIINVGQRTISAYESGKAT-----PSVEVLKSLADYFDV 56

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
            +   L              K   +  +                GN       P      
Sbjct: 57  AVDYFLSDKPGQTEVEFVDIKFKKVPLYS----------APVSAGNG----AFPNDIYVL 102

Query: 128 NGIYAIQTQ-DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
             I AI    D   K    SM P+   G +L +        GD ++     G I  K  +
Sbjct: 103 GEINAINHDVDFAVKVVGNSMEPIAPDGSVLFVKKQNYAFNGDMIVCTYD-GWIYVKWYV 161

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +    I L+S N  Y    VE  D   I  ++
Sbjct: 162 KQ-NDKILLLSENPTYTPIVVEPKDRFIIHGVV 193


>gi|330999679|ref|ZP_08323388.1| peptidase S24-like protein [Parasutterella excrementihominis YIT
           11859]
 gi|329574185|gb|EGG55761.1| peptidase S24-like protein [Parasutterella excrementihominis YIT
           11859]
          Length = 224

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 67/221 (30%), Gaps = 12/221 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +        L  S +AR   + P S +        G+++   +  + K+     
Sbjct: 2   KTLAERLTLALSDSGLKKSDIARLCSISPASVSDWF----TGKSKSIKSIYLPKVAKLLG 57

Query: 67  ETICQLLDLPFSDGRTTE-KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
            +   L               E+      +          +  F   +    +      +
Sbjct: 58  VSSTWLATGNGPMKSPNVLVTEEVCDDDDWVEIPEYKIRFAAGFEQNSTLEELASEYKAA 117

Query: 126 PHNGIY----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                +           R K +  SM PL    D+++++ +       R+        + 
Sbjct: 118 YRRSWFQRKNINPEDCKRFKVKGDSMEPLLLDHDVVLVDCSKTEIIDGRIYAFVFGNALR 177

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARIL 219
            K L  +   SI + S N  +  +T+   +   ++ I  ++
Sbjct: 178 VKRLYRKIDGSIVVHSENPNFEDETIKPVDTEQVQIIGEVI 218


>gi|260426266|ref|ZP_05780245.1| LexA repressor [Citreicella sp. SE45]
 gi|260420758|gb|EEX14009.1| LexA repressor [Citreicella sp. SE45]
          Length = 231

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 68/229 (29%), Gaps = 14/229 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + + I++  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLDFINKRMQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +                    +     P+              G    G
Sbjct: 61  ARAIEIVKLPESLGGRPAGFAPKVIDGDIPDSRPAAARPVATIEAMELQVL---GRIAAG 117

Query: 113 NKWNTV-GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
               ++   P   +   G+ +   +    + +  SM       GD++I+        GD 
Sbjct: 118 EPIQSIADNPPGIAVPTGMLSANARHYALEVRGDSMIEAGINDGDVVIIRETSSAENGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ +    +   K    + G +I L + N  Y    + +  ++   R++
Sbjct: 178 VVAQIEGYEATLKRFRRK-GDAIVLEAANPAYEPRVLPVGSVKVQGRLV 225


>gi|229008902|ref|ZP_04166256.1| hypothetical protein bmyco0002_56320 [Bacillus mycoides Rock1-4]
 gi|228752339|gb|EEM02013.1| hypothetical protein bmyco0002_56320 [Bacillus mycoides Rock1-4]
          Length = 218

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 68/219 (31%), Gaps = 17/219 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I + I ++ ++HNL+   L   AG+   + +  ++       + P    I KI       
Sbjct: 3   IGKNIKKLRDKHNLSQKELGEIAGVSDKAVSTWEKG-----LKEPRMGVIQKIADHFGIL 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              +++   S        + EI     P    G                V +P   +  +
Sbjct: 58  KSDIIEDQDSKVTHIRPNQPEIKNNCKPVPLLGAIAAGTPLEMVAVEEWVNIPVEITDCH 117

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                       +    SM  +     + +++  I++  GD   +     D   K     
Sbjct: 118 P------HAFLLRVVGDSMNKVVPPNALALIDPDIEIRNGDVAAVAVNGFDATLKRFYKF 171

Query: 189 RGR-SIDLMSLNCCYPVDTVEM-----SDIEWIARILWA 221
           +   +++  S N  +     +      + +    +++W 
Sbjct: 172 QDGVTLEPESYNPEHKTQFYDSKTQEFTPVVVKGKLVWY 210


>gi|240141533|ref|YP_002966013.1| SOS response transcriptional repressor, lexA [Methylobacterium
           extorquens AM1]
 gi|254564050|ref|YP_003071145.1| SOS response transcriptional repressor, lexA [Methylobacterium
           extorquens DM4]
 gi|240011510|gb|ACS42736.1| SOS response transcriptional repressor, lexA [Methylobacterium
           extorquens AM1]
 gi|254271328|emb|CAX27340.1| SOS response transcriptional repressor, lexA [Methylobacterium
           extorquens DM4]
          Length = 258

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/235 (13%), Positives = 68/235 (28%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + I +  +   + PS    K  LD  S +   R  +    R       + 
Sbjct: 19  MLTRKQLELLQFIQQRMQESGVPPSFDEMKDALDLKSKSGIHRLIMALEERGFLRRLPNR 78

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG----------- 107
            + +               S+ R       E  L   P +       +            
Sbjct: 79  ARAIEILRMPDMPAAKPASSEPRRFTPSVVEGGLSAKPAAPKPPMLQAHDGKGQSVMVPV 138

Query: 108 --VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
                 G   + +         +  +    +    + +  SM       GD+++++    
Sbjct: 139 MGRIAAGVPISAIESQSHSISMSPDFLSGGEHYALEVRGDSMIEAGILDGDLVVIHKQET 198

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N GD ++      +   K L  R G SI L + N  Y    +    +    +++
Sbjct: 199 ANNGDIIVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGKLV 252


>gi|293433433|ref|ZP_06661861.1| transcriptional regulator [Escherichia coli B088]
 gi|291324252|gb|EFE63674.1| transcriptional regulator [Escherichia coli B088]
          Length = 228

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 78/228 (34%), Gaps = 16/228 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    E+  ++ + LA K GL   S  K +        +    + I K+L  + 
Sbjct: 2   KTLAERLKIGREKAGMSQAQLAEKIGLSQQSVAKIENGET---LQPRKIKEIAKVLGVSQ 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-----VP 121
           + +   ++   S      K+ +   L                   G     V       P
Sbjct: 59  KWLQLGIEDNASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAEIVESAIDWFP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIKPRTGD 179
             R+         +     +    S+LP+   GD++ ++    + +  GD L        
Sbjct: 119 LRRADLRKSGVCASNAKIVQIWGNSLLPVLNNGDLVAVDISQTVPIRDGD-LYAVRDGVL 177

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
           +  K+LI+     + L S N   YP + +   D    I  I R+ W+S
Sbjct: 178 LRVKILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVFWSS 225


>gi|126731368|ref|ZP_01747175.1| LexA repressor [Sagittula stellata E-37]
 gi|126708279|gb|EBA07338.1| LexA repressor [Sagittula stellata E-37]
          Length = 231

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 64/229 (27%), Gaps = 14/229 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + + I++   R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLDFINKRMARDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +                R      +   +              G    G
Sbjct: 61  ARAIEIVKLPESLGGAPAGFSPRVIEGDRPDNTPGRATEINTL---DVTELPIMGRIAAG 117

Query: 113 NKWNTV-GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
               ++   P   +    +   Q +    + +  SM       GD++++        GD 
Sbjct: 118 VPIESINDEPPGIAVPGMMLKGQGRHYALEVRGDSMIEAGINDGDVVVIRETSDAADGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ +    +   K    + G  I L + N  Y    +   D+    R++
Sbjct: 178 VVAQIEGYEATLKRFRRK-GEMIVLEAANPAYEPRVLPRGDVNVQGRLV 225


>gi|254710961|ref|ZP_05172772.1| Peptidase family S24 [Brucella pinnipedialis B2/94]
 gi|256029343|ref|ZP_05442957.1| Peptidase family S24 [Brucella pinnipedialis M292/94/1]
          Length = 142

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 77/151 (50%), Gaps = 9/151 (5%)

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           +D          +    IPLL    +G+GG+FD   FP G  W+ V  P           
Sbjct: 1   MDSLPRHLGEYTQDPHPIPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTGEG----- 55

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                   +    SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+
Sbjct: 56  ----VYALEVSGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRT 111

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           I+L SLN  +P    E  DIEWIARILWASQ
Sbjct: 112 IELHSLNPEHPNRIFESKDIEWIARILWASQ 142


>gi|284006836|emb|CBA72100.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 230

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 83/224 (37%), Gaps = 24/224 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M + +  ++   I  + +  ++   + LAR+  +   + ++       G  + P    + 
Sbjct: 7   MITTT-DRLIRNIQVLMKERDIENVTELARRTRIPQPTMHRLI----SGEIKEPKYALLK 61

Query: 60  KILAATNETICQLLDLP--------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
           ++ +  N  + +L++                   + K IP+L     GS G+++   +P 
Sbjct: 62  QVASYFNIPVSELVEKDIGSSKLSSNVLKAEEIFQFKAIPVLGNAQLGSEGYWEELEYPI 121

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G     +  P                   K    SM P  + G+ +++        GD +
Sbjct: 122 GYGDGYINWPTK----------DPDAFALKCIGDSMKPRIKNGEYVVIEPNHTYLPGDEV 171

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
            I    G+ + K  +  R   I ++S+N  +P    +++ IE I
Sbjct: 172 FITTSEGEAMVKTFLYERDGVIVVISINENHPPLHFDINRIEKI 215


>gi|221196208|ref|ZP_03569255.1| phage repressor [Burkholderia multivorans CGD2M]
 gi|221202882|ref|ZP_03575901.1| phage repressor [Burkholderia multivorans CGD2]
 gi|221176816|gb|EEE09244.1| phage repressor [Burkholderia multivorans CGD2]
 gi|221182762|gb|EEE15162.1| phage repressor [Burkholderia multivorans CGD2M]
          Length = 230

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 71/220 (32%), Gaps = 28/220 (12%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + I  +          LA  AG+   + ++      +G+ +    E    I         
Sbjct: 14  DRIRAVLSETQAEQVELAEAAGVTKGTVSQWL----DGKIKSIKLEYAVGIQKRYGYNPV 69

Query: 71  Q---------LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                     +    +++    +   + +PL+    +G         FP G  +  +   
Sbjct: 70  WLVMGEGEKKMGTPGYANVAPAQVGSRRVPLISSVQAGRMTEAVD-PFPPGGAFEYL--- 125

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                      +       + +  SM P +  GD +I++ AIQ   GD ++ K    +  
Sbjct: 126 ------LTDLDLSDYAFALEIEGLSMAPDFNPGDRIIIDPAIQPRPGDFVVAKNGREEAT 179

Query: 182 AKVLISRRGR-----SIDLMSLNCCYPVDTVEMSDIEWIA 216
            K   +R        + +L+ LN  YP  + E   +  I 
Sbjct: 180 FKKYRARGVGADGREAFELIPLNPDYPTISSEHEQVRIIG 219


>gi|85058914|ref|YP_454616.1| hypothetical protein SG0936 [Sodalis glossinidius str. 'morsitans']
 gi|84779434|dbj|BAE74211.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 239

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 67/233 (28%), Gaps = 24/233 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
             +  +AI        L+ +  A K G   ++ ++      +   R    +   KI    
Sbjct: 12  RDQQLKAIKA-----GLSKADFAEKCGTSASTISQIL---GDKAGRNLGDDLARKIEKNL 63

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG---------SGGFFDSGVFPTGNKWN 116
                 L        + +E  E +I     P               F        G+   
Sbjct: 64  GLKHGWLDLQHHETQKNSEVHEAQIIGGIIPWDSKTSLYGDEVEVPFLKEVKISAGSGSL 123

Query: 117 TVG------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                    +   +S    +          +    SM P+   G  + ++   ++    +
Sbjct: 124 FQEDHNGYKLRFAKSTLRRLNVQPENAVCVEVIGNSMEPVLPDGSTVGVDLGNKIIKDGK 183

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
           +        +  KVL       I + S N   Y  +  + +++  I ++ W+S
Sbjct: 184 MYAIDYGDFLRVKVLYLMPKGKIRIRSYNQDEYDDEECDATEVTVIGKVFWSS 236


>gi|254490244|ref|ZP_05103434.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490560|ref|ZP_05103746.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490688|ref|ZP_05103873.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490854|ref|ZP_05104037.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490891|ref|ZP_05104074.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254490935|ref|ZP_05104117.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254491345|ref|ZP_05104525.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254491994|ref|ZP_05105172.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254492163|ref|ZP_05105338.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|254492671|ref|ZP_05105842.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|224462192|gb|EEF78470.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224462715|gb|EEF78989.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224462809|gb|EEF79080.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224463474|gb|EEF79743.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224463844|gb|EEF80111.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464026|gb|EEF80292.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464063|gb|EEF80329.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464144|gb|EEF80408.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464304|gb|EEF80567.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
 gi|224464591|gb|EEF80850.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
          Length = 272

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/267 (13%), Positives = 70/267 (26%), Gaps = 59/267 (22%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA---- 64
           I   I    +R  LT   +A   G+   S  K ++       R P    + KIL      
Sbjct: 7   IGGRILEERKRLRLTQQDVADFVGITRQSQAKYEKGE-----RSPDAIYLEKILGLGFNS 61

Query: 65  ----TNETICQLLDLPFSDGRTTEKKEKEIPLLYFP------------------------ 96
               T             D  ++           +                         
Sbjct: 62  YYVLTGNETFPTRSHLDVDDNSSSTHRNSNESETYEKRDRKSKVGQVDPTSNEEVGSSIK 121

Query: 97  ----------PSGSGGFFDSGVFPTGNKW---NTVGVPEIRSPHNGIY----AIQTQDTR 139
                      + +           GN +          +      IY    +       
Sbjct: 122 DYSAGTGSIMETFAHIPLFDVKASAGNGYVIHEEEETDALIFKKEWIYNELHSSPANLYL 181

Query: 140 HKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN 199
              +  SM P  R GD+++++    V   D + +      ++ K L     + + + S N
Sbjct: 182 IYVEGESMEPALRPGDVILVDHTDNVAKRDGIYVIRMGESLLVKRLQRLPSQRLKVTSDN 241

Query: 200 CCYPVDTVEMS-----DIEWIARILWA 221
             Y    + +      ++  I R++W+
Sbjct: 242 PAYEPFEISLDFDLQNELSIIGRVVWS 268


>gi|183599591|ref|ZP_02961084.1| hypothetical protein PROSTU_03072 [Providencia stuartii ATCC 25827]
 gi|188021839|gb|EDU59879.1| hypothetical protein PROSTU_03072 [Providencia stuartii ATCC 25827]
          Length = 207

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 78/210 (37%), Gaps = 19/210 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   I +  +  NLT + LA KAG+   S    +    + + R  +   I K L    ++
Sbjct: 3   LASRIRQRRQELNLTQTELAEKAGISQQSIESIENGRTK-KPR--NIIEIAKAL----QS 55

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
             + L    S    +E   + IPLL +  +G     +      GN +  + V +  S   
Sbjct: 56  HPEWLLNGKSIMPISEVNSRRIPLLSYVQAGLFKDANPITDYEGN-FEYILVDDDIS--- 111

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS- 187
                       + +  SM P +++GDI+++++ I  N G+ +  K        K     
Sbjct: 112 ------ANAFALRVEGDSMTPEFKEGDIVVIDTEIWPNPGEFVFAKNGGNQGTFKKYRPT 165

Query: 188 -RRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
                  +L+ LN  YP        I  I 
Sbjct: 166 GIGTGEFELVPLNPDYPTLNSHDYQISLIG 195


>gi|32266247|ref|NP_860279.1| hypothetical protein HH0748 [Helicobacter hepaticus ATCC 51449]
 gi|32262297|gb|AAP77345.1| hypothetical protein HH_0748 [Helicobacter hepaticus ATCC 51449]
          Length = 228

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/226 (10%), Positives = 64/226 (28%), Gaps = 21/226 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I   +  +   H +T    A + G+   +    +        R+     +  I       
Sbjct: 2   IGSKLVALRNEHQMTQKDFAERTGISYGTLQAYEYGTQS--PRYDYLTKVSDIFNVPMIF 59

Query: 69  ICQLLDLPFSDGRTT--------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
                    +             + ++ +  +   P +     +D  V   G+       
Sbjct: 60  FLDDDTSLGNSYTNPKGFVSDSLDVRKSDSLVSNNPSTIQIPIYDDVVASAGSGAINDEY 119

Query: 121 PEIRSPHNGIY-------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
           P      +  +       +     +    +  SM P   +   L++  ++    G   ++
Sbjct: 120 PTQSVGIDKGFLRTHFGLSSFLGLSIITAKGDSMSPTIPENCQLLVQKSV-PKEGQICVV 178

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +    ++  K L         L+S N  Y    +E  + + +  ++
Sbjct: 179 RID-DELYVKRLQKLP--KYRLISDNKSYENIELEGREYDIVGVVV 221


>gi|284008333|emb|CBA74709.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 230

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 77/232 (33%), Gaps = 16/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  H++I +A  R+A++  +T + LA K  + P S  + +      +NR      +  
Sbjct: 1   MKTM-HERIKQA--RLAKK--MTQAELAEKLSVTPQSVQQWETSTEPKKNRLMKIADVLD 55

Query: 61  ILAA---TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           I        E   +   L          +  E   L         F+ S     G+  N 
Sbjct: 56  INVNWLLFGEKKNKDGRLKNKMNFREISEWDESTPLEDDEV-EIPFYKSIELAAGSGCNE 114

Query: 118 ------VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
                   +   RS                    SM P+   G  + +N          +
Sbjct: 115 NKDYNGFKLRYSRSTLRRYGIPSKSVYAFTVHGNSMEPVIPNGATVFVNCCDNSIVDGGI 174

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIEWIARILWAS 222
               +      K+L+ + G+ + + S N   YP +  ++  ++ I R+  AS
Sbjct: 175 YFIEQDDLFRIKILLRQPGKKVIIRSFNSIEYPDEIADLDTVKVIGRVFNAS 226


>gi|259418887|ref|ZP_05742804.1| LexA repressor [Silicibacter sp. TrichCH4B]
 gi|259345109|gb|EEW56963.1| LexA repressor [Silicibacter sp. TrichCH4B]
          Length = 232

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 72/229 (31%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +    ++ E I +  ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLQLLEFIHKRLQKDGVPPSFDEMKTALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + ++  +             + G+     + E+  +    +G+      G    G
Sbjct: 61  ARAIEVIRLPDSLGGNPDSFQPKVIAGGKDQNAPKAELKPV--ADNGATELAVMGRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +              +   Q    + +  SM+      GD++++      + GD 
Sbjct: 119 VPIEAISQASAHVAVPNAMLSSAGQHYALEVRGDSMIDAGINDGDVVVIRETDAADNGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    + GR I+L + N  YP  +     ++   R++
Sbjct: 179 VVALVEGHEATLKRFERK-GRMIELHAANPAYPTRSYSEDQVKVQGRLV 226


>gi|47605801|sp|P61613|LEXA_RHOCA RecName: Full=LexA repressor
 gi|33340117|gb|AAQ14546.1|AF308861_1 LexA [Rhodobacter capsulatus]
          Length = 238

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 69/236 (29%), Gaps = 23/236 (9%)

Query: 3   SFSHKKI--WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST----- 55
             +HK++   + I +   R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTHKQLELLDFIQKRMARDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRMAHR 60

Query: 56  ----------ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                     ES+ +   A      Q    P     +  +  +         + +     
Sbjct: 61  ARALEIVKLPESMERAAEAERGLQTQPAFTPMLIAGSRTEPPRGALP---VAAAALDIPM 117

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAI 163
            G    G     +          G   + + +    + +  SM+      GDI+++ S  
Sbjct: 118 MGRIAAGVPIEAIAEVAHHVTVPGAMLSGRGEHYALEVKGDSMIQAGINDGDIVVIRSQP 177

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               GD ++      +   K    R G  I L + N  Y    +    ++   R++
Sbjct: 178 TAENGDIVVALVEDLEATLKRYYRR-GGMIALEAANPAYETRLLREDQVKVQGRLV 232


>gi|262277265|ref|ZP_06055058.1| repressor LexA [alpha proteobacterium HIMB114]
 gi|262224368|gb|EEY74827.1| repressor LexA [alpha proteobacterium HIMB114]
          Length = 226

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/228 (14%), Positives = 61/228 (26%), Gaps = 17/228 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNR--------W 52
           M +   K +   I+   +   ++PS    +  L+  S +   R       R         
Sbjct: 1   MLTKKQKNLLIYINEKLKNDGVSPSYDEMRQSLNLKSKSGIHRLISALEERGFVKRLAHK 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+              P         K K+     + P          +    
Sbjct: 61  ARALEVVKLPENAGVKDLYNNFTPSVISG-GLDKIKKEKEKKYIPVVGKIAAGLPIEAIE 119

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRL 171
           +    +  P   S  N  +         K +  SM+      GD +I+        G  +
Sbjct: 120 DSSENIPYPPNLSDKNDEF------YGLKVEGDSMINAGINDGDTVIIKKTNTAENGKIV 173

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K L  +   SI L S N  Y         ++    ++
Sbjct: 174 VALIDDHEATLKRLRKKTN-SIALESANPAYETRIFNPERVKIQGILV 220


>gi|312134838|ref|YP_004002176.1| XRE family transcriptional regulator [Caldicellulosiruptor
           owensensis OL]
 gi|311774889|gb|ADQ04376.1| transcriptional regulator, XRE family [Caldicellulosiruptor
           owensensis OL]
          Length = 230

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/205 (15%), Positives = 63/205 (30%), Gaps = 11/205 (5%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            I  + E+  L    +A+K  +   + +  +        R PS E + K     N +   
Sbjct: 17  RIRELREKQGLQQKDVAKKLNISNQALSNYELG-----KRMPSLEMVKKFADFFNVSTDY 71

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF-----PTGNKWNTVGVPEIRSP 126
           L+ L  S     +    +  L   P     G               +             
Sbjct: 72  LMGLTNSPNPNQDDDVVKKFLENNPDVRPVGKMIPIPIIGTVRAGSDGSLACEEYLGSEL 131

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                    +    + +  SM P   +GD++++     V  G+  ++     + V K +I
Sbjct: 132 VEVDTVKDGEYFFLRVKGDSMYPEIFEGDLVLVRKQPDVESGELAVVIVNGDEGVVKKVI 191

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSD 211
            +   +I L S+N  Y    +    
Sbjct: 192 KKEN-AIILQSVNPKYEPIVITEGQ 215


>gi|114764299|ref|ZP_01443527.1| LexA repressor [Pelagibaca bermudensis HTCC2601]
 gi|114543247|gb|EAU46264.1| LexA repressor [Roseovarius sp. HTCC2601]
          Length = 231

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 71/229 (31%), Gaps = 14/229 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + + I++  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLDFINKRLQRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +                R   +  K  P+     + +      G    G
Sbjct: 61  ARAIEIVKLPESLGGKPAGFTPQVIDGDRPDSRPAKAQPV---SNAEALELPLLGRIAAG 117

Query: 113 NKWNTV-GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
               ++   P   +    + +        + +  SM       GD++I+      + GD 
Sbjct: 118 EPIQSIADNPPNIAVPGAMLSSNAHHYALEVKGDSMIEAGIHDGDVVIIRETSSASNGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ +    +   K    + G +I L + N  Y    + +  ++   R++
Sbjct: 178 VVAQIEGYEATLKRFRRQ-GDTIVLEAENAAYEPRVLPLGAVKVQGRLV 225


>gi|156933191|ref|YP_001437107.1| hypothetical protein ESA_01002 [Cronobacter sakazakii ATCC BAA-894]
 gi|156531445|gb|ABU76271.1| hypothetical protein ESA_01002 [Cronobacter sakazakii ATCC BAA-894]
          Length = 229

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 70/228 (30%), Gaps = 19/228 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E + +  E+  L+   LA + GL   S  K +    E     P       +       
Sbjct: 4   LAERLKKAREKAGLSQLQLAEQVGLTQQSIAKIENGVTE----QPRKIKQLALALGVTAN 59

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-------GVP 121
             Q  D+  +   +    ++       P   +           GN              P
Sbjct: 60  WLQYGDIDANGSYSEMIVKEWESTSADPDLFTEIPILDIELSAGNGCEAEIVESELSTYP 119

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIKPRTGD 179
             R          +         +S+ P+   GD + ++      +  GD L        
Sbjct: 120 LRRDELRRAGVSASSARIVNILGSSLYPVLTNGDKVAVDLSQTSPIRDGD-LYALRDGVL 178

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
           +  K+LI+R    + L S N   YP + +   +    I  I R+ W+S
Sbjct: 179 LRVKILINRPDGGLILRSFNKDEYPDEVLTYEEKLARIHVIGRVFWSS 226


>gi|260567943|ref|ZP_05838412.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260154608|gb|EEW89689.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 132

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 56/141 (39%), Positives = 75/141 (53%), Gaps = 9/141 (6%)

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
              +   IPLL    +G+GG+FD   FP G  W+ V  P                   + 
Sbjct: 1   MYARPAPIPLLGMAEAGAGGYFDDAGFPAGQGWDIVEFPARTGEG---------VYALEV 51

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SMLPLYR GD LI+     V  GDR++++ R G+++AK+L  +  R+I+L SLN  +
Sbjct: 52  SGESMLPLYRDGDTLIVAPNAAVRRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEH 111

Query: 203 PVDTVEMSDIEWIARILWASQ 223
           P    E  DIEWIARILWASQ
Sbjct: 112 PNRIFESKDIEWIARILWASQ 132


>gi|294677883|ref|YP_003578498.1| LexA repressor [Rhodobacter capsulatus SB 1003]
 gi|294476703|gb|ADE86091.1| LexA repressor [Rhodobacter capsulatus SB 1003]
          Length = 238

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 69/236 (29%), Gaps = 23/236 (9%)

Query: 3   SFSHKKI--WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST----- 55
             +HK++   + I +   R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTHKQLELLDFIQKRMARDGVPPSFDEMKDALDLRSKSGIHRLITALEARGFIRRMAHR 60

Query: 56  ----------ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                     ES+ +   A      Q    P     +  +  +         + +     
Sbjct: 61  ARALEIVKLPESMERAAEAERGLQTQPAFTPTLIAGSRTEPPRGALP---VAAAALDIPM 117

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAI 163
            G    G     +          G   + + +    + +  SM+      GDI+++ S  
Sbjct: 118 MGRIAAGVPIEAIAEVAHHVTVPGAMLSGRGEHYALEVKGDSMIQAGINDGDIVVIRSQP 177

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               GD ++      +   K    R G  I L + N  Y    +    ++   R++
Sbjct: 178 TAENGDIVVALVEDLEATLKRYYRR-GGMIALEAANPAYETRLLREDQVKVQGRLV 232


>gi|167746119|ref|ZP_02418246.1| hypothetical protein ANACAC_00815 [Anaerostipes caccae DSM 14662]
 gi|167654634|gb|EDR98763.1| hypothetical protein ANACAC_00815 [Anaerostipes caccae DSM 14662]
          Length = 209

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/224 (12%), Positives = 54/224 (24%), Gaps = 28/224 (12%)

Query: 1   MTSFSHKKIWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M    +K I    I      +  T + +    G+  T+F    +       R    E + 
Sbjct: 1   MGGLGNKDIMANNIKYYMNLNGKTRNEMCEALGVKYTTFTDWVKGNT--YPRIDKIELMA 58

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                    + +   +                                    G   + V 
Sbjct: 59  NYFGIEKSDLVEQRSVNRKHNAVEINVLGR-------------------VAAGIPIDAVE 99

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                       A        +    SM P + +GD++I+         D ++      +
Sbjct: 100 EIIDTEEITEDMAKTGTFFGLQIHGNSMEPKFSEGDVVIVRQQDDAETDDIVIAIVNGDE 159

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARI 218
              K L       I L+S N  Y        +     ++ I  +
Sbjct: 160 ATCKKLKKYNDG-IVLISTNPAYEPMYFSNKEIMDKPVKIIGVV 202


>gi|256024105|ref|ZP_05437970.1| Repressor protein C2 [Escherichia sp. 4_1_40B]
          Length = 208

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/218 (12%), Positives = 69/218 (31%), Gaps = 24/218 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + + I  +      +   L +  G+   +    ++         P  E++ K+    N
Sbjct: 2   ETVGQRIKALRRVTGTSQKELGKFCGVSDVAVGYWEKDINT-----PGGEALSKLAKFFN 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +    +              + +P++ +  +G      +               E+   
Sbjct: 57  TS-IDYILYGAEFEGKLVTNMRRVPVISWVQAGQFTECRAAEV----------FSEVDKW 105

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDI 180
            +    I       + +  SM     LP   +G  +I++   +   G  ++ +   T + 
Sbjct: 106 VDTSLKIGDNSFALEVKGDSMTNPNGLPTIPEGATVIVDPDAEPRHGKIVIARLDGTNEA 165

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             K L+    +   L+ LN  YP   +  + +  I  +
Sbjct: 166 TVKKLVIDGPQKF-LVPLNPRYPNIPINGNCL-IIGVV 201


>gi|197285395|ref|YP_002151267.1| regulatory protein [Proteus mirabilis HI4320]
 gi|227355829|ref|ZP_03840222.1| repressor of rdgA and rdgB [Proteus mirabilis ATCC 29906]
 gi|194682882|emb|CAR43223.1| regulatory protein [Proteus mirabilis HI4320]
 gi|227164148|gb|EEI49045.1| repressor of rdgA and rdgB [Proteus mirabilis ATCC 29906]
          Length = 230

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 65/227 (28%), Gaps = 16/227 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I +          LT S LA  AG    S  + +    +   R      + K L      
Sbjct: 3   IAKRTKDKRIALGLTQSELATLAGTTQQSIEQLESGKTK---RPRFLPELAKALNCELSW 59

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYF------PPSGSGGFFDSGVFPTGNKWNTVG--- 119
           + +  +          + E      +              +F S     G+   T     
Sbjct: 60  LLEGDNKQTHASEIPPQDEWHSVSEWDNDTPLNADEVEIRYFKSIELAAGDGCCTNEDHN 119

Query: 120 ---VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
              +   +S      A             SM P+   G  + +++         +    +
Sbjct: 120 GYKLRFSKSTLRRYGASPQNVICFSVYGDSMSPVIPNGSTVTVDTGNTRIVDGGIYAIEQ 179

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
                 K+L  + G  + + S N   +P +  E+  ++ + R++  S
Sbjct: 180 DSLFRIKLLYRQPGGKLIIRSYNKDEFPDEFAEIDSVKIMGRVIHWS 226


>gi|56697019|ref|YP_167381.1| LexA repressor [Ruegeria pomeroyi DSS-3]
 gi|71648704|sp|Q5LRH4|LEXA_SILPO RecName: Full=LexA repressor
 gi|56678756|gb|AAV95422.1| LexA repressor [Ruegeria pomeroyi DSS-3]
          Length = 231

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/228 (14%), Positives = 62/228 (27%), Gaps = 12/228 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +   + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRLQADGVPPSFDEMKLALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +              DG   ++            +        G    G
Sbjct: 61  ARAIEIVKLPESLGGEPTVGFQPRVIDGDRPDRPRPANAEPVTIHAVELPVM--GRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
                +     +    G    + +    + +  SM       GD++++      + GD +
Sbjct: 119 VPIEAISQVSHQVAVPGSMVGKGEHYALEVKGDSMIEAGINDGDVVVIRETSTADNGDIV 178

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K    R   SI L + N  Y    +    +    R++
Sbjct: 179 VALVDDSEATLKRFFRRGA-SIALEAANPAYETRVLPSDRVRVQGRLV 225


>gi|117926204|ref|YP_866821.1| phage repressor [Magnetococcus sp. MC-1]
 gi|117609960|gb|ABK45415.1| putative phage repressor [Magnetococcus sp. MC-1]
          Length = 264

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/245 (12%), Positives = 65/245 (26%), Gaps = 27/245 (11%)

Query: 3   SFSHKK----------IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW 52
           + +H +          +   +        L+   LA KAG+     +K +    EG  + 
Sbjct: 17  TLTHPQNSDTLLLMDTLGHRLKDARLALGLSQKKLADKAGVSQGLIHKLETGFYEGTGQI 76

Query: 53  PSTESIFKIL-------AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                   +                        +   +                +     
Sbjct: 77  VPIAGALDVRPEWLHSGEQPRRWGNPQYKDLRENSSHSSADGSAHSGHTTSEGYALIPIY 136

Query: 106 SGVFPTGNKWNTV------GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
           S     G     +       +    S  +       +    + Q  SM P +  GD+L+L
Sbjct: 137 SVHASAGLGEEVIQEDVLDHLAFQTSWLSQKGLDPCKLGVIQAQGDSMYPTFDDGDVLLL 196

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIA 216
           +   +     ++ +      +  K L       I ++S N  Y    V   + E    + 
Sbjct: 197 DMGQREVVDGKVFVLRSEEYLYVKRLQILP-GRILIVSDNPKYQSVQVTREERELWKIVG 255

Query: 217 RILWA 221
           R++W 
Sbjct: 256 RVVWV 260


>gi|218296125|ref|ZP_03496894.1| peptidase S24 and S26 domain protein [Thermus aquaticus Y51MC23]
 gi|218243502|gb|EED10031.1| peptidase S24 and S26 domain protein [Thermus aquaticus Y51MC23]
          Length = 220

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 70/210 (33%), Gaps = 11/210 (5%)

Query: 5   SHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP---STESIFKI 61
           + +K   AI R      L+   L  + G      ++      +   R+      E++ ++
Sbjct: 6   TDEKAGLAIRRRMRELGLSQKELGARVGKSQAWVSQELLRTPKQVIRYLWARDPEAVQRL 65

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L     T  +           +E       + Y  P    G         G ++ T+ +P
Sbjct: 66  LHVLQWTPEEFSRETGIHIPGSEIPGAIPVVRYRIPVIDAGAGPPMWN-EGAEYITLHIP 124

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           E+R         + +    + +  SM P  R GDI++  +      G  + +      ++
Sbjct: 125 ELRGKR------EEELFAVRVKGDSMEPTLRDGDIVVFWTGGAPEPGRIVAVHVHWDGVI 178

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
            K L      S  L S N  +P   +  +D
Sbjct: 179 VKRLQRY-NGSWYLYSDNPDHPPVPLTEND 207


>gi|147677806|ref|YP_001212021.1| SOS-response transcriptional repressors [Pelotomaculum
           thermopropionicum SI]
 gi|146273903|dbj|BAF59652.1| SOS-response transcriptional repressors [Pelotomaculum
           thermopropionicum SI]
          Length = 224

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 65/222 (29%), Gaps = 26/222 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           KI   I +  E   LT + L  K G+  T+ N  ++       R    + ++++  A  +
Sbjct: 4   KIGARIKKAREEKYLTQAELGVKLGVSATAINYYEKG-----KRKIGIDDLYRMANALGK 58

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYF---------PPSGSGGFFDSGVFPTGNKWNTV 118
            +   L          +K+                   P          ++   N    +
Sbjct: 59  PLEYFLGRDVGSVGRGDKQPSGSNRENINNTFNDMTGIPVLGTVSAGELLYSEQNISGYL 118

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV-NCGDRLLIKPR 176
             P   +          +    + +  SM       GD++++     V   G  +     
Sbjct: 119 PFPRKMA--------DGKYFALRVKGDSMTGEGIYDGDLVLIRRQSHVDFNGQIVCALVN 170

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE--MSDIEWIA 216
             +   K+ +     +I L + N  YP   ++     +    
Sbjct: 171 GEENTLKIFLQDENGNILLKAANPAYPDIVLQHGKDALVIQG 212


>gi|148557717|ref|YP_001265299.1| putative phage repressor [Sphingomonas wittichii RW1]
 gi|148502907|gb|ABQ71161.1| putative phage repressor [Sphingomonas wittichii RW1]
          Length = 216

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 67/215 (31%), Gaps = 7/215 (3%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             +  A+D +        S ++R  G +P    +  +    G  R  S E   ++ A   
Sbjct: 3   DDVRSALDALIRERGEDYSAISRLLGRNPAYIQQFIKR---GSPRKLSEEDRLRLAAYFR 59

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
               +L                 +  +    +        G+     +   +   +    
Sbjct: 60  VPETRLGGRADGGPAGDMALAAALVTVPRI-AIGASAGPGGIAEIEERDRPIAFDDGLLR 118

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
             G    +   +  +    SM P    GD ++++          + +      ++ K L+
Sbjct: 119 DLGAGR-RAALSIIRVAGESMEPTLHDGDDILVDRDASEIRPGGIYVLRLDDLLMVKRLL 177

Query: 187 SRRGRSIDLMSLNCCYPVDT-VEMSDIEWIARILW 220
               R + + S N  +P     + + ++ I R+LW
Sbjct: 178 RD-DRGLVVHSDNPAHPEIAGFDPATLQVIGRVLW 211


>gi|117926057|ref|YP_866674.1| phage repressor [Magnetococcus sp. MC-1]
 gi|117609813|gb|ABK45268.1| putative phage repressor [Magnetococcus sp. MC-1]
          Length = 264

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/245 (13%), Positives = 66/245 (26%), Gaps = 27/245 (11%)

Query: 3   SFSHKK----------IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW 52
           + +H +          +   +        L+   LA KAG+     +K +    EG  + 
Sbjct: 17  TLTHPQNSGTLLLMDTLGHRLKDARLALGLSQKKLADKAGVSQGLIHKLETGFYEGTGQI 76

Query: 53  PSTESIFKIL-------AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                   +                        +   +                +     
Sbjct: 77  VPIAGALDVRPEWLHSGEQPRRWGNPQYKDLRENSSHSSADGSAPSGHTTSEGYALIPIY 136

Query: 106 SGVFPTGNKWNTV------GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILIL 159
           S     G     +       +    S  +       +    +TQ  SM P +  GD+L+L
Sbjct: 137 SVHASAGLGEEVIQEDVLDHLAFQTSWLSQKGLDPCKLGVIQTQGDSMYPTFDDGDVLLL 196

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIA 216
           +   +     ++ +      +  K L       I ++S N  Y    V   + E    + 
Sbjct: 197 DMGQREVVDGKVFVLRSEEYLYVKRLQILP-GRILIVSDNPKYQSVQVTREERELWKIVG 255

Query: 217 RILWA 221
           R++W 
Sbjct: 256 RVVWV 260


>gi|273810436|ref|YP_003344907.1| CI phage repressor [Xylella phage Xfas53]
 gi|257097811|gb|ACV41117.1| CI phage repressor [Xylella phage Xfas53]
          Length = 336

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 67/222 (30%), Gaps = 15/222 (6%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             I  + +   ++ S +A    +   + +  KR G   +  + +  +  K+         
Sbjct: 107 RFIAALGKNREVSQSAIATLCNVSEQAVSGWKRTGRIDKKHFAALSTALKV--PLEYWYG 164

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW---NTVG----VPEI 123
           +              +  +      P +G            G        V     +P  
Sbjct: 165 EAYGAERVGIDVRRIRAVDGEEGTDPETGVMIPVYDLEVSGGPGCTVPEYVETRYKLPFQ 224

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +      A        K + +SM  +   GD +++++       D +      G+   K
Sbjct: 225 INWLRTWDAKPNDILIAKVRGSSMEDVLYDGDKVVIHTKRTRIRNDAVYALVYGGEARIK 284

Query: 184 VLISRRGRSIDLMSLNCC---YPVDTVEMS---DIEWIARIL 219
            L      S+ ++S N     +P + V+      +  I +++
Sbjct: 285 RLFVMADGSLRIVSHNPDKGRFPDEVVQPDNLEQVSIIGQVI 326


>gi|195953192|ref|YP_002121482.1| putative phage repressor [Hydrogenobaculum sp. Y04AAS1]
 gi|195932804|gb|ACG57504.1| putative phage repressor [Hydrogenobaculum sp. Y04AAS1]
          Length = 205

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 72/213 (33%), Gaps = 20/213 (9%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I + +  + E   ++   LA+  G D  SF +       G+   P  E +  I  A   
Sbjct: 2   NIGQRLKYIRESKGISRRELAKMMGKDEVSFEQYLYKLESGKILNPGIELVESISKALGI 61

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           +   LL+     G           +   P         + ++     +    +P      
Sbjct: 62  SPKDLLEKQEEHGDIE-------TVFAIPIVDVKAGAGNPLYAEEYIYVNDIIPSRYLS- 113

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA-IQVNCGDRLLIKPRTGDIVAKVLI 186
                        K +  SM P+ + G+ +I++++   +  G   +I  + G ++ + + 
Sbjct: 114 -----------AIKIKGDSMEPIIKDGEYVIIDTSSKDIINGKIYVISDKDGGLLVRRIY 162

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                   L+  N  Y    V+ SDI  I + +
Sbjct: 163 KLNDGFFRLLPENEAYKSQDVKASDIRIIGKAI 195


>gi|170744745|ref|YP_001773400.1| LexA repressor [Methylobacterium sp. 4-46]
 gi|229621226|sp|B0UGH4|LEXA_METS4 RecName: Full=LexA repressor
 gi|168199019|gb|ACA20966.1| transcriptional repressor, LexA family [Methylobacterium sp. 4-46]
          Length = 239

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/234 (13%), Positives = 64/234 (27%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +     +   I +      + PS    K  LD  S +   R       R      P+ 
Sbjct: 1   MLTRKQLDLLRFIQQRMRETGVPPSFDEMKDALDLKSKSGIHRLITALEERGFLRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDG---------RTTEKKEKEIPLLYFPPSGSGGFFDS 106
               +++           ++                 +       L+      +      
Sbjct: 61  ARAIEVIRIPEAVASGPAEVVRFTPSVVEGGRSSAPVKPAPLPTALVSDESGHAVSIPVM 120

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQV 165
           G    G   + +         +  +    +    + +  SM       GD++++      
Sbjct: 121 GRIAAGTPISAIQSQSRSVAMSPDFLAGGEHYALEVRGDSMIEAGILDGDLVVIRRQDTA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           N GD ++      +   K L  R G SI L + N  Y    +    +    R++
Sbjct: 181 NTGDIVVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGRLV 233


>gi|240948773|ref|ZP_04753145.1| phage repressor [Actinobacillus minor NM305]
 gi|240296989|gb|EER47567.1| phage repressor [Actinobacillus minor NM305]
          Length = 218

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 76/224 (33%), Gaps = 23/224 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            S++ + + I    +   LT   LA    G+   + ++ +    +     P+ E+I  + 
Sbjct: 1   MSNQTLGDRIRNRRKELKLTQKDLATALKGVSHVAISQWESNTTK-----PNAENILDLS 55

Query: 63  AATNETICQL-LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                 I  L      S+         +IPL+ +  +G     D      G+ +  +   
Sbjct: 56  TVLQCEISWLLRGNGESNVVPASIGMTKIPLISYIQAGQWTGIDDFRETCGD-YEYI--- 111

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                      +       + +  SM P + +GD++I++     + G+ +       +  
Sbjct: 112 ------LTDLDVSDDAFALEIKGDSMTPDFLEGDVVIIDPNEPPHAGEFVAAINGNYEAT 165

Query: 182 AKVLISRRG------RSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K                +L++LN  YP  +    +I  I  ++
Sbjct: 166 FKKYRPLGEVDNFGREHFELIALNPDYPKLSTLKQEIRIIGTMV 209


>gi|215479977|ref|YP_002332426.1| c repressor [Pseudomonas phage MP29]
 gi|169409241|gb|ACA57646.1| c repressor [Pseudomonas phage MP29]
          Length = 240

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 76/230 (33%), Gaps = 22/230 (9%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
            +F+ + +   I  +A     +   LA++ G+  T   +  +            E +  I
Sbjct: 20  PTFTQE-VGTRIAEVARLLG-SRRALAKQVGIHETQLYRYIKGINAAAP-----ELLSAI 72

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---- 117
             A   ++  L++         E  +                   G    G+   T    
Sbjct: 73  AKAGRVSLDWLINGEEVAATPAEGAKS------IEGEYVYIPLYDGQVSAGHGSWTDGAT 126

Query: 118 --VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
             V +   R          +  +  +    SM PL   GD ++++          + +  
Sbjct: 127 VLVNLAFTRYSLRKKGLDPSSISAIRIGGDSMEPLLCDGDTVLVDHTKSTVQDAAVYVVR 186

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE---MSDIEWIARILWAS 222
               + AK L  R   S+ ++S N  Y    V    +SD+E I R++WAS
Sbjct: 187 LDDHLYAKRLQRRFDGSVSIISENKAYTEMIVPKAKLSDLEIIGRVVWAS 236


>gi|319775381|ref|YP_004137869.1| hypothetical protein HICON_07210 [Haemophilus influenzae F3047]
 gi|329122603|ref|ZP_08251182.1| XRE family transcriptional regulator [Haemophilus aegyptius ATCC
           11116]
 gi|317449972|emb|CBY86184.1| Putative uncharacterized protein [Haemophilus influenzae F3047]
 gi|327472617|gb|EGF18046.1| XRE family transcriptional regulator [Haemophilus aegyptius ATCC
           11116]
          Length = 229

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 67/232 (28%), Gaps = 26/232 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  S       +  + E   L+ +  ++  G+   + +      + G+ R P   +I +
Sbjct: 1   MSDLS-----TRLKTLLEEKGLSMNAFSKMVGVSQPAISDI----VSGKTRSPK--NIVE 49

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT-GNKWNTVG 119
           I  A    +  L +          +                            +      
Sbjct: 50  IATALGVDVNWLKNGEGD--SEIGRITAYCHSEKDNEHTLRVDLLDVNLAAYSSGIINAE 107

Query: 120 VPEIRSP----HNGIYAIQTQD-----TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            P I S       G   I  +         +    SM+P  ++ DI+ +++ I+   G+ 
Sbjct: 108 YPNIVSSLYFTEEGANRILGRTTTNGVYMFRVPTDSMVPTIKQTDIVFIDTNIKHYIGEG 167

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM---SDIEWIARIL 219
           +      G+   K L       I  +S N  Y    +          I + +
Sbjct: 168 IYAFSLNGEEYIKRLQRLPTGVIRALSDNKHYEPFDITEELFDSAVIIGKFI 219


>gi|161345277|gb|ABX64473.1| putative phage repressor [Pseudomonas syringae]
          Length = 238

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 64/229 (27%), Gaps = 20/229 (8%)

Query: 11  EAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  +      L+    A + GLD +  ++      +   +  +T    KI       +
Sbjct: 6   QRISALRAAMAGLSQKDFANQHGLDASYLSQLLNGHRKLGEKAAATLE-EKINLHPGSLV 64

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              L                +       S                   V           
Sbjct: 65  NPELLSGSDTAEIIVPAVAPVDSRTVMQSLGFITIPHLDVAASMGSGNVPPDSQIEVIKD 124

Query: 130 -------------IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                         ++             SM   +R GD L+++  I     D + +   
Sbjct: 125 ITVHLDWLKTQGLAFSRIENLAIITGDGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTL 184

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI--LW 220
            GD+  K L    G ++ ++S N  YP   +E +D   +   AR+  +W
Sbjct: 185 DGDLYIKRLQRMTGGALRMISDNPLYPAIIIEGADLTKVHIQARVLLVW 233


>gi|145631924|ref|ZP_01787679.1| hypothetical protein CGSHi22421_00742 [Haemophilus influenzae
           R3021]
 gi|260582515|ref|ZP_05850306.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae NT127]
 gi|144982429|gb|EDJ89999.1| hypothetical protein CGSHi22421_00742 [Haemophilus influenzae
           R3021]
 gi|260094495|gb|EEW78392.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae NT127]
          Length = 231

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 67/233 (28%), Gaps = 26/233 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  S       +  + E   L+ +  ++  G+   + +      + G+ R P   +I +
Sbjct: 1   MSDLS-----TRLKTLLEEKGLSMNAFSKMVGVSQPAISDI----VSGKTRSPK--NIVE 49

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN-KWNTVG 119
           I  A    +  L                 +             +       G+       
Sbjct: 50  IATALGVDVNWLKTGEGEPIAQGSLISSLVSTDSDEHHRFRVDYLDVQAAAGHSGIENAD 109

Query: 120 VPEIRSPHNGIY---------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            PE+                 +     +       SM+P   KGDI+ +++ +    G+ 
Sbjct: 110 YPEVIQSIYFSKEGLLEIVGKSTNDGISLINVPTDSMVPTINKGDIVFVDTKVNYYTGEG 169

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI----EWIARIL 219
           +      G    K L+         +S N  YP   +   ++      I + +
Sbjct: 170 VYFFLLNGGAYIKRLMKLPTGVYRAISDNSVYPDFDIS-DELFDTAVIIGKFI 221


>gi|260845233|ref|YP_003223011.1| putative phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|257760380|dbj|BAI31877.1| predicted phage repressor [Escherichia coli O103:H2 str. 12009]
 gi|309702933|emb|CBJ02264.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 224

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 86/224 (38%), Gaps = 24/224 (10%)

Query: 5   SHKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           +   + + I  + ++  ++  + LAR+  L+  + ++     + G  + P   ++ +I  
Sbjct: 4   TTDILSQNIKYLMDKAKISSITELARRLQLNQPTLHRL----VSGEVKDPKYATLKQIAD 59

Query: 64  ATNETICQLLDLPFSDGRTTEK---------KEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
             + +   L +    +    +          +  ++P+L     G GG +    +  G+ 
Sbjct: 60  YFHVSPIDLAERSLQEMEKEDATGIKTYISLRFNKVPVLGNTQLGVGGLWSDTQYSVGSS 119

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
              +  P                   K    SM+P  ++G+ +I+        GD +L+ 
Sbjct: 120 DGFIYWPTK----------DEDAYALKCVGDSMMPRIKEGEFVIVEPNHDYTPGDEVLVV 169

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            R G+++ K  +  R     LMS+N  +P   V   +IE I  +
Sbjct: 170 TREGEVMVKTFLFERDGLFHLMSVNEDHPPVRVPRENIEKIHYV 213


>gi|84503087|ref|ZP_01001183.1| LexA repressor [Oceanicola batsensis HTCC2597]
 gi|84388631|gb|EAQ01503.1| LexA repressor [Oceanicola batsensis HTCC2597]
          Length = 233

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 68/229 (29%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +        +      G                 + +      G    G
Sbjct: 61  ARAIEIVKLPDSLGGDGGGFVPRVIDGGAGPADPPLGDTRP-VEAAHALELPVMGRIAAG 119

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +          G   + + +    + +  SM+      GD++++      + GD 
Sbjct: 120 VPIEAINQVSHHVAVPGSMLSGRGEHFALEVRGDSMIDAGINDGDVVVVRETGSADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G+ I+L++ N  Y    +  + ++   R++
Sbjct: 180 VVALVDEQEATLKRFFRRSGQ-IELVAANPAYETRVLPDNRVKVQGRLV 227


>gi|33341104|gb|AAQ15118.1| LexA [Paracoccus denitrificans]
          Length = 233

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/234 (13%), Positives = 63/234 (26%), Gaps = 22/234 (9%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE---- 56
           M +    ++ E I     R  + PS    K  LD     +SK      R+R   T     
Sbjct: 1   MLTRKQIQLLEFIQARMARDGVPPSFDEMKLALDL----RSKSGNSPPRDRPXGTRGSSA 56

Query: 57  ---------SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
                     I ++  + ++       +                +     +        G
Sbjct: 57  ACRIAPVRWEIVRLPESLSKGPGFQPRVIEGTMPDRPGPLPRGAMEVSVSAIELPVM--G 114

Query: 108 VFPTGNKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQV 165
               G     +              + Q +    + +  SM       GD++++      
Sbjct: 115 RIAAGLPIEAISEISHHIAVPTTMLSGQDRHYALEVRGDSMIEAGINDGDVVVIREQNAA 174

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             GD ++      +   K    + G  I L + N  Y    +    +    R++
Sbjct: 175 ESGDIVVALVDGYEATLKRYRRK-GNMIALEAANPAYETRVLPEDKVRIQGRLV 227


>gi|301386007|ref|ZP_07234425.1| putative phage repressor [Pseudomonas syringae pv. tomato Max13]
 gi|302058863|ref|ZP_07250404.1| putative phage repressor [Pseudomonas syringae pv. tomato K40]
          Length = 238

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 64/229 (27%), Gaps = 20/229 (8%)

Query: 11  EAIDRMA-ERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  +      L+    A + GLD +  ++      +   +  +T    KI       +
Sbjct: 6   QRISALRTAMAGLSQKDFANQHGLDASYLSQLLNGHRKLGEKAAATLE-EKINLHPGTLV 64

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              L                +       S                   V           
Sbjct: 65  NPELSSGSDAAEIIVPTVAPVDSRTVMQSLGFITIPHLDVAASMGSGNVPPDSQIEVIKD 124

Query: 130 -------------IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                         ++             SM   +R GD L+++  I     D + +   
Sbjct: 125 ITVHLDWLKTQGLAFSRIENLAIITGDGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTL 184

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI--LW 220
            GD+  K L    G ++ ++S N  YP   +E +D   +   AR+  +W
Sbjct: 185 DGDLYIKRLQRMTGGALRMISDNPLYPAIIIEGADLTKVHIQARVLLVW 233


>gi|229590309|ref|YP_002872428.1| e14 prophage; putative phage repressor [Pseudomonas fluorescens
           SBW25]
 gi|229362175|emb|CAY49077.1| e14 prophage; putative phage repressor [Pseudomonas fluorescens
           SBW25]
          Length = 235

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 84/229 (36%), Gaps = 25/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            S K +   I    E+  L+ + LA+  G      ++S+    E   R P+ + I KI  
Sbjct: 20  RSMKTLGSRIAHYREKAGLSQAALAKACGWK----SQSRIGNYEKDAREPNLDDISKIAH 75

Query: 64  ATNETICQLLDLPFSD----GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                   LL    S           K    P++ +  +G+        +P G   +T  
Sbjct: 76  ELKIDPAALLLPGESPSNISIAAQPTKSFRYPVVSWVAAGAWAEAVE-PYPAG-ISDTYE 133

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSML----PLYRKGDILILNSAIQVNCGDRLL-IK 174
             E        Y  +        +  SM         +G ++++++  +V  G  ++   
Sbjct: 134 FSE--------YDSKGPAFWLTVKGDSMTAPAGQSITEGTLILVDTEAEVAPGKLVVAKL 185

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           P + +   K L+S  G  + L  LN  YP++ V+  +   +  ++ A Q
Sbjct: 186 PDSNEATFKKLVSD-GGRLFLKPLNPSYPIEAVD-ENCRIVGVVVQALQ 232


>gi|262043414|ref|ZP_06016539.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039240|gb|EEW40386.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 207

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 67/211 (31%), Gaps = 21/211 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-STESIFKILAATNE 67
           +            +T + +A  AG+   S    +     GR R P +   + K L  +  
Sbjct: 3   LAARFKARRIELGMTQTEVANVAGVSQQSIESIE----SGRTRKPRNVLELAKALKCSP- 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                L    +     E   + IP+L +  +G            G  +  V         
Sbjct: 58  ---DWLLNGKNIMPLAEVSTRHIPILSYVQAGQCTEARDYTNMEGE-FEYVLADAD---- 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                +       +    SM P +++GDI+I++  +    G+ ++ K    +   K    
Sbjct: 110 -----VPETCFALRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNNGHEATFKKYRP 164

Query: 188 RRGR--SIDLMSLNCCYPVDTVEMSDIEWIA 216
                   +L+ LN  YPV       +  I 
Sbjct: 165 LGIGIEDFELVPLNPDYPVLRSAELPLRVIG 195


>gi|238898738|ref|YP_002924420.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466498|gb|ACQ68272.1| APSE-2 prophage; cI [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 260

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 84/232 (36%), Gaps = 32/232 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M   +  K+ + I ++     + + + L+R+ G+   + ++       G  + P  + I 
Sbjct: 29  MGMMT-AKLNKNIKKLMAEKGVKSVAELSRRIGMPQPTLHRML----SGEVKSPRLKIIQ 83

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG----------------GF 103
           KI         +LL         + + + +        +                   G+
Sbjct: 84  KIADFFRVEANELLYKDLITSHISIENKTKAYERVEVKAIPFNFCKVPVLGTTQLGGGGY 143

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
           ++S     G+ +  +  P                   + Q  SM+P  + G+ +++    
Sbjct: 144 WNSKESSAGHDYGYIIWPTE----------DRDAFALRCQGESMMPRIQHGEFVVMEPNH 193

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           +   GD +L++   G ++ K  + +R   + L+S+N  +P   +  S IE I
Sbjct: 194 KYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAASTIEKI 245


>gi|218555126|ref|YP_002388039.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361894|emb|CAQ99494.1| putative repressor CI from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 224

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 86/224 (38%), Gaps = 24/224 (10%)

Query: 5   SHKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           +   + + I  + ++  ++  + LAR+  L+  + ++     + G  + P   ++ +I  
Sbjct: 4   TTDILSQNIKYLMDKAKISSITELARRLQLNQPTLHRL----VSGEVKDPKYATLKQIAN 59

Query: 64  ATNETICQLLDLPFSDGRTTEK---------KEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
             + +   L +    +    +          +  ++P+L     G GG +    +  G+ 
Sbjct: 60  YFHVSPIDLAERSLQEMEKEDATGIKTYISLRFNKVPVLGNTQLGVGGLWSDTQYSVGSS 119

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
              +  P                   K    SM+P  ++G+ +I+        GD +L+ 
Sbjct: 120 DGFIYWPTK----------DEDAYALKCVGDSMMPRIKEGEFVIVEPNHDYTPGDEVLVV 169

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            R G+++ K  +  R     LMS+N  +P   V   +IE I  +
Sbjct: 170 TRDGEVMVKTFLFERDGLFHLMSVNEDHPPVRVPRENIEKIHYV 213


>gi|254224901|ref|ZP_04918516.1| transciptional regulator [Vibrio cholerae V51]
 gi|125622589|gb|EAZ50908.1| transciptional regulator [Vibrio cholerae V51]
          Length = 264

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 69/241 (28%), Gaps = 26/241 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPSG----LARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
            K+  + + +      +   G    +A+K G+ P + +K          R    E I   
Sbjct: 23  RKEFAQRLAQACNDAGIDAHGRGVIIAKKIGVTPKAVSKWLNAESM--PRQNKMEEIANF 80

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-------FFDSGVFPTGNK 114
           L  +   +       FS+ +          +  +  S   G       F        GN 
Sbjct: 81  LGVSLFWLQYGKQESFSEVKEKPNAYMLGEMQEWDSSTPLGDDEVMVPFLSDVRLSAGNG 140

Query: 115 WNTVG-------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
           +           +   +S                    SM P+   G  + +N A +   
Sbjct: 141 FLNEEELDNGFKLRFAKSTLRRYGVCAKDAVCVSVSGNSMEPVLPDGSTVGINRADRTLS 200

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIE-----WIARILWA 221
             ++      G++  K L    G  + + S N   YP      + +       I R+ W 
Sbjct: 201 DGKIYAINHNGELFIKRLYKLPGGGVRIYSFNEIEYPPREYTEAQVVEQKISIIGRVFWY 260

Query: 222 S 222
           S
Sbjct: 261 S 261


>gi|218547977|ref|YP_002381768.1| Cro/CI family transcriptional regulator [Escherichia fergusonii
           ATCC 35469]
 gi|218355518|emb|CAQ88129.1| putative transcriptional regulator, Cro/CI family from phage origin
           [Escherichia fergusonii ATCC 35469]
          Length = 228

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 77/228 (33%), Gaps = 16/228 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E +    E   ++ + LA K GL   S  K +        +    + I K+L  + 
Sbjct: 2   KTLAERLKIGREIAGMSQAQLAEKIGLSQQSVAKIENGET---LQPRKIKEIAKVLGVSQ 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-----VP 121
           + +   ++   S      K+ +   L                   G     V       P
Sbjct: 59  KWLQLGIEDNASIPDLVVKEAESTALDPDIFVNIPVLDVELSAGNGCLAEIVESAIDWFP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN--SAIQVNCGDRLLIKPRTGD 179
             R+         +     K    S+LP+   GD++ ++    + +  GD L        
Sbjct: 119 LRRADLRKSGVCASNAKIVKIWGNSLLPVLNNGDLVAVDISQTVPIRDGD-LYAVRDGVL 177

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD----IEWIARILWAS 222
           +  K+LI+     + L S N   YP + +   D    I  I R+ W+S
Sbjct: 178 LRVKILINLPDGGLILRSFNKDEYPDEILTFEDRRARIHVIGRVFWSS 225


>gi|154253617|ref|YP_001414441.1| LexA repressor [Parvibaculum lavamentivorans DS-1]
 gi|171769676|sp|A7HY01|LEXA_PARL1 RecName: Full=LexA repressor
 gi|154157567|gb|ABS64784.1| SOS-response transcriptional repressor, LexA [Parvibaculum
           lavamentivorans DS-1]
          Length = 237

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 27/232 (11%), Positives = 62/232 (26%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++   I    +   ++PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQHELLMFIHERIKEGGVSPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLPHR 60

Query: 53  PSTESIFKILA----ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
                I K+      +      +       +G    K              +      G 
Sbjct: 61  ARALEILKLPDAASPSLAMARGRGFSPSVIEGGAQPKPSSRDLAPARSSGDTMTLSVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNC 167
              G     +     +           +    + +  SM       GD +++        
Sbjct: 121 IAAGTPIEALQEESHQVSVPLNLLGSGEHYALEVKGDSMIEAGILDGDTVLIQRCDTATS 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K L  ++G SI L + N  Y         ++   +++
Sbjct: 181 GDIVVALVDGYEATLKRL-RKKGDSIALEAANPAYETRIFGPDRVKVQGKLV 231


>gi|332981967|ref|YP_004463408.1| SOS-response transcriptional repressor, LexA [Mahella australiensis
           50-1 BON]
 gi|332699645|gb|AEE96586.1| SOS-response transcriptional repressor, LexA [Mahella australiensis
           50-1 BON]
          Length = 207

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 61/222 (27%), Gaps = 31/222 (13%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESI 58
           +   K+I + I  + E     PS   +    GL  TS      KR   +G  +   T+  
Sbjct: 6   TVKQKQILDFIKSITEERGYPPSIREIGDAVGLSSTSTVHGYLKRLEAKGAIKRDPTK-- 63

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
                           +    G  ++ +      L   P          +    N     
Sbjct: 64  -------------PRAMEVIYGEPSDDENISKVELANIPVLGRVAAGQPILAQENIEEYF 110

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTS-MLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
            +P         +   ++    + +  S         D +++        GD ++     
Sbjct: 111 PLPLD-------FIQNSEAFMLRVKGDSMYEAGILDNDYIVVRKQETAQNGDIVVALID- 162

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            D   K         I L   N       V+  D++ + +++
Sbjct: 163 DDATVKRFYKEED-HIRLQPENPFMQPIIVK--DVKILGKVI 201


>gi|144898408|emb|CAM75272.1| Peptidase S24, LexA repressor [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 236

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 54/231 (23%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +    ++   ID       ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQYELLMFIDERLRATGISPSFDEMKDALDLKSKSGIHRLITGLEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETI---CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
                + K+     +           P        +            + +      G  
Sbjct: 61  ARALEVVKLPDNLGDQPLPAPSAKFSPTVIQGNFTQTVFAGAAPVAGVADAVSLPLYGKI 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +                        +  SM       GD +I+ S      G
Sbjct: 121 AAGTPIEALRDHSNSVEVPAALLTGGDHYALTVEGDSMIEAGILDGDTVIIRSCDTAEAG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             ++      +   K L  +   SI L   N  Y         ++   R++
Sbjct: 181 TIVVALVDDQEATLKRLRRKGA-SIALEPANKAYETRIFPPDRVKVQGRLV 230


>gi|153001080|ref|YP_001366761.1| putative phage repressor [Shewanella baltica OS185]
 gi|151365698|gb|ABS08698.1| putative phage repressor [Shewanella baltica OS185]
          Length = 225

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 68/222 (30%), Gaps = 16/222 (7%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            E   +T   LA +A +     +K     ++   +  +  +  +  A   +   +     
Sbjct: 1   MEAIGMTQKELAERADISQVMVHKLVSGKVKTTGKLLNIAAALRCTAEELQYGEEGAKAK 60

Query: 77  FSDGRTTEKKEKEIPLLYFPPSG------SGGFFDSGVFPTGNKW-NTVGV-----PEIR 124
            ++   +  +      ++   +          F+       G+   +            +
Sbjct: 61  AANRIESNAEWAGGFEIWDSDTPLGEDEVEIPFYMEVELAAGDGILDCREFKGPKLRFTK 120

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
           S               K    SM P+   G  + ++++       ++      G +  KV
Sbjct: 121 STLKRQGVNSDYAACVKVNGNSMEPILPHGSTVGVDTSATDVIDGKMYAINHDGMLRIKV 180

Query: 185 LISRRGRSIDLMSLNCC-YPVDTVEMS---DIEWIARILWAS 222
           L    G  + L S N   YP + ++      ++ I ++ W S
Sbjct: 181 LYKLPGGGLRLRSYNTDEYPDERLDADQVKQVKVIGKVFWYS 222


>gi|254294062|ref|YP_003060085.1| LexA repressor [Hirschia baltica ATCC 49814]
 gi|254042593|gb|ACT59388.1| SOS-response transcriptional repressor, LexA [Hirschia baltica ATCC
           49814]
          Length = 228

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 62/222 (27%), Gaps = 4/222 (1%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   +++   I +  +   ++PS    K+ LD  S +   R       R         
Sbjct: 1   MLTNKQRELLLFIHQRIKETGVSPSFDEMKSALDLASKSGIHRLITALEERGFLRRLPHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +             P     + +        +      +      G    G     +
Sbjct: 61  ARAIEVLKLPESATPSAPPLGRSSFKPAIVSRDGVSSKNVANDTIPVLGRIAAGVPIAAI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                R     +     Q    + Q  SM       GDI+IL        G+ ++     
Sbjct: 121 QNETDRITAPTLGMNSDQHFALEVQGDSMIEAGILDGDIVILKKGDTAISGEIVVALVNE 180

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +   K +  +R  SI L + N  Y         +    +++
Sbjct: 181 EEATLKRI-RKRNGSIALEAANPAYETRIFGPDKVRVQGKLV 221


>gi|303257549|ref|ZP_07343561.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|302859519|gb|EFL82598.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
          Length = 227

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 66/219 (30%), Gaps = 12/219 (5%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +        L  S +AR   + P S +        G+++   +  + K+      +
Sbjct: 7   LAERLTLALSDSGLKKSDIARLCFISPASVSDWF----SGKSKSIKSIYLPKVAKVLGVS 62

Query: 69  ICQLLDLPFSDGRTTE-KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
              L               E       +          +  F   +    +      +  
Sbjct: 63  STWLATGNGPMKSPNVLVTEDVCDDDDWVEIPEYKIRFAAGFEQNSTLEELASEYKAAYR 122

Query: 128 NGIY----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
              +           R K +  SM PL    D+++++ +       R+        +  K
Sbjct: 123 RSWFQRKNINPEDCKRFKVKGDSMEPLLLDHDVVLVDCSKTEIIDGRIYAFVFGDALRVK 182

Query: 184 VLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARIL 219
            L  +   SI + S N  +P +T+   +   ++ I  ++
Sbjct: 183 RLYRKIDGSIMVHSENPNFPDETISPADTEQVQVIGEVI 221


>gi|257879532|ref|ZP_05659185.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257883466|ref|ZP_05663119.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|294622463|ref|ZP_06701485.1| transcriptional regulator, Cro/CI family [Enterococcus faecium
           U0317]
 gi|257813760|gb|EEV42518.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257819124|gb|EEV46452.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|291598010|gb|EFF29120.1| transcriptional regulator, Cro/CI family [Enterococcus faecium
           U0317]
          Length = 234

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 72/235 (30%), Gaps = 31/235 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           E +  + E++N+    LA K G    +S ++ ++         P  +++ +I    N  I
Sbjct: 4   ENLKFLREKYNIDQQELAEKLGRKSSSSISEWEKGKYT-----PKLKTLNEIAKIFNVDI 58

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP-------- 121
             L+++  S              L      +   F S       + N +  P        
Sbjct: 59  DDLMNIDLSISNQIYNILPIYNQLNDENKVATYEFASNRLEEQKQENVLDFPKKEKIPTV 118

Query: 122 ----------------EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV 165
                            +             D        SM P+ R G  + +     V
Sbjct: 119 HNSASAANPTELTYGDTVVEEEEFERVPSAADFAVPIIGDSMEPVIRNGQFVFVKEQPDV 178

Query: 166 NCGDRLLIKPRTGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             G+  +++     +  K +      ++I L S+N  Y    V    I  I +++
Sbjct: 179 EDGEIAIVELGGDGVTCKEIYKDYENQTIILRSINDLYEDRIVSPEQIRIIGKVV 233


>gi|330963891|gb|EGH64151.1| putative phage repressor [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 238

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 65/229 (28%), Gaps = 20/229 (8%)

Query: 11  EAIDRMAER-HNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  +      L+    A + GLD +  ++      +   +  +T    KI       +
Sbjct: 6   QRISALRAAMAGLSQKDFANQHGLDASYLSQLLNGHRKLGEKAAATLE-EKINLRPGSLV 64

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              L       +        +       S                   V           
Sbjct: 65  NPELLSGSDPDQLIVPVVAPVDSRTVMQSLGFITIPHLDVAASMGSGNVPPDSQIEVIKD 124

Query: 130 -------------IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                         ++             SM   +R GD L+++  I     D + +   
Sbjct: 125 ITVHLDWLKTQGLAFSRIENLAIITGDGDSMDGTFRDGDSLLVDRGITEIRTDAVYVFTL 184

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARI--LW 220
            GD+  K L    G ++ ++S N  YP   +E +D   +   AR+  +W
Sbjct: 185 DGDLYIKRLQRMTGGALRMISDNPLYPAIIIEGADLTKVHIQARVLLVW 233


>gi|209964501|ref|YP_002297416.1| LexA repressor [Rhodospirillum centenum SW]
 gi|226694238|sp|B6IST2|LEXA_RHOCS RecName: Full=LexA repressor
 gi|209957967|gb|ACI98603.1| LexA repressor [Rhodospirillum centenum SW]
          Length = 237

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/232 (11%), Positives = 60/232 (25%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-FNKS-----KRFGIEGRNRW 52
           M +   +++   I    +   ++PS   +    GL   S  ++      +R  I      
Sbjct: 1   MLTRKQQELLLFIHERLKDGGVSPSFDEMKDALGLKSKSGIHRLITGLEERGFIRRLPHR 60

Query: 53  PSTESIFKILAATNE----TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
                + ++             +       +    + +           + +      G 
Sbjct: 61  ARALEVLRLPEQPAPLRVAPRTEEPVRFRPNVIRGDFRGALPGREARGDAEAVSLPLYGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNC 167
              G     +                 +    +    SM+      GD +I+        
Sbjct: 121 IAAGLPIEALRDTTASIDVPTGLIASGEHYALEVAGDSMVDAGILDGDTVIIQRCETAEN 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           G  ++      ++  K L  + G SI L   N  Y         +    R++
Sbjct: 181 GTVIVALVDDNEVTLKRLRRK-GNSIALEPANPAYETRVFGADRVRIQGRLV 231


>gi|15888721|ref|NP_354402.1| LexA repressor [Agrobacterium tumefaciens str. C58]
 gi|25453092|sp|Q8UFK2|LEXA_AGRT5 RecName: Full=LexA repressor
 gi|15156463|gb|AAK87187.1| LexA repressor [Agrobacterium tumefaciens str. C58]
          Length = 240

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 67/234 (28%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  A             S    +  K KE        + +  F  +   P  
Sbjct: 61  ARALEVIKLPEAYTPGARPQRGFSPSVIEGSLGKPKEPEPAPAVKAPANDFAGAATIPVM 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQ------TQDTRHKTQDTSM-LPLYRKGDILILNSAIQV 165
            +            +    A+        +    + +  SM       GD +I+ +    
Sbjct: 121 GRIAAGVPISAIQNNTHDLAVPVDMLGSGEHYALEVKGDSMIEAGIFDGDTVIIRNGNTA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           N GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 NPGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKIQGKLV 233


>gi|293392401|ref|ZP_06636723.1| cro/CI family transcriptional regulator [Serratia odorifera DSM
           4582]
 gi|291425055|gb|EFE98262.1| cro/CI family transcriptional regulator [Serratia odorifera DSM
           4582]
          Length = 228

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 72/231 (31%), Gaps = 22/231 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K + E      E   L+   LA K G+   S  K +      + R      I ++  +  
Sbjct: 2   KTLAERFKFARENSGLSQDDLAAKVGVTQQSIAKIENGIT-LQPR-----KIKELALSLG 55

Query: 67  ETICQLLDLPFSDGR-TTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN-------TV 118
            +   L      +   +    ++    +  P               GN          + 
Sbjct: 56  VSQQWLQLGIEENAELSNYVVKESEEAILDPELFVSVPILDIELSAGNGAEAELIESCSD 115

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ--VNCGDRLLIKPR 176
             P  R          +     K    S+LP+   GD + +++     +  GD L     
Sbjct: 116 TFPLRRDDLRRAGVSASNARIVKIWGNSLLPVLTNGDYVAVDTTHTQSIRDGD-LYAIRD 174

Query: 177 TGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSD----IEWIARILWAS 222
              +  K ++S     + L S N   YP + +  ++    +  I R+ W+S
Sbjct: 175 GVLLRVKTVVSLPDGGVILRSFNKEEYPDEVLSYNERKARVHVIGRVFWSS 225


>gi|257066290|ref|YP_003152546.1| transcriptional regulator, XRE family [Anaerococcus prevotii DSM
           20548]
 gi|256798170|gb|ACV28825.1| transcriptional regulator, XRE family [Anaerococcus prevotii DSM
           20548]
          Length = 206

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 76/217 (35%), Gaps = 25/217 (11%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   + ++ E   +    LA+  G++  + +  +R       R PSTE + K     N +
Sbjct: 3   LGAKLKQLREEQEMKQETLAQILGINRATISMYERNQ-----RVPSTEILQKYTKTFNVS 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              LL            ++  IP+      G+    D  ++   +               
Sbjct: 58  SDYLLGNTHYKSNNINNEKYTIPVYASISCGNPFVADENIYDFEDIDI------------ 105

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                Q +      +  SM P ++ GD+ I+     ++ G    ++    +   K ++ +
Sbjct: 106 -ALKSQGEHFGLLCRGDSMSPEFKDGDVAIIRKQSDIDSGQVAAVRINGDEATLK-IVKK 163

Query: 189 RGRSIDLMSLNCC-YPVDTVEMSD-----IEWIARIL 219
             + I L+++N   +        +     +E I R++
Sbjct: 164 SEQGITLVAINPDVFLPQFYSNEEIINLPVEIIGRVI 200


>gi|219870852|ref|YP_002475227.1| transcriptional activator-regulator PrtR/CI repressor [Haemophilus
           parasuis SH0165]
 gi|219691056|gb|ACL32279.1| transcriptional activator-regulator PrtR/CI repressor [Haemophilus
           parasuis SH0165]
          Length = 223

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 61/224 (27%), Gaps = 19/224 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E I++      L    LA    +   +         + + R      + +I  A N  
Sbjct: 4   LGERIEQAMNLKGLKRKELAEMLNISTMAVGDLINNKTK-KPR-----YLVEIAEALNVD 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +  L              +       +  +             GN    +     +S   
Sbjct: 58  VKWLQTGEGEMRSHVNDVDVIDKDKDYSNTHINIDMYDIKLSAGNGKPVIEWVPRKSDEP 117

Query: 129 GIYA---------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            ++                    +  SM P+    D +I++ +        +        
Sbjct: 118 LLFREAWFKVKRLSPKNCKAMYVRGHSMAPVLEDWDTVIVDISDTEIADGEVYAVVYNKH 177

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARILW 220
              K +I   G+ I L+S N  Y    V   D   ++ I R +W
Sbjct: 178 FYIKQIIR-TGKGIQLVSFNPEYYPIDVMDDDLNNLQIIGRKVW 220


>gi|170748438|ref|YP_001754698.1| LexA repressor [Methylobacterium radiotolerans JCM 2831]
 gi|229621225|sp|B1LUJ7|LEXA_METRJ RecName: Full=LexA repressor
 gi|170654960|gb|ACB24015.1| transcriptional repressor, LexA family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 242

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 64/237 (27%), Gaps = 19/237 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-------- 52
           M +     +   I    +   + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQLDLLRFIQSRMQECGVPPSFDEMKDALDLKSKSGIHRLITALEERGFLRRLPNR 60

Query: 53  ---------PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF 103
                    P + +       T     +        G++ +        +      +   
Sbjct: 61  ARAIEVIRIPESLTQAAPAPQTPAEPRRFTPSVVEGGKSKQPPAPASTRMIDESGRAISI 120

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSA 162
              G    G   + +         +  +    +    + +  SM       GD++++   
Sbjct: 121 PVMGRIAAGTPVSAIQNQSHAITLSPDFVAGGEHYALEVRGDSMVEAGILDGDLVVIRKQ 180

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              N GD ++      +   K L  R G SI L + N  Y    +    +    R++
Sbjct: 181 DTANTGDIIVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGRLV 236


>gi|114771089|ref|ZP_01448529.1| LexA repressor [alpha proteobacterium HTCC2255]
 gi|114548371|gb|EAU51257.1| LexA repressor [alpha proteobacterium HTCC2255]
          Length = 228

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/223 (13%), Positives = 59/223 (26%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     + E I +  ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQLDLLEFIHKRLQKDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +                              L    + +      G    G     +
Sbjct: 61  ARAIEILRLPESIDGGGFQPRIIEGSLTPPPAAALPIEAANALTLPIMGRIAAGTPIEAI 120

Query: 119 GVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                     G       +    + +  SM       GDI+++N       GD ++    
Sbjct: 121 QQVSNNVSVPGEMLKNSGRHYALEVKGDSMIEAGINDGDIVVINEQNDAENGDIVVALVD 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K L  +RG  + L + N  Y         ++   +++
Sbjct: 181 DQEATLKRL-RKRGTVVALEAANPAYETRVYRDDQVKVQGKLV 222


>gi|304391662|ref|ZP_07373604.1| repressor LexA [Ahrensia sp. R2A130]
 gi|303295891|gb|EFL90249.1| repressor LexA [Ahrensia sp. R2A130]
          Length = 233

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 57/227 (25%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTKKQHELLMFIQERMKEAGVPPSFDEMKDALDLKSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-----SGVFPTGN 113
            + L                        E  +       +   G         G    G 
Sbjct: 61  ARALEVIKLPDSYQPSPAGRRPFEPSVVEGGLGRAPEMVANDTGPAMTEVPVMGRIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             + +         +     + +    + +  SM       GD +++        GD ++
Sbjct: 121 PISAIQENTHTIAVSPDMLGRGEHYALEVKGDSMIEAGILDGDTVVIQRGDTATPGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K    + G SI L + N  Y         +    +++
Sbjct: 181 ALVDHEEATLKRFRRK-GDSIALEAANPAYETRIFGPDRVAVQGKLV 226


>gi|120610433|ref|YP_970111.1| putative prophage repressor [Acidovorax citrulli AAC00-1]
 gi|120588897|gb|ABM32337.1| phage repressor protein [Acidovorax citrulli AAC00-1]
          Length = 230

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 70/219 (31%), Gaps = 15/219 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K I E +    ER  LT   LA++A +   +    +    + R R     +    ++   
Sbjct: 11  KTIAERLRAARERAGLTQPALAQRANVSQGTIGNIESGLRK-RPRDLLAIAAALHVSPLW 69

Query: 67  ET-----ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                  +    D           + +  P++    +G          P G+  +    P
Sbjct: 70  LETGQGLMHGDHDQANVSTAPASMRPRRYPVISSVQAGEWEEIVDQFSP-GDAEDWQDSP 128

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
               P+  +  ++     +          + +G  + ++  ++   GD ++  +      
Sbjct: 129 VDLGPNGFVLKLEGSSMTNPAGGR---DNFPEGMYVHIHPGVEAQPGDYVVAKREADNKA 185

Query: 181 VAKVLISRRGRSIDLMSLNCCYPV--DTVEMSDIEWIAR 217
             K L+   G    L ++N  +P     +E  D   I +
Sbjct: 186 TFKKLVRVDGEQF-LHAINPAWPKPYIKLEPGD-RIIGK 222


>gi|212499706|ref|YP_002308514.1| cI [Bacteriophage APSE-2]
 gi|211731675|gb|ACJ10163.1| cI [Bacteriophage APSE-2]
          Length = 232

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 84/232 (36%), Gaps = 32/232 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M   +  K+ + I ++     + + + L+R+ G+   + ++       G  + P  + I 
Sbjct: 1   MGMMT-AKLNKNIKKLMAEKGVKSVAELSRRIGMPQPTLHRML----SGEVKSPRLKIIQ 55

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG----------------GF 103
           KI         +LL         + + + +        +                   G+
Sbjct: 56  KIADFFRVEANELLYKDLITSHISIENKTKAYERVEVKAIPFNFCKVPVLGTTQLGGGGY 115

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
           ++S     G+ +  +  P                   + Q  SM+P  + G+ +++    
Sbjct: 116 WNSKESSAGHDYGYIIWPTE----------DRDAFALRCQGESMMPRIQHGEFVVMEPNH 165

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           +   GD +L++   G ++ K  + +R   + L+S+N  +P   +  S IE I
Sbjct: 166 KYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAASTIEKI 217


>gi|262044717|ref|ZP_06017768.1| cro/CI family transcriptional regulator [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259037939|gb|EEW39159.1| cro/CI family transcriptional regulator [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 239

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/236 (12%), Positives = 67/236 (28%), Gaps = 14/236 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI-- 58
           M   + K + + ++       ++   LA+ A +   +  +      +G  R     +   
Sbjct: 1   MQESTLKTLADRLNFAMHEMGMSQGQLAKAANMAQPTIWRITSGNAKGTTRIVDLANALG 60

Query: 59  ---FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK- 114
                +   +             D      K  +             F     F  G+  
Sbjct: 61  VRPEWLSDGSGPMKPSSAHQLPKDQEYVGVKTWDKSTPLEDDEVEVPFLKDIEFACGDGR 120

Query: 115 ---WNT----VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
               +     +   +      G             +  SM P+   G  + +N+  +   
Sbjct: 121 IGNEDYNGYKLRFAKSTLRQIGASTDGHGILCFPVRGDSMEPVIPDGTTVAINTEDKKIV 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIEWIARILWAS 222
             ++      G    K+L      ++ + S N   +P +   ++ IE I R+ W S
Sbjct: 181 DGKIYAISEDGWKRVKMLYRTGPDTVSVRSFNSVEHPAEDKPLNKIEIIGRVFWYS 236


>gi|212712325|ref|ZP_03320453.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
 gi|212685071|gb|EEB44599.1| hypothetical protein PROVALCAL_03413 [Providencia alcalifaciens DSM
           30120]
          Length = 224

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 77/220 (35%), Gaps = 21/220 (9%)

Query: 6   HKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA 64
           ++ + + I  + +   ++  + LAR+  +   + ++       G  + P    +  I   
Sbjct: 5   NELLIKNIKHLMDTKGISNHTELARRLKMHQPTMHRLL----SGEVKDPKISVVKNIADF 60

Query: 65  TNETICQLLDLPFSDGRTTEKKEK------EIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            +  +  L D   +       +         IP++     G GG +    +P G     +
Sbjct: 61  FHVPLTDLTDADLTKKENGVPQSAISVNYTSIPVVGRAQLGEGGCWSDLQYPIGMGEGYI 120

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             P                        SM+P  ++G+ +I+        GD +L+   T 
Sbjct: 121 HWPTS----------DPDAYALLCVGDSMIPRIKEGEFVIIEPNHTYRPGDEVLLVTSTE 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           + + K  +  R   I L S+N  +P   VE   ++ I  +
Sbjct: 171 ETMVKTYLYERDGYIHLSSINDAHPPIKVEQIKVDKIHYV 210


>gi|311695997|gb|ADP98870.1| phage repressor [marine bacterium HP15]
          Length = 225

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/202 (14%), Positives = 73/202 (36%), Gaps = 13/202 (6%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           +    A KAG+  ++F       +      P  +S+ +I  A   ++  L          
Sbjct: 30  SARSFAHKAGMGDSTFRNILNGAL------PRLDSLLRIAKAAGVSVEWLATGKEPAKSD 83

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
           ++ +E+   +  +    + G         G++  T  +   R         + +      
Sbjct: 84  SQFEEEFALIPGYNVQVAAGHGSI----AGDEAPTRELAFRRKWLRFRGLQENELALVFA 139

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
           +  SM P     + ++++++ +      + +      ++ K + +     + L+S N  Y
Sbjct: 140 KGDSMEPTISDNETVMVDTSEKKLRDGHIYVIRNGDHLLVKRIQTLWNDGVQLLSDNKEY 199

Query: 203 PVDTVEMSDIE---WIARILWA 221
           P   +  SD+E    I +++W 
Sbjct: 200 PPQEISKSDLENLDVIGKVVWV 221


>gi|83951834|ref|ZP_00960566.1| LexA repressor [Roseovarius nubinhibens ISM]
 gi|83836840|gb|EAP76137.1| LexA repressor [Roseovarius nubinhibens ISM]
          Length = 232

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 63/229 (27%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + + I++  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLDYINKRIQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +                     +  +          +      G    G
Sbjct: 61  ARALEIVKLPESLGGAP--AHGFTPRVIEGDRPEAGQPANARPVEVHALELPVMGRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +          G   + Q      + +  SM       GDI+++      + GD 
Sbjct: 119 VPIEAINHVSHNVAVPGAMVSGQGNHYALEVKGDSMIEAGINDGDIVVIRETSTADNGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G +I L + N  Y    +    ++   R++
Sbjct: 179 VVALVEDQEATLKRFFRR-GGAIALEAANPAYETRVLPDDKVKVQGRLV 226


>gi|257451797|ref|ZP_05617096.1| SOS-response transcriptional repressors [Fusobacterium sp. 3_1_5R]
 gi|317058353|ref|ZP_07922838.1| SOS-response transcriptional repressor [Fusobacterium sp. 3_1_5R]
 gi|313684029|gb|EFS20864.1| SOS-response transcriptional repressor [Fusobacterium sp. 3_1_5R]
          Length = 208

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 75/217 (34%), Gaps = 27/217 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + I + I ++ +   LT    ++ AG+ P S  K +        R  S E++  I     
Sbjct: 8   ETIGDKILKLRKETALTQEQFSKIAGVTPLSILKYESGE-----RLISIETLLNIANYFK 62

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             I         +    ++   +IP++    +G+G           +  + +   E    
Sbjct: 63  IPIS---YFLGENILKVDENMIKIPVVSVVSAGNGKCGLD------DITDWIEFSENIF- 112

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                     D        SM P     DIL++     ++ GD  + K    D+  K L 
Sbjct: 113 -------PACDFATTVSGDSMEPKIFDSDILLIRKTETLDSGDIGIFKID-EDVFCKKLQ 164

Query: 187 SRR-GRSIDLMSLNCCYPVDTVEMSDIE---WIARIL 219
                  + L SLN CY    +   ++E    I +++
Sbjct: 165 LNHLTNEVILKSLNPCYAPRYLSKEELENFKIIGKVV 201


>gi|220904000|ref|YP_002479312.1| putative phage repressor [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868299|gb|ACL48634.1| putative phage repressor [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 225

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/230 (13%), Positives = 71/230 (30%), Gaps = 19/230 (8%)

Query: 1   MTSFSHKKIWEA----IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE 56
           M +FS   + +A    + +  E   +    +A + G+  T+  K +        + P  E
Sbjct: 1   MKTFSQAGLTKAFAQRLRQRREELGMHKQDMAARVGVSLTTIQKYENG------QMPKGE 54

Query: 57  SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
              ++    + ++  LL    +   + +   +   ++                  G+   
Sbjct: 55  YAVRLADTLDCSLDWLLAGKGAADGSGQNCGEARLVMVPMVEARLSAGTGSFETGGDVLR 114

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                       G     +Q    +    SM P     D+++++   +     R+     
Sbjct: 115 HYAFRWDFLRRKG---NPSQMVLLRVSGDSMQPRIMHNDVVLIDQTQRDPVPGRIYAVGV 171

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARILWA 221
              +  KV+ +     + L S N  Y     +  +     +  I R +W 
Sbjct: 172 EDMVYLKVVNAMP-GRLILTSFNPDYAPIEADTGEQLADLVRVIGRAVWV 220


>gi|167646744|ref|YP_001684407.1| LexA repressor [Caulobacter sp. K31]
 gi|189046532|sp|B0SYZ8|LEXA_CAUSK RecName: Full=LexA repressor
 gi|167349174|gb|ABZ71909.1| transcriptional repressor, LexA family [Caulobacter sp. K31]
          Length = 235

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 60/230 (26%), Gaps = 13/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQHELLMFIHERIKESGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILA--------ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
            + L          T                   +              S      G   
Sbjct: 61  ARALEVVKLPQQATTAAPPKGRGAFRPQVLEGGGQAPTTSAQPQMAADNSRELPILGRIA 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G   + +     R P         +    + Q  SM       GD +I+      N G+
Sbjct: 121 AGTPIDAIQHERERLPVPESMLGAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTANSGE 180

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K L  ++G SI L + N  Y         +E   +++
Sbjct: 181 IVVAL-VGEEATLKRL-RKKGGSIALEAANPKYETRIFGPDQVEVQGKLV 228


>gi|296283865|ref|ZP_06861863.1| LexA repressor [Citromicrobium bathyomarinum JL354]
          Length = 228

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 55/221 (24%), Gaps = 6/221 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    E   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTAKQHELLRFIHERLEETGISPSFEEMKEALDLKSKSGVHRLISALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWNT 117
            + L         +             +   +P      +         G    G     
Sbjct: 61  ARALEVLKMPESAVAGSAPKAANDLGARTTSVPARMPEAANDVIDIPLHGRIAAGAPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           +   +   P         +    +    SM       GD  ++  A     GD ++    
Sbjct: 121 LEDHQSL-PVPAALLGPGEHFALEVSGDSMIEAGIFDGDYALIRRADTARDGDIVVALVE 179

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
             +   K L    G  + L   N  Y     +   ++   +
Sbjct: 180 NEEATLKYLWR-EGGRVRLDPANPSYEPQVYDARAVQVQGK 219


>gi|325679534|ref|ZP_08159114.1| peptidase S24-like protein [Ruminococcus albus 8]
 gi|324108821|gb|EGC03057.1| peptidase S24-like protein [Ruminococcus albus 8]
          Length = 228

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 71/229 (31%), Gaps = 14/229 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              + +I + I +  E   +T   L    G + ++  + +  G   + + P  E++ + L
Sbjct: 1   MEKNVEIGKRIKKRREELGMTQEALGSPLGFNKSTIQRYE-AGKVAKIKLPIIEAMAQRL 59

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV--------FPTGNK 114
             + E +    D         +   +                            F     
Sbjct: 60  NVSPEWLALKSDDMGEYHGAPDSLLESKVSSNVAAVLPQEKIHMIPVFGSVAAGFGAYAS 119

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
            + +G   +   ++              +  SM P    GD +++     V+ G R+ + 
Sbjct: 120 SDVIGYIPLYIENDFDVV---DTICIIVKGQSMYPKIEDGDRIVVRRQDSVDNG-RVAVV 175

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
               + V K +    G  ++L S N  YP   +E  ++     +    Q
Sbjct: 176 MIGDEAVVKRVNFD-GERLELTSFNPEYPPRIIEGEELANCHIVGLVQQ 223


>gi|146297047|ref|YP_001180818.1| SOS-response transcriptional repressor, LexA [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166224565|sp|A4XL42|LEXA_CALS8 RecName: Full=LexA repressor
 gi|145410623|gb|ABP67627.1| SOS-response transcriptional repressor, LexA [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 202

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 60/221 (27%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 8   KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                              +   P          +    N  +T+ 
Sbjct: 68  EIVD---------------------DDFYVHRNVIRLPLVGKVTAGEPILAVENIEDTIT 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM+       DI+I+        GD ++      
Sbjct: 107 LPYDLVGTE-------DAFLLRVKGDSMIDAGIFDNDIIIVKRQNVAENGDIVVALID-D 158

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 159 EATVKRFFKESD-HIRLQPENKAMEPIIVK--DVKILGKVI 196


>gi|289671819|ref|ZP_06492709.1| peptidase [Pseudomonas syringae pv. syringae FF5]
          Length = 220

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 64/217 (29%), Gaps = 16/217 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +    +   L  + LA +AG+  TS +  +R   +       T  + KI         
Sbjct: 5   DRLKAARQHAKLNQAELAVRAGITQTSISDLERGKSKA------TAHVAKIADVCGVNAL 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-VPEIRSPHNG 129
            L D            E     +    S    +        G     V   P   +    
Sbjct: 59  WLSDGKGDMTAFITSNEPSNVSMAEQSSRMYRYPLVSWVAAGEWSEAVEPYPPGAADEYD 118

Query: 130 I--YAIQTQDTRHKTQDTSM----LPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVA 182
           +  Y  +        +  SM     P   +G  +++++  +V  G  ++     + +   
Sbjct: 119 VSDYKAKGPAFWLVVKGDSMTAPTAPSIPEGSQILIDTRAEVLPGKLVIAKLAGSNEATF 178

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K L+   G    L  LN  YP           I  ++
Sbjct: 179 KKLVEDGGVRY-LKPLNSAYPTVQCTEG-CRVIGVVV 213


>gi|197284378|ref|YP_002150250.1| phage reprossor [Proteus mirabilis HI4320]
 gi|194681865|emb|CAR41178.1| phage reprossor [Proteus mirabilis HI4320]
          Length = 233

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 66/225 (29%), Gaps = 9/225 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK------ 60
           K + E I +     N+T + LA   G+ P S  + +      +NR      I +      
Sbjct: 2   KTMRERIKQARLAKNMTQAELAELVGVSPQSVQQWETSTEPRKNRVIKIAEILEVDTNWL 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +   T+      +     +       +    +       S G     +         +  
Sbjct: 62  LFGITDIDERNKVSSIQINQDIEVSDKNTYKVEMLDIQASAGPGVMVLDDFIETITAIEY 121

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
               +         +       +  SM   +   D + ++       GD + +      +
Sbjct: 122 SADEAKRLFGGRSASTIKMITVKGDSMAGTFEPRDQIFVDITTNFFDGDGIYVFVLDNQL 181

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE--WIARILWASQ 223
             K L  +  + + ++S N  Y    +E   I   +I   +  SQ
Sbjct: 182 YIKRLQKQY-KRLAVISDNARYETWYLEEDSINSLYIHAKVLVSQ 225


>gi|212712857|ref|ZP_03320985.1| hypothetical protein PROVALCAL_03954 [Providencia alcalifaciens DSM
           30120]
 gi|212684549|gb|EEB44077.1| hypothetical protein PROVALCAL_03954 [Providencia alcalifaciens DSM
           30120]
          Length = 252

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 65/227 (28%), Gaps = 18/227 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLD-PTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           K IWEA     +   LT    A   G     + ++             + +    +    
Sbjct: 19  KTIWEA---KRDTLGLTQEKAAEALGFSTQGAVSQYLNGRTALNT-DTTLKFAALLQVQP 74

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG-NKWNTVGVPEIR 124
            +   +L  L        +    E   L      +           G + +     P+  
Sbjct: 75  EDINPELKALLDYVRSNKQASVAEHSPLITRNEHNTLRLLDIYAKAGPSGFMNNEFPDTI 134

Query: 125 SPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                      +                  SM P     D++ +++  +   GD + +  
Sbjct: 135 RSIEFSSEKVFELFGRKSLKGIEMINITGDSMSPAINPRDVVFVDTHNEYFDGDGVYVFS 194

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARIL 219
               +  K L   +G+ + + S N  Y    +E S   D++ I +++
Sbjct: 195 FENALFIKRLQRVKGKKLAVKSDNSAYETFYIEESEMHDLKIIGKVI 241


>gi|217977841|ref|YP_002361988.1| LexA repressor [Methylocella silvestris BL2]
 gi|254809102|sp|B8EK86|LEXA_METSB RecName: Full=LexA repressor
 gi|217503217|gb|ACK50626.1| SOS-response transcriptional repressor, LexA [Methylocella
           silvestris BL2]
          Length = 236

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 62/231 (26%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++   I+   +   + PS    K  LD  S +   R  I    R      P+ 
Sbjct: 1   MLTKKQSELLRFINERMKETGVPPSFDEMKDALDLRSKSGIHRLIIALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP----- 110
               ++L     +          +    E     +  +        G       P     
Sbjct: 61  ARALEVLRMPGASAADAGRGRKFEPSVIEGHLGRVRPMPAARDDEDGARAMVAIPVMGRI 120

Query: 111 -TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCG 168
             G   + +               Q +    + +  SM+       D +++        G
Sbjct: 121 AAGTPISALQTRSHTLNLPPEMLSQGEHYALEVRGDSMIDAGIFDADTVLIRKQDTAETG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K L  R   SI L + N  Y         +    +++
Sbjct: 181 DIVVALIDDEEATLKRLRRRGA-SIALEAANPAYETRIFGPDRVRIQGKLV 230


>gi|254362846|ref|ZP_04978921.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
 gi|153094483|gb|EDN75317.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
          Length = 219

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 67/232 (28%), Gaps = 38/232 (16%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKA----------GLDPTSFNKSKRFGIEGRN 50
           MT+         I    E+  ++   +A +               +     +R       
Sbjct: 1   MTTL-----GSRIKAYREQLGISQYEVAERCTSIDNRDKNNKWGQSRIANYERNN----- 50

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R P  + I  +      +  + L    +       K    PL+    +G         F 
Sbjct: 51  RTPDLDDIEILSKVLGVSP-ETLAFDTNVQLARPTKSNSYPLISNIQAGLWTEAFD--FK 107

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
               ++ +       P              +    SM P + +GD+++++   + + GD 
Sbjct: 108 DSEGYDYIDTEIDAGP---------DAFFLRISGMSMEPKFSEGDLVLIDIRKRPHPGDY 158

Query: 171 LLIKPRTGDIVAKVLISR------RGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
           +     TG+   K                +L+ LN  +P  +    DI  I 
Sbjct: 159 VAAVNGTGEATLKRYRELGEWSESGNPHFELIPLNPDFPTLSSMKQDIRIIG 210


>gi|320199124|gb|EFW73719.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           EC4100B]
          Length = 249

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 61/229 (26%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 20  MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 73

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K                       G         E+
Sbjct: 74  ALGVRTEWLSSGIGPMRNDGQQSGKPTVN---HSKYFKIDVLDIEVSAGPGVINREFVEV 130

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 131 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 190

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 191 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 238


>gi|149184609|ref|ZP_01862927.1| LexA repressor [Erythrobacter sp. SD-21]
 gi|148831929|gb|EDL50362.1| LexA repressor [Erythrobacter sp. SD-21]
          Length = 230

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/225 (12%), Positives = 58/225 (25%), Gaps = 12/225 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRNRWP 53
           M +    ++   I +  E   ++PS   +     L   S      +  +  G     R P
Sbjct: 1   MLTAKQHELIRFIQQKLEETGISPSFEEMKEALDLKSKSGVHRLISALEERGFI--RRLP 58

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +++    +++            T             P +        G    G 
Sbjct: 59  NRARALEVIKLPEDSVTSPSKPAAPANDTVVAVHAPKTAAPEPANDIIEVPLHGRIAAGA 118

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
               +       P              +    SM       GD  ++  A     G+ ++
Sbjct: 119 PIEAIEGQASM-PVPAALLGPGDHYALEVSGDSMIEAGIFDGDFALVKRAETARDGEIVV 177

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
                 +   K L  + G  + L   N  Y     E   ++   +
Sbjct: 178 ALVDNEEATLKYL-RKEGGMVRLDPANGAYEPQIYEAGRVKVQGK 221


>gi|307943610|ref|ZP_07658954.1| transcriptional regulator [Roseibium sp. TrichSKD4]
 gi|307773240|gb|EFO32457.1| transcriptional regulator [Roseibium sp. TrichSKD4]
          Length = 234

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/230 (13%), Positives = 65/230 (28%), Gaps = 27/230 (11%)

Query: 4   FSHKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            ++  + E  DR+      +     A K  L  ++  K     I      PS +   +I 
Sbjct: 12  LTNTNLEEFPDRLKALIGTSSVLAFASKCELPGSTVRKYLDGSI------PSLDKATQIA 65

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW------- 115
            A N ++  L             +      +  P               G          
Sbjct: 66  RACNVSLEWLATGQGPKHPRQASEVHAADFIGIPR-------YDAHLSAGGGTWNADKER 118

Query: 116 --NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
             + +             +             SM PL    DI++++ + +    D +  
Sbjct: 119 PLDHIPFTREFLAKRLHKSKPRDLVILMVNGDSMEPLINDDDIVMVDQSKK-RLEDGIFA 177

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILW 220
                    K   +     +++ S N  YP + ++     D+  I +++W
Sbjct: 178 FVFDDLAKVKRFRTLANGDLEIRSDNPLYPPEVLQKEQLNDLNIIGKVVW 227


>gi|218550037|ref|YP_002383828.1| Regulatory protein CI from bacteriophage origin [Escherichia
           fergusonii ATCC 35469]
 gi|218553312|ref|YP_002386225.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218357578|emb|CAQ90217.1| Regulatory protein CI from bacteriophage origin [Escherichia
           fergusonii ATCC 35469]
 gi|218360080|emb|CAQ97627.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 242

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 61/229 (26%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 13  MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 66

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K                       G         E+
Sbjct: 67  ALGVRTEWLSSGIGPMRNDGQQSGKPAV---SHSKYFKIDVLDIEVSAGPGVINREFVEV 123

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 124 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 183

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 184 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 231


>gi|327198606|ref|YP_004327350.1| phage repressor protein [Erwinia phage phiEt88]
 gi|311875300|emb|CBX44558.1| phage repressor protein [Erwinia phage phiEt88]
          Length = 236

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/233 (14%), Positives = 62/233 (26%), Gaps = 27/233 (11%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +    +   L+   L    G+   +  K +    +      ST    +I  A   +  
Sbjct: 7   ERLRVSRKNKGLSQKALGDLVGVSQANIQKLENGKSQ------STGYAAQIAEALGVSAI 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG------------GFFDSGVFPTGNK---- 114
            L     +               +   S                F     F  G+     
Sbjct: 61  WLATGNGAKDSLQASSSIPPEHEWGSVSSWDNETPLDDDEVEVHFLKDIEFACGDGTFSS 120

Query: 115 WNT----VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
            +     +   +      G  +             SM P+   G  + +++  +     +
Sbjct: 121 EDHNGFMLRFSKATLRRVGANSSGEGVLCFPATGNSMEPIIPDGTTVAVDTNNKKIVDGK 180

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
           L      G    K L       I + S N   +P   V +++I  I R+ W S
Sbjct: 181 LYAIDHGGLKRIKQLFRMPNNMISVRSFNKDEFPDQDVRINEITVIGRLFWYS 233


>gi|315499847|ref|YP_004088650.1| transcriptional repressor, lexa family [Asticcacaulis excentricus
           CB 48]
 gi|315417859|gb|ADU14499.1| transcriptional repressor, LexA family [Asticcacaulis excentricus
           CB 48]
          Length = 235

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 67/230 (29%), Gaps = 13/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRN-- 50
           M +   +++   I    +   ++PS         LA K+G+        +  G   R   
Sbjct: 1   MLTTKQRELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHR-LITALEERGFIRRLAH 59

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R  + E I     AT     +             +    +P               G   
Sbjct: 60  RARALEVIKLPDQATTAAPPRGRQAFVPQVVEGTRPAAPVPASKPANDEGRELPLLGKIA 119

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGD 169
            G     +G    R     I+    +    + +  SM+      GD +I+  +     G+
Sbjct: 120 AGVPIEALGAERDRIRVPEIFVGSGEHYLLEIEGDSMINAGILDGDYVIIKKSDSAQSGE 179

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++          K L  +   SI L + N  Y        ++    +++
Sbjct: 180 IVVALVDGDTATLKRLRKKGA-SIALEAANPAYKTRIYNADEVAVQGKLV 228


>gi|223935627|ref|ZP_03627543.1| transcriptional regulator, XRE family [bacterium Ellin514]
 gi|223895635|gb|EEF62080.1| transcriptional regulator, XRE family [bacterium Ellin514]
          Length = 222

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/223 (13%), Positives = 59/223 (26%), Gaps = 12/223 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M   + K            H  LT + L    G+        ++              +F
Sbjct: 1   MKELTEK-----FREFRRLHGNLTQAELGEMLGVTGNYIYLIEKGIKRPSK---GLTKLF 52

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           + + AT   +     +       T    +          G            G   +   
Sbjct: 53  ESMYATLPQMGAQPGIHPPINSLTSSGLRTTINPLTFIPGRNSAPVVSWAAAGTAHDYAD 112

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTG 178
           +           +          +  SM P    GD++  +   +   G+ ++ +     
Sbjct: 113 LANQIEEVVYTDSRDPNAFALIVEGDSMYPEIAAGDVITFSPNSEPRNGNIVVARLAENH 172

Query: 179 DIVAKVLISRR--GRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++ K        GR+I L S N  YP  T+      +I   +
Sbjct: 173 GVLVKRFRRTGPEGRTIILESTNQDYPPITLPAEAFRFIYPAV 215


>gi|163760898|ref|ZP_02167977.1| putative LexA repressor (SOS regulatory protein) [Hoeflea
           phototrophica DFL-43]
 gi|162281942|gb|EDQ32234.1| putative LexA repressor (SOS regulatory protein) [Hoeflea
           phototrophica DFL-43]
          Length = 238

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/232 (10%), Positives = 62/232 (26%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +    ++   I+   +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQHELLLFINERMKESGIPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLP----FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
                + K+  +   ++                   +  +                  G 
Sbjct: 61  ARALEVIKLPDSYQNSLQPRRGFSPSVIEGSLGKAPEPVRRSQAANDEAPQVAEVPMMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNC 167
              G   + +                 +    + +  SM+      GD +++ +    + 
Sbjct: 121 IAAGVPISAIQNNTHNVQVPIEMVGPGEHYALEVKGDSMIDAGIFDGDTVVIRNVSTASP 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 GDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 231


>gi|329120198|ref|ZP_08248867.1| cro/CI family prophage MuSo2 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327463350|gb|EGF09670.1| cro/CI family prophage MuSo2 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 217

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 75/215 (34%), Gaps = 11/215 (5%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + ++ +   L  +  A +     +  N           + P  + I KIL+       
Sbjct: 7   ENVRKLIDDSGLNVAEFAERIEEKSSRVNDVLNG-----KQRPPFDMIEKILSVFQIDAN 61

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L+    +        ++   + ++    S G+         +  + +   +      G+
Sbjct: 62  WLITGHKNPNGLGNISDEYEYIPFYDVEVSAGYGADAYGAV-HPQSYLAFRKDWLRSRGL 120

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           Y      +  K +  SM P    GD L+++++  +     + +      +  K +     
Sbjct: 121 Y--PKDLSCVKARGDSMEPTINNGDTLLVDASRNMPRDGYIYVIRSADTLWVKRIQKHID 178

Query: 191 RSIDLMSLNCCYPVDTVEMS---DIEWIARILWAS 222
            S+ L+S N  YP  T+      DI+ I +++  S
Sbjct: 179 NSLLLISDNGTYPPMTLRSDQHHDIQIIGQVVNIS 213


>gi|228968306|ref|ZP_04129303.1| hypothetical protein bthur0004_50850 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228791383|gb|EEM38988.1| hypothetical protein bthur0004_50850 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 218

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 67/219 (30%), Gaps = 17/219 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I + I ++  +HNL+   L   AG+   + +  ++       + P   +I KI       
Sbjct: 3   IGKNIKKLRSKHNLSQKELGEIAGVSDKAVSTWEKG-----LKEPRMGAIQKIADHFKIL 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              +++   S        + +I          G                + VP   +  +
Sbjct: 58  KSDIIEDQDSKITHIRPNQPKIENNCKAVPLLGAIAAGTPLEMLTVEEWINVPIEITDCH 117

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                       +    SM  +     + +++  +++  GD   +     D   K     
Sbjct: 118 P------HAFLLRVVGDSMNKIVPPDALALIDPDVEIKNGDIAAVAVNGFDATLKRFYKF 171

Query: 189 RGR-SIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
           +   +++  S N  +     +      + +    +++W 
Sbjct: 172 QDGITLEPESYNSEHKTQFYDSKTQEHTPVVVKGKLVWY 210


>gi|328543728|ref|YP_004303837.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [polymorphum gilvum SL003B-26A1]
 gi|326413472|gb|ADZ70535.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Polymorphum gilvum SL003B-26A1]
          Length = 237

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/232 (12%), Positives = 58/232 (25%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLMFIHERLKETGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FK----------ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
            +          I         +       +G       +        P+G       G 
Sbjct: 61  ARAMEVVRLPESIAPGLGSPRSRGFSPSIIEGSLGRAPAQAGRTEAGDPAGMATIPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNC 167
              G     +               + +    + +  SM       GD +++        
Sbjct: 121 IAAGVPIEAIQTHSHSISVPPELLGRGEHYALEVRGDSMIEAGILDGDTVLIRKTDSAES 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K L  +   SI L + N  Y         +    R++
Sbjct: 181 GDIVVALVDDEEATLKRLRKKGP-SIALEAANPAYETRIFGPGRVRIQGRLV 231


>gi|284992288|ref|YP_003410842.1| LexA family transcriptional regulator [Geodermatophilus obscurus
           DSM 43160]
 gi|284065533|gb|ADB76471.1| transcriptional repressor, LexA family [Geodermatophilus obscurus
           DSM 43160]
          Length = 263

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 59/220 (26%), Gaps = 23/220 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
            +++ E I    ER    PS   +    GL   S    +   ++ +    R P+      
Sbjct: 55  QRRVLEVIRDSIERRGYPPSVREIGEAVGLSSASSVAHQLSVLQKKGWLRRDPNRPRALD 114

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +    +        +    G         +PL+    +G                +   +
Sbjct: 115 VRLPGDSAGASAPTVVAPVGAEETPAPTYVPLVGRIAAGGPV------LAEQAVEDVFPL 168

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P            +      K    SM       GD +++        G+ +      G+
Sbjct: 169 PRELVG-------EGTLFMLKVTGDSMVEAAICDGDWVVVRQQPTAENGEIVAAMID-GE 220

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K    R    + L+  N  Y        D   + R++
Sbjct: 221 ATVKTYKRR-DGHVWLLPHNPAYEPI--PGDDATVLGRVV 257


>gi|170723125|ref|YP_001750813.1| putative phage repressor [Pseudomonas putida W619]
 gi|169761128|gb|ACA74444.1| putative phage repressor [Pseudomonas putida W619]
          Length = 259

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 65/256 (25%), Gaps = 46/256 (17%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           K+ E I        LT   LA K G+  T+ ++ +    +   R     +I      ++ 
Sbjct: 2   KLSERIRAARLHAGLTQRDLAEKIGIAQTAISQLESGKTQ---RSSYLMAIASTCGVSSA 58

Query: 68  TICQLLDLP--------------FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            + +                       +T  +  K +       +           P  +
Sbjct: 59  WLAEGWGTMLRDAASVEAFLNSGDHPLKTAHENAKPVYDPGVAVALEPIQAWDDDTPLED 118

Query: 114 KWNTVGVPEIRSPHNGIY-----------------------AIQTQDTRHKTQDTSMLPL 150
               +          G                             Q         SM P+
Sbjct: 119 DEVEIPFLREVELSAGSGRTVIERSSTAKLRFGKRSLRAHNVQFDQAVCVVVSGNSMEPV 178

Query: 151 YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEM 209
              G  + +N         ++      G +  KVL    G  +   S N   +P +T   
Sbjct: 179 LPDGSTVGVNIGQTQIVDGKMYAIKHDGQLRVKVLYRVPGGGVRFRSFNQSEHPDETYTA 238

Query: 210 SD-----IEWIARILW 220
            +     IE I R+ W
Sbjct: 239 DEMAEKSIEIIGRVFW 254


>gi|167465058|ref|ZP_02330147.1| SOS-response transcriptional repressor [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 211

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 66/222 (29%), Gaps = 24/222 (10%)

Query: 1   MTSFSHKKIWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M     K+I+ A I R+ +   +T   LA+  G+  ++ +  ++   +   R    E + 
Sbjct: 1   MDDKKIKEIFAANIKRLRKSRGMTQGDLAKILGVGISTVSDWEK--AKKYPRAGVIEKLS 58

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +       +  +                +   +  +           G    GN      
Sbjct: 59  QYFDMPKSSFFE---------------VQGNAIEVYIEEDLVKIPIIGKVSCGNGVIAYE 103

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
             E        +         + +  SM+      GD++++     V  G+   +     
Sbjct: 104 EIEGYEDTPSSWVRGADFFYLRAKGDSMINARIFDGDLVLIRKQNFVEEGEIAAVLID-D 162

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIAR 217
           ++  K +       + L S N  Y           +I+ + +
Sbjct: 163 EVYLKRVYKH-DDYLRLESENPTYKPIYKTKENCSEIKILGK 203


>gi|59714374|ref|YP_207148.1| DNA-binding protein RDGA [Vibrio fischeri ES114]
 gi|59482651|gb|AAW88260.1| DNA-binding protein RDGA [Vibrio fischeri ES114]
          Length = 203

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 71/217 (32%), Gaps = 20/217 (9%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K+I   +    +    +   LA    +  ++ ++ +R         P  E + ++    N
Sbjct: 2   KEISIRLKEKRKALRYSQRKLADLVNVTTSAISQWEREETT-----PKGEHLVRLAEVLN 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            T+  L+          +             S   GF       T      + +P+    
Sbjct: 57  CTVQWLVGTEDDICEYVDIPF----YEQVKASAGHGFLCECKNVT-----YISLPKAL-- 105

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
               Y              SM P+     +L+++S+ +      + +  +   I  K LI
Sbjct: 106 --FKYFNVKDLLAITAHGDSMEPVLNDDALLVIDSSKKQIRDGSMYVIRQGDLIRVK-LI 162

Query: 187 SRRGRSIDLMSLNCCYPVDTVEM-SDIEWIARILWAS 222
           S     + L S N  Y  +  E   D+E + +++W S
Sbjct: 163 SLDNNGLKLKSYNQSYHDEIYEDYQDVEILGKVIWYS 199


>gi|257463935|ref|ZP_05628320.1| SOS-response transcriptional repressor, LexA [Fusobacterium sp.
           D12]
 gi|317061461|ref|ZP_07925946.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313687137|gb|EFS23972.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 214

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 65/209 (31%), Gaps = 7/209 (3%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    + + LA+   +    +N  +R  ++     PS E + +++   +     
Sbjct: 6   YLKEKREELGYSQNKLAKALQITQPYYNSIERGEVKN---PPSEEILERMIELFSLNAKD 62

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
                +        K     +      G            G         E      G+ 
Sbjct: 63  KEYFLYLAAVERTPKIILEKMKQMKEEGPAAIPLFPRISAGIGVFGEEEVEDYISIPGVR 122

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            ++ +    + +  SM P  R   I++    +Q++ G+        G+   K L  +   
Sbjct: 123 NLE-EVFSVRVKGDSMEPTIRNSSIIVCRQNMQIHNGEIGAFLVN-GEAFVKRLQVKSD- 179

Query: 192 SIDLMSLNCCYPVDTVEM-SDIEWIARIL 219
            I LMS N  Y    +    +   + ++L
Sbjct: 180 YIVLMSDNPNYQPIYISPSDEFVSVGKVL 208


>gi|300023412|ref|YP_003756023.1| transcriptional repressor, LexA family [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525233|gb|ADJ23702.1| transcriptional repressor, LexA family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 239

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/234 (12%), Positives = 65/234 (27%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +   K +   I    +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTEKQKDLLMFIHERMQERGVPPSFDEMKDALDLRSKSGIHRLITALVERGFIRRLPHR 60

Query: 53  PSTESIFKILAA------TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS 106
                + K+         +          P     T  K+    P  +   + +      
Sbjct: 61  ARAIEVIKLPENQIAAATSATPAAPRGFQPSVITGTGPKQNVTPPPSHVIDARTVSVPVM 120

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQV 165
           G    G   + +         +       +    + +  SM       GD +I+      
Sbjct: 121 GRIAAGTPISAIQNHTHDIAVSPDILTNGEHFALEVKGDSMIEAGIHDGDTVIVRRCNTA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             GD ++      +   K L  ++G +I L + N  +         ++   R++
Sbjct: 181 ENGDIIVALVEGEEATLKRL-RKKGSTIALEAANPEFKTRIFGPDQVDIQGRLV 233


>gi|312114155|ref|YP_004011751.1| LexA family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219284|gb|ADP70652.1| transcriptional repressor, LexA family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 258

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/233 (15%), Positives = 67/233 (28%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +   K++   I+   E   + PS    K  L   S +   R  +    R      P  
Sbjct: 21  MLTPKQKQLLLYINERIEATGVPPSFDEMKEALHLKSKSGIHRLIMALEERGFIRRLPHR 80

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG-------- 107
               +++      +    D       T  +  +       P +      D G        
Sbjct: 81  ARALEVMKMPERRVGFEADRRRGFMPTVIEGARRSSFEEAPQAPFIRDRDDGGISVPVMG 140

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVN 166
               G   + +            Y         + +  SM     ++GD ++L       
Sbjct: 141 RIAAGVPRSAIEDHSHVLVMPPEYLSTGDHFALEVRGDSMIEAGIQEGDTVVLKKTAAAE 200

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K L  +RG+SI L   N  Y         ++   +++
Sbjct: 201 SGDIVVALIDDEEATLKRL-RKRGQSIALEPANPAYETRIFGPDRVKIQGKLV 252


>gi|260433608|ref|ZP_05787579.1| LexA repressor [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417436|gb|EEX10695.1| LexA repressor [Silicibacter lacuscaerulensis ITI-1157]
          Length = 232

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 63/229 (27%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +   + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQADGVPPSFDEMKTALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +        +          + +             +      G    G
Sbjct: 61  ARAIEIVKLPESLGGEP--TVGFKPRVIEGDKPEGPRPANFESVSVDALELPVMGRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +          G   + Q      + +  SM+      GDI+++      + GD 
Sbjct: 119 VPIEAISHVSHHVAVPGTMVSGQGDHYALEVRGDSMIDAGINDGDIVVIRETATADNGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G +I L + N  Y    +    ++   R++
Sbjct: 179 VVALVEDQEATLKRFFRR-GNAIALEAANPAYETRVLPNDKVKVQGRLV 226


>gi|298369854|ref|ZP_06981170.1| peptidase, S24 family [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281314|gb|EFI22803.1| peptidase, S24 family [Neisseria sp. oral taxon 014 str. F0314]
          Length = 233

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 73/229 (31%), Gaps = 19/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           +++EA +++        S LAR     P + N  +     G +     E+   I A+   
Sbjct: 7   RLYEAAEKLKGIKG--QSNLARFLNTSPQTLNNWE---SRGVSSKGLIEAAKAIGASVEW 61

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFP------PSGSGGFFDSGVFPTGNKW-NTVG- 119
                  +  S    +          +              F+       GN + + +  
Sbjct: 62  LETGTGSMDGSHTPESNATVIGTVDAWDSRTPLSGDDCEVPFYKDIHLAAGNGFSDDIED 121

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   ++                    SM P++  G  L +N+A +     ++   
Sbjct: 122 YNGYKLRFSKATLRRHGISPAAVICVCADGDSMEPVFPDGATLGINTADKTVKDGKIYAV 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIEWIARILWAS 222
              G +  K+L    G  I + S N   YP +  + +DI  I R+ W S
Sbjct: 182 NHGGLLRTKILQKLPGNKIRIRSYNAEAYPDEEADAADINIIGRVFWWS 230


>gi|319891834|ref|YP_004148709.1| Phage repressor [Staphylococcus pseudintermedius HKU10-03]
 gi|317161530|gb|ADV05073.1| Phage repressor [Staphylococcus pseudintermedius HKU10-03]
          Length = 234

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 72/240 (30%), Gaps = 28/240 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M    +  I + I R  +  N++   LA    + P++ +             PS   I +
Sbjct: 1   MNKERNIIIAKNIRRFLDDSNMSQKKLAELINIKPSTLSDYLNLRSN-----PSHGVIQR 55

Query: 61  ILAATNETICQLLDLPFS--------------------DGRTTEKKEKEIPLLYFPPSGS 100
           I          +                          D    +  E+   +L+      
Sbjct: 56  IADVFGVGKSDIDTTYKDENSITSIYDKLTPPRQKRVLDFANEQLNEQNNKVLHINSHNV 115

Query: 101 GGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILN 160
                +             +  +         I   D   +    SM PL+   +I+ ++
Sbjct: 116 ISEEVAVYGYASAGTGETLIDGVEFTTQYNGHIPNHDFALQVNGDSMEPLFEDKEIIFVD 175

Query: 161 SAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
              Q+N G   +     G+   K +     + I L+SLN  YP    + S DI+   +++
Sbjct: 176 KTKQINSGQIGIFVID-GEAYLKKVF-ISDKGIRLVSLNSKYPDLHFDSSYDIKVAGKVI 233


>gi|257467041|ref|ZP_05631352.1| SOS-response transcriptional repressor, LexA [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315918178|ref|ZP_07914418.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
 gi|313692053|gb|EFS28888.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 215

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 65/209 (31%), Gaps = 7/209 (3%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    + + LA+   +    +N  +R  ++     PS E + +++   +     
Sbjct: 6   YLKEKREELGYSQNKLAKALQITQPYYNSIERGEVKN---PPSEEILERMIGLFSLNEKD 62

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
                +        K     +      G            G         E      G+ 
Sbjct: 63  AEYFLYLAAVERTPKIILEKMKQIKGEGPSAIPLFPRISAGIGVFGEEEVEDYISIPGVR 122

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            ++ +    + +  SM P  +   I++    +QV+ G+        G+   K L  +   
Sbjct: 123 NVE-EVFSVRVKGDSMEPTIKNSSIIVCRQNMQVHNGEIGAFLVN-GEAFVKRLQIKPD- 179

Query: 192 SIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
            + LMS N  Y    +    +   + ++L
Sbjct: 180 YVVLMSDNPNYQPIYISPNDEFVSLGKVL 208


>gi|254360461|ref|ZP_04976610.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
 gi|153091001|gb|EDN73006.1| possible LexA family repressor/S24 family protease [Mannheimia
           haemolytica PHL213]
          Length = 218

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/221 (14%), Positives = 76/221 (34%), Gaps = 23/221 (10%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           + + + I    +   LT   LA    G+   + ++ +    +     P++E+I  +    
Sbjct: 4   QTLGDRIKSRRKELKLTQKDLATALKGVSHVAVSQWESSTTK-----PNSENILDLSTVL 58

Query: 66  NETICQL-LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
              I  L      S+         ++PL+ +  +G     D      G+ +  +      
Sbjct: 59  QCDISWLLRGNGESNVLPASLGMTKVPLISYIQAGQWTGIDDFRETCGD-YEYI------ 111

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                   +       + +  SM P + +GD +I++  +Q + G+ +       +   K 
Sbjct: 112 ---LTDLEVSEDAFALEIKGDSMEPDFIEGDRVIIDPDVQPHAGEFVAAINGDYEATFKK 168

Query: 185 LISRRG------RSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                       +  +L++LN  Y   +    +I  I  ++
Sbjct: 169 YRPLEDLDEYGRQHFELIALNPDYHKLSTLKQEIRIIGTMV 209


>gi|110641328|ref|YP_669058.1| phage-related repressor protein [Escherichia coli 536]
 gi|110342920|gb|ABG69157.1| phage-related repressor protein [Escherichia coli 536]
 gi|324013243|gb|EGB82462.1| peptidase S24-like domain protein [Escherichia coli MS 60-1]
          Length = 230

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 61/229 (26%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K                       G         E+
Sbjct: 55  ALGVRTEWLSSGIGPMRNDGQQSGKPAVSY---SKYFKIDVLDIEVSAGPGVINREFVEV 111

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 112 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 172 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 219


>gi|293413803|ref|ZP_06656452.1| regulatory protein CI bacteriophage origin [Escherichia coli B185]
 gi|291433861|gb|EFF06834.1| regulatory protein CI bacteriophage origin [Escherichia coli B185]
          Length = 242

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 62/229 (27%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 13  MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 66

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K        P              G         E+
Sbjct: 67  ALGVRTEWLSSGIGPMRNDGQQLGKPTAN---HPKYFKIDVLDIEVSAGPGVINREFVEV 123

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 124 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 183

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 184 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 231


>gi|15837298|ref|NP_297986.1| phage-related repressor protein [Xylella fastidiosa 9a5c]
 gi|9105580|gb|AAF83506.1|AE003913_2 phage-related repressor protein [Xylella fastidiosa 9a5c]
          Length = 221

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 64/221 (28%), Gaps = 24/221 (10%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           KI   I    E   ++ + LA+ AG+  ++ +  +           ST ++ KI      
Sbjct: 5   KIGSRIRAERENQGISRTELAKFAGIATSTLSDLELGHSR------STTALHKIAERLGV 58

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
           +   L          T         L +      G         G+       PEI    
Sbjct: 59  SAQWLETGRGEKSTDTFPAPISNNSLGYVRVQQMGEAG-----MGDGRENEDFPEIVRTV 113

Query: 128 N----------GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                      G      +      +  SM P    G+++++++      GD L +    
Sbjct: 114 EYSEAFLRSLLGFLPPPGRLVLVTGKGDSMTPTIAPGEVVLVDTGTHTFEGDGLYLVNVG 173

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
                K L  R    + ++S N   P        I    ++
Sbjct: 174 HGHQIKRLQDR--GRLFVVSDNHLMPSFEFPEEGI-IGGKV 211


>gi|257453296|ref|ZP_05618595.1| SOS-response transcriptional repressor, LexA [Fusobacterium sp.
           3_1_5R]
 gi|317059828|ref|ZP_07924313.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313685504|gb|EFS22339.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
          Length = 215

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 65/209 (31%), Gaps = 7/209 (3%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    + + LA+   +    +N  +R  ++     PS E + +++   +     
Sbjct: 6   YLKEKREELGYSQNKLAKALQITQPYYNSIERGEVKN---PPSEEILERMIGLFSLNEKD 62

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131
                +        K     +      G            G         E      G+ 
Sbjct: 63  AEYFLYLAAVERTPKIILEKMKQIKGEGPAAIPLFPRISAGIGVFGEEEVEDYISIPGVR 122

Query: 132 AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
            ++ +    + +  SM P  +   I++    +QV+ G+        G+   K L  +   
Sbjct: 123 NVE-EVFSVRVKGDSMEPTIKNSSIIVCRQNMQVHNGEIGAFLVN-GEAFVKRLQIKPD- 179

Query: 192 SIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
            + LMS N  Y    +    +   + ++L
Sbjct: 180 YVVLMSDNPNYQPIYISPNDEFVSLGKVL 208


>gi|92113491|ref|YP_573419.1| putative phage repressor [Chromohalobacter salexigens DSM 3043]
 gi|91796581|gb|ABE58720.1| putative phage repressor [Chromohalobacter salexigens DSM 3043]
          Length = 227

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 68/218 (31%), Gaps = 20/218 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E I    +R  L+ +  A  AG+  T+    ++       R P TE +     A +  
Sbjct: 12  VGERIKGERKRLGLSQTAFANLAGVGKTTQINYEKGT-----RNPDTEYLA----ALDSA 62

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK--WNTVGVPEIRSP 126
              +  +      +    + + P+       S           G         +      
Sbjct: 63  GVDVYYVLTGRKSSGGSSDVQAPVEEPLDGYSPVPMYDIEAAAGAGRLIEHENIESTLYF 122

Query: 127 HNGIYAIQT----QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                + +          K +  SM    + GD +I++ +      D + +     +   
Sbjct: 123 QTQALSAEGLDPAHLIGAKVRGDSMGSTLQDGDRVIVDCSQ--RTPDGVFLLRVGEEYRI 180

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIAR 217
           K +    G +  L+S N  Y  + ++     D+E + R
Sbjct: 181 KRVQRVAGGAWLLISDNHAYEKEMIKPDEMQDVEILGR 218


>gi|110633994|ref|YP_674202.1| LexA repressor [Mesorhizobium sp. BNC1]
 gi|122965964|sp|Q11HT8|LEXA_MESSB RecName: Full=LexA repressor
 gi|110284978|gb|ABG63037.1| SOS-response transcriptional repressor, LexA [Chelativorans sp.
           BNC1]
          Length = 236

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 61/231 (26%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++   I    +   + PS    K  LD  S +   R       R      P+ 
Sbjct: 1   MLTRKQHELLLFIHARLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP----- 110
               ++L   +     L           E  +        P + +         P     
Sbjct: 61  ARALEVLRLPDSIAPGLAAPRKFSPSVIEGGQGRSSPAPRPAANNDDETSVVSIPVMGRI 120

Query: 111 -TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G   + +                 +    + +  SM       GD +I+      N G
Sbjct: 121 AAGVPIDAIQHRTHSIGVPPDMITGGEHYALEVKGDSMIEAGIFDGDTVIIRQTQAANPG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K    +   SI L + N  Y         ++   R++
Sbjct: 181 DIVVALVDEEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGRLV 230


>gi|126735652|ref|ZP_01751397.1| LexA repressor [Roseobacter sp. CCS2]
 gi|126714839|gb|EBA11705.1| LexA repressor [Roseobacter sp. CCS2]
          Length = 228

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 60/223 (26%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-FFDSGVFPTGNKWNT 117
            + L              F+       K    P+   P           G    G     
Sbjct: 61  ARALEIVKLPDAMQAKTGFTPRVIDGDKPDSTPVAAIPVDNGSVDLPMMGRIAAGVPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           +                      + +  SM+      GD++++      + GD ++    
Sbjct: 121 ISEASRNVSVPQSMVGAGDHYALEVKGDSMIDAGINDGDVVVIRETTVADNGDIVVALVE 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K    R G +I L + N  Y         ++   R++
Sbjct: 181 GHEATLKRF-RRNGSAIALEAANPAYETRVFRDDQVKVQGRLV 222


>gi|308751810|gb|ADO45293.1| transcriptional regulator, XRE family [Hydrogenobacter thermophilus
           TK-6]
          Length = 311

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/220 (12%), Positives = 69/220 (31%), Gaps = 15/220 (6%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   +  + +   L+      + G    +    +   ++         ++  I +    
Sbjct: 87  NIHNRLRYLRKTLGLSQEEFGERIGKSLRTIQYWEAGTVQ-----IPDTALKLIASTFGV 141

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT----VGVPEI 123
           +   L           +   +EI                 V   G  +      + V  +
Sbjct: 142 SYEWLKTGQGEMWGREKLSLEEIIEREQRKLLESKIKVPVVGKAGAGFPHSPSDIEVIGV 201

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS----AIQVNCGDRLLIKPRTGD 179
                  Y  + +    +    SM P   +GD ++  +       +  G  ++++  +G+
Sbjct: 202 VFVSKSPYLKEGKIFAVQVSGDSMHPALTEGDYVVFQTYEGDGSDIPNGKIVVVRNHSGE 261

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ K L+     ++ L   N  YP    + ++ E + RI+
Sbjct: 262 LLVKRLLKM-NGTVLLAGDNPKYPPIFPQQAEAEGL-RIV 299


>gi|269219559|ref|ZP_06163413.1| repressor LexA [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269210801|gb|EEZ77141.1| repressor LexA [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 237

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 69/223 (30%), Gaps = 13/223 (5%)

Query: 6   HKKIWEAIDR--MAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGR------NRWPSTES 57
            K++  A+    +  R+  T   +A + G   TS  K +   +E +       R P T  
Sbjct: 13  QKEVLNALRSELLKNRYAPTIREIADRCGFSSTSSVKYQLDALEDKGYIVRDPRRPRTIL 72

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           + ++                   R    +E +     F    S      G    G+    
Sbjct: 73  LTELGLENTHRRLYADYTSAGIPRGAAAEEPKTSAEDFHVDPSVNVPVVGRIAAGSPILA 132

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
             V E   P         +    K    SM       GD +++        G+ +     
Sbjct: 133 DQVVEEVLPLPRSLTGDGELFMLKVVGDSMVEAAICDGDWVVIRRQPVAENGEIV-AAMI 191

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   KVL  + G ++ L+  N  Y        D E + R++
Sbjct: 192 EGEATVKVLQRKDGHTL-LLPRNSEYRPI--PADDAEVLGRVV 231


>gi|329113360|ref|ZP_08242141.1| LexA repressor [Acetobacter pomorum DM001]
 gi|326697185|gb|EGE48845.1| LexA repressor [Acetobacter pomorum DM001]
          Length = 220

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 55/220 (25%), Gaps = 17/220 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKSKRFGIEGRNRWPSTES 57
           M +    K+   ID   ++   +PS   +    GL   +  ++      E          
Sbjct: 5   MLTRKQHKLLLFIDSHLKQTGFSPSFDEMREAMGLRSKSGIHRLISGLEE---------- 54

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
             +     +    + L++                    P + +      G    G     
Sbjct: 55  --RGFLRRHHHRARALEVIQLPEMQELPPNVVRASFTRPKAETVRIPLYGRIAAGLPIEA 112

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           V                      +    SM+      GD +I+    Q   G  ++    
Sbjct: 113 VPDTSHVLTVPTEMLGTGDYYALEVAGDSMVDAGILDGDNVIIRRTDQAENGQIVVALID 172

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
             ++  K L  + G  I L   N  Y    V    +    
Sbjct: 173 EHEVTLKRLRRK-GNMIALEPANSSYETRIVPAEKLRIQG 211


>gi|257463340|ref|ZP_05627736.1| putative prophage repressor [Fusobacterium sp. D12]
 gi|317060917|ref|ZP_07925402.1| SOS-response transcriptional repressor [Fusobacterium sp. D12]
 gi|313686593|gb|EFS23428.1| SOS-response transcriptional repressor [Fusobacterium sp. D12]
          Length = 198

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/212 (16%), Positives = 71/212 (33%), Gaps = 27/212 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            + +  + E   L+   L+ K  +  T+    +        R  + E + +IL A N + 
Sbjct: 5   GKKLKLLRESKGLSQEELSDKLSVTKTTIGNYENG-----RRALTLEKLAEILEALNSSF 59

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
            +   L        +                     +G+    N  + + +P+  S    
Sbjct: 60  NEFFSLKELCTEDIKIPIVSK-----------VSAGTGLLVEENIVDYLPIPKELSN--- 105

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                  D     +  SM P  + GDI ++    ++  G+ ++     G+   K      
Sbjct: 106 -----KCDFATFVEGNSMFPDVKNGDIALVKMDCEIESGNIVI-FSLNGNSYIKKYHYNP 159

Query: 190 -GRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
               I  +S N  Y   +V E  +++ I R++
Sbjct: 160 FSNKITFISSNKEYENISVMEGDELKVIGRVI 191


>gi|26249039|ref|NP_755079.1| putative repressor protein of prophage [Escherichia coli CFT073]
 gi|331651509|ref|ZP_08352529.1| repressor protein C2 [Escherichia coli M718]
 gi|26109446|gb|AAN81649.1|AE016765_51 Putative repressor protein of prophage [Escherichia coli CFT073]
 gi|331050782|gb|EGI22839.1| repressor protein C2 [Escherichia coli M718]
          Length = 208

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 69/218 (31%), Gaps = 24/218 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + + I  +      +   L +  G+   +    ++         P  E++ K+    N
Sbjct: 2   ETVGQRIKALRRVTRTSQKELGKFCGVSDVAVGYWEKDINT-----PGGEALSKLAKFFN 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +    +              + +P++ +  +G      +               E+   
Sbjct: 57  TS-IDYILYGAEFEGKLVTNMRRVPVISWVQAGQFTECRAAEV----------FSEVDKW 105

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDI 180
            +    +       + +  SM     LP   +G  +I++   +   G  ++ +   T + 
Sbjct: 106 VDTSLKVGDNSFALEVKGDSMTNPNGLPTIPEGATVIVDPDAEPRHGKIVIARLDGTNEA 165

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             K L+    +   L+ LN  YP   +  + +  I  +
Sbjct: 166 TVKKLVIDGPQKF-LVPLNPRYPNIPINGNCL-IIGVV 201


>gi|302751894|gb|ADL66071.1| phage transcriptional regulator [Staphylococcus aureus subsp.
           aureus str. JKD6008]
          Length = 242

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 76/246 (30%), Gaps = 39/246 (15%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+SFS       ++R+  + +++ S LA    ++ T+  + ++       R P  + + +
Sbjct: 8   MSSFS-----SNLERLMNKRDMSDSELAELVDVNRTTVTRWRKGI-----RSPKLDKLPE 57

Query: 61  ILAATNETICQLLDLPF--------SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP-- 110
           I          L+             +  +     ++  +L +  +      +       
Sbjct: 58  IANVFGVKPLDLIHDMDDSKIIEEIHNVSSQLTPPRQSNVLKYATNQLEEQNNDSDNLVD 117

Query: 111 ----------------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
                                      E  S       +   D   K    SM PL++ G
Sbjct: 118 FNSYIQEKSEVDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNG 177

Query: 155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIE 213
            I+ +  +  +  G   +     GD   K +       + L+SLN  Y      +   + 
Sbjct: 178 QIIFIEKSHTIKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLHFYDNESVR 235

Query: 214 WIARIL 219
            + +++
Sbjct: 236 LVGKVI 241


>gi|237737791|ref|ZP_04568272.1| repressor [Fusobacterium mortiferum ATCC 9817]
 gi|229419671|gb|EEO34718.1| repressor [Fusobacterium mortiferum ATCC 9817]
          Length = 229

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 71/223 (31%), Gaps = 21/223 (9%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E   ++ +  A+ AG+  + +N  +R  ++     PS E + K ++    T  +
Sbjct: 6   YLKVRREALGISQNKFAKMAGITQSYYNGIERGEVKN---PPSEEILDKFVSLLLLTPSE 62

Query: 72  --------------LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
                          + L      + EK+  +  ++    + +           G    T
Sbjct: 63  GEKLKYLAAIERTPAIILNEIKRLSDEKELSKRQVIKDISNNNTLVPLFSRISAGIGVIT 122

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
              P       GI            +  SM P  +   I+I     ++  G+ +      
Sbjct: 123 DEEPIDYISLPGI-KNTENVFAINVKGDSMEPTIKNQSIIICRQGSELRDGE-VGAFLVN 180

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
           G+   K +         L+S N  Y    V    + + I ++L
Sbjct: 181 GESFVKRI-KVTKNFFALLSDNPNYQPIYVYPQDEFKVIGKVL 222


>gi|209917763|ref|YP_002291847.1| phage transcriptional regulator [Escherichia coli SE11]
 gi|209911022|dbj|BAG76096.1| phage transcriptional regulator [Escherichia coli SE11]
 gi|315614557|gb|EFU95200.1| helix-turn-helix family protein [Escherichia coli 3431]
          Length = 230

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 61/229 (26%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K                       G         E+
Sbjct: 55  ALGVRTEWLSSGIGPMRNDGQQSGKPAV---SHSKYFKIDVLDIEVSAGPGVINREFVEV 111

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 112 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 172 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 219


>gi|331646411|ref|ZP_08347514.1| transcriptional activator-regulatory protein [Escherichia coli
           M605]
 gi|331045163|gb|EGI17290.1| transcriptional activator-regulatory protein [Escherichia coli
           M605]
          Length = 230

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 61/229 (26%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K                       G         E+
Sbjct: 55  ALGVRTEWLSSGIGPMRNDGQQSGKPAVN---HSKYFKIDVLDIEVSAGPGVINREFVEV 111

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 112 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 172 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 219


>gi|323938497|gb|EGB34748.1| peptidase S24 [Escherichia coli E1520]
          Length = 230

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 62/229 (27%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K        P              G         E+
Sbjct: 55  ALGVRTEWLSSGIGPMRNDGQQSGKPAAN---HPKYFKIDVLDIEVSAGPGVINREFVEV 111

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 112 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 172 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 219


>gi|59801483|ref|YP_208195.1| putative phage repressor protein, putative phage associated protein
           [Neisseria gonorrhoeae FA 1090]
 gi|59718378|gb|AAW89783.1| putative phage repressor protein, putative phage associated protein
           [Neisseria gonorrhoeae FA 1090]
          Length = 215

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 58/218 (26%), Gaps = 28/218 (12%)

Query: 27  LARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKK 86
           +A+ A +  ++    +        R     +I K+    + +   L     S        
Sbjct: 1   MAKLAEVSQSTIAALESG------RNKKATNIAKLAKILDVSAFWLETGEGSRTAPALIN 54

Query: 87  EKEIPLLYFPPSGSG---------------GFFDSGVFPTGNKWNTVG------VPEIRS 125
                 +                        +     F  G     +       +P  +S
Sbjct: 55  PDLPHEVKDIHRPMMWSSNDPLPDDDYVFVPYLKESCFKGGAGAYEIPDYNGYRLPFGKS 114

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
                               SM     +   + +++        ++    + G    K L
Sbjct: 115 TLRRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTGETAIRDGKIYAFAQDGMFRVKYL 174

Query: 186 ISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
           I + G S+ + S N   YP +T  +  +  I R+ W S
Sbjct: 175 IRQPGNSVLIRSHNSGFYPDETAPLDSLTVIGRVFWWS 212


>gi|37526812|ref|NP_930156.1| hypothetical protein plu2922 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786244|emb|CAE15296.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 212

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 73/210 (34%), Gaps = 16/210 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E +        LT + LA   G    S  + ++   + R R+     + ++  A   +
Sbjct: 3   IAERVKTRRIEMGLTQTELADLIGTKQQSIEQLEKGKTK-RPRF-----LPELAVALQCS 56

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +  LL            K++EI     P +G        V       + V          
Sbjct: 57  VSYLLYGTE-------DKKEEIEYAGKPKNGLVRVIGEAVLGIDGAVDMVEFHAGWL--- 106

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            I +        K +  SM P  + G+ +++     V+ GD + ++   G  + K++   
Sbjct: 107 RICSTDHDAYGLKVKGDSMWPRIQSGEFVVIEPNTPVHPGDEVFVRTNNGHNMIKIMNIT 166

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           R       S+N  +   T+  +++  I  +
Sbjct: 167 RNGDYQFSSINSDHRPITIPKNNVIMIHYV 196


>gi|257426151|ref|ZP_05602567.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428811|ref|ZP_05605206.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431422|ref|ZP_05607796.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434133|ref|ZP_05610484.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257437044|ref|ZP_05613085.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282914858|ref|ZP_06322639.1| probable transcriptional repressor [Staphylococcus aureus subsp.
           aureus M899]
 gi|282925355|ref|ZP_06333011.1| hypothetical protein SARG_02518 [Staphylococcus aureus subsp.
           aureus C101]
 gi|293507872|ref|ZP_06667714.1| hypothetical protein SCAG_02388 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510844|ref|ZP_06669544.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           M809]
 gi|293545444|ref|ZP_06672120.1| probable transcriptional repressor [Staphylococcus aureus subsp.
           aureus M1015]
 gi|257271059|gb|EEV03228.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274455|gb|EEV05967.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257277868|gb|EEV08532.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281059|gb|EEV11203.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283638|gb|EEV13764.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282312989|gb|EFB43389.1| hypothetical protein SARG_02518 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282321252|gb|EFB51582.1| probable transcriptional repressor [Staphylococcus aureus subsp.
           aureus M899]
 gi|290919755|gb|EFD96827.1| probable transcriptional repressor [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291094935|gb|EFE25203.1| hypothetical protein SCAG_02388 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466316|gb|EFF08842.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           M809]
          Length = 210

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 77/225 (34%), Gaps = 23/225 (10%)

Query: 3   SFSHKKIWE-AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              +K+I    I R+ + +N+  + L+R   +  T+ +       +   R    E + K 
Sbjct: 1   MLGNKEIMAKNISRLMKENNVDRNKLSRDLKISYTTLSDWIN--AKTYPRIDKIEMLAKY 58

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                 ++ +           ++  + +   +   P  S       ++   N  + +   
Sbjct: 59  FGVEKSSLVE---------SPSKIVQLDTLPVKKIPVVSKISAGMPIYAEENLIDYIYF- 108

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                     +   ++   +    SM  L+++GD++++     V  G   ++     +  
Sbjct: 109 -----ATKNLSSNKEEFGLQVSGDSMDKLFQEGDVVVVEKDSTVENGQLGVVLVNGYNGT 163

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDTVEMSD-IEWIARILWASQ 223
            K +       I L+    N  +        D I+ + R++ ASQ
Sbjct: 164 VKRIRY-NNDQIILIPESNNPSHYPQVYGKDDEIKIVGRVV-ASQ 206


>gi|325271879|ref|ZP_08138337.1| putative phage repressor [Pseudomonas sp. TJI-51]
 gi|324102998|gb|EGC00387.1| putative phage repressor [Pseudomonas sp. TJI-51]
          Length = 276

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 67/270 (24%), Gaps = 57/270 (21%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF----------------------- 44
           ++ + +        LT + LA +AG+   S ++ +R                        
Sbjct: 2   ELKDRLKHARRLKGLTQTELAERAGIAQASISEIERGLSRSSSHLVKIAQICGVDALWLA 61

Query: 45  ---GIEGRNRWPST----ESIFKILAATNETICQL---------------LDLPFSDGRT 82
              G       P      E I K+ AA                            +D   
Sbjct: 62  EGVGSIPAPTEPGYALVGEEIQKLSAADMVRQMLAKTGSGLSEEARNRLLQAAEETDSPP 121

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI----------YA 132
            +   K                       G+   T   PE+                 + 
Sbjct: 122 GDGSAKVGASRGSAGDMIRIAHYDVRGAMGSGQVTHDYPEMLRDVRVSLRHLRELGLDFK 181

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
                        SM P  +  D LI++  ++   GD +      G    K L       
Sbjct: 182 EPHHLKLVTGWGQSMAPTIKDRDPLIVDVTVREFVGDGVYFISWGGHEYIKRLQVADDEH 241

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARI--LW 220
            +++S N  +    +   +    A++  +W
Sbjct: 242 FEMISDNPKHKDRMIRKEETYIQAKVLYVW 271


>gi|332670100|ref|YP_004453108.1| transcriptional repressor, LexA family [Cellulomonas fimi ATCC 484]
 gi|332339138|gb|AEE45721.1| transcriptional repressor, LexA family [Cellulomonas fimi ATCC 484]
          Length = 253

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 60/220 (27%), Gaps = 20/220 (9%)

Query: 9   IWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRW----PSTESIFK 60
           + E I    E     PS   +    GL  P+S  ++      +G  R     P    + +
Sbjct: 39  VLETIRASVESRGYPPSMREIGEAVGLTSPSSVKHQLTVLERKGYLRRDPNRPRAIEVVQ 98

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
              +         D   S    T    + +P   + P          +       +   +
Sbjct: 99  PDDSRGVGTWTAPDGSRSAFAPTGDDGERVPSPSYVPVVGRIAAGGPILAEQVVEDVFPL 158

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P                   +    SM+      GD +++        G+ +      G+
Sbjct: 159 PRQLVG-------DGDLFLLRVAGDSMVDAAICDGDWVVVRRQPVAENGEIVAAMID-GE 210

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L  R    + LM  N  Y        +   + R++
Sbjct: 211 ATVKTL-RRADGHVWLMPHNAAYSPI--AGDEATILGRVV 247


>gi|87119734|ref|ZP_01075631.1| probable transcriptional regulator [Marinomonas sp. MED121]
 gi|86165210|gb|EAQ66478.1| probable transcriptional regulator [Marinomonas sp. MED121]
          Length = 244

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 67/232 (28%), Gaps = 16/232 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            ++  A+ +   + +   + LA++ G    + NK      + R     T SI   +    
Sbjct: 10  DRLLIALQKAGIQRHGAGAWLAKQTGTTVKAANKWLNGESQPRREKVHTISIATGVRTEW 69

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYF-------PPSGSGGFFDSGVFPTGNKWNTVG 119
                       +    +       +  +       P      FF       GN +N V 
Sbjct: 70  LEYGMGEMQTTQEENKQDNHLNLGHIDAWDSDTPLNPNEVEIPFFSEIELSAGNGFNNVL 129

Query: 120 ------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
                 +    S  N            K    SM P+   G  + L+ +       ++  
Sbjct: 130 DIATQKLRFNVSTLNKAGVSSDTVACCKVNGDSMEPILPNGSTVGLDISQTKIQDGKMYA 189

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWAS 222
               G +  K L       + + S N  +  + +      D+  I R+ W S
Sbjct: 190 IEHGGMLRVKYLYRLPFNGLRIRSANPDHHDEELSGESALDVRVIGRVFWYS 241


>gi|46201430|ref|ZP_00208098.1| COG1974: SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Magnetospirillum magnetotacticum MS-1]
          Length = 235

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 58/231 (25%), Gaps = 14/231 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +    ++   ID       ++PS    K  LD  S +   R       R      +  
Sbjct: 1   MLTRKQYELLMFIDERLRATGISPSFDEMKDALDLKSKSGIHRLITGLEERGF-IRRLAH 59

Query: 61  ILAATNETICQLLDLPFSDGRT-----------TEKKEKEIPLLYFPPSGSGGFFDSGVF 109
              A             +                   ++ +      PS S      G  
Sbjct: 60  RARALEVVRLPENRHDQTLPPPAKAFAPNVIKGGFASQQLVGAPVAVPSDSVSLPLYGKI 119

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +                        +  SM       GD +++ S      G
Sbjct: 120 AAGTAIEALSDHSRSIDIPASMLGSGNHYALTVEGDSMIEAGINDGDTVVIRSCDSAETG 179

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             ++      ++  K L  + G S+ L   N  Y    +    ++   R++
Sbjct: 180 TIVVALVDDTEVTLKRLRRK-GTSVALEPANKAYETRVLPPDRVKVQGRLV 229


>gi|260576320|ref|ZP_05844311.1| SOS-response transcriptional repressor, LexA [Rhodobacter sp. SW2]
 gi|259021391|gb|EEW24696.1| SOS-response transcriptional repressor, LexA [Rhodobacter sp. SW2]
          Length = 228

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/223 (13%), Positives = 58/223 (26%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + I    ER  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQLELLDFIKTRTERDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + L                     +K +     +      +      G    G     +
Sbjct: 61  ARALEIIKLPEAMERPGFSPKVIQGDKVDPPRGAMPVDAVYAFELPVMGRIAAGVPIEAI 120

Query: 119 GVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                     G   + +      + +  SM       GDI+++        GD ++    
Sbjct: 121 SEVSHHVAVPGSMLSGKGNHYALEVKGDSMIEAGINDGDIVVIREQNTAENGDIVVALVE 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K    R    I L + N  Y         ++   R++
Sbjct: 181 DSEATLKRFRRRGA-MIALEAANPAYETRVYADHLVKVQGRLV 222


>gi|103486322|ref|YP_615883.1| LexA repressor [Sphingopyxis alaskensis RB2256]
 gi|123380023|sp|Q1GUX2|LEXA_SPHAL RecName: Full=LexA repressor
 gi|98976399|gb|ABF52550.1| SOS-response transcriptional repressor, LexA [Sphingopyxis
           alaskensis RB2256]
          Length = 227

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 55/222 (24%), Gaps = 9/222 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWP--STE 56
           M +    ++   I +  +   ++PS   +    GL   S     R       R       
Sbjct: 1   MLTAKQHELLHFIQQRLDASGISPSFEEMKEALGLKSKS--GIHRLISALEERGFLRRLP 58

Query: 57  SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           +  + L            +  +     + ++    L     +        G    G    
Sbjct: 59  NRARALEVLKLPDTAKSVVTNNRDNVVQLRKAPSALKPIAANDIIEVPLHGRIAAGVPIE 118

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKP 175
                E  +          +    +    SM       GD  ++  A     GD ++   
Sbjct: 119 AFEDHEQLA-VPAALLGSGEHYALEVSGDSMVEAGIFDGDYALIQKADTAREGDIVVALV 177

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
              D   K    R G+ I L   N  Y         +    R
Sbjct: 178 DGQDATLK-FFRREGKMIRLDPANSAYEPQRYPAERVIVQGR 218


>gi|222529484|ref|YP_002573366.1| LexA repressor [Caldicellulosiruptor bescii DSM 6725]
 gi|222456331|gb|ACM60593.1| SOS-response transcriptional repressor, LexA [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 222

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 60/221 (27%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 28  KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 87

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                      ++      +   P          +    N   T+ 
Sbjct: 88  EIVD---------------------EEFYVHRNVVQLPLVGKVTAGEPILAVENIEETMT 126

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM        DI+I+        GD ++      
Sbjct: 127 LPYDLVGTE-------DAFLLRVRGDSMIEAGIFDNDIIIVRRQNVAENGDIVVALID-D 178

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 179 EATVKRFYKEHD-HIRLQPENKAMEPIIVK--DVKILGKVI 216


>gi|71083618|ref|YP_266337.1| LexA repressor [Candidatus Pelagibacter ubique HTCC1062]
 gi|91761961|ref|ZP_01263926.1| LexA repressor [Candidatus Pelagibacter ubique HTCC1002]
 gi|123775507|sp|Q4FM55|LEXA_PELUB RecName: Full=LexA repressor
 gi|71062731|gb|AAZ21734.1| repressor LexA [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717763|gb|EAS84413.1| LexA repressor [Candidatus Pelagibacter ubique HTCC1002]
          Length = 225

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 62/223 (27%), Gaps = 4/223 (1%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +   K +   I++      ++PS    K  L+  S +   R       R        K
Sbjct: 1   MLTKKQKNLLLFINKKLRASGVSPSYEEMKDSLNLKSKSGIHRLISALEERGFIRRLAHK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
             A     + +           +    K                  G    G     +  
Sbjct: 61  ARALEVIKLPETASANDIYNSFSPSVIKGGLDTENTNLNEMEIPVLGSIAAGTPVEAIQN 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              R P         Q    K Q  SM      +GD +I+  +   + G  ++      +
Sbjct: 121 EVSRIPLPSNLEKNGQYFGLKVQGDSMIEAGINEGDTVIIKRSDTADNGKIVVALIDEHE 180

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
            + K +  + G+++ L S N  Y         ++     +  S
Sbjct: 181 AMLKRIRRK-GKTVALESANRNYETKIFGPDRVKVQG--VLVS 220


>gi|258542190|ref|YP_003187623.1| LexA repressor [Acetobacter pasteurianus IFO 3283-01]
 gi|256633268|dbj|BAH99243.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636327|dbj|BAI02296.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639380|dbj|BAI05342.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642436|dbj|BAI08391.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645491|dbj|BAI11439.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648544|dbj|BAI14485.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651597|dbj|BAI17531.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654588|dbj|BAI20515.1| transcriptional regulator LexA [Acetobacter pasteurianus IFO
           3283-12]
          Length = 216

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 55/220 (25%), Gaps = 17/220 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKSKRFGIEGRNRWPSTES 57
           M +    K+   ID   ++   +PS   +    GL   +  ++      E          
Sbjct: 1   MLTRKQHKLLLFIDSHLKQTGFSPSFDEMREAMGLRSKSGIHRLISGLEE---------- 50

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
             +     +    + L++                    P + +      G    G     
Sbjct: 51  --RGFLRRHHHRARALEVIQLPEMQELPPNVVRASFTRPKAETVRIPLYGRIAAGLPIEA 108

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           V                      +    SM+      GD +I+    Q   G  ++    
Sbjct: 109 VPDTSHVLTVPAEMLGSGDYYALEVAGDSMVDAGILDGDSVIIRRTDQAENGQIVVALID 168

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
             ++  K L  + G  I L   N  Y    V    +    
Sbjct: 169 EHEVTLKRLRRK-GNMIALEPANSSYETRIVPAEKLRIQG 207


>gi|326622275|gb|EGE28620.1| repressor protein cI [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 232

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/232 (12%), Positives = 62/232 (26%), Gaps = 24/232 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + + + +++  E   ++   LA+ +G+   +  +       G  +      I +
Sbjct: 1   MNIMKKETLSDRLNKAMELAGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVE 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           I  A       L        +         P      +             G        
Sbjct: 55  IANALGVNSEWLSTGIGPMKKDGTTPINASP----SSNTFKIDILDLEVSAGPGVINREF 110

Query: 121 PEIRSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
            EI                            +  SM      GD+L ++ +I+   GD +
Sbjct: 111 VEILRSVEYSQDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDVSIKNFDGDGI 170

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCY---PVDTVE-MSDIEWIARIL 219
                      K L   +   + ++S N  Y        + M+ +    +++
Sbjct: 171 YAFLYDDTAHVKRLQKMKD-KLLVISDNKSYSAWDPIERDEMNRVFVFGKVI 221


>gi|299137331|ref|ZP_07030513.1| putative phage repressor [Acidobacterium sp. MP5ACTX8]
 gi|298600736|gb|EFI56892.1| putative phage repressor [Acidobacterium sp. MP5ACTX8]
          Length = 240

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 76/231 (32%), Gaps = 18/231 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG-RNRWPSTESIFKILAAT 65
           +   E   R+   H  T  GLA + G+   + ++ +    +  + R    ++    L  T
Sbjct: 2   ENFGERFKRIRTAHGYTQRGLASEIGISGAAISQWESGETQPDKIRAEFLDAAAHKLHTT 61

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLL----YFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
              + +   +  S G    +      ++    + P +G            G     +   
Sbjct: 62  VRHLLKGDGVEGSPGSVKVEAFAIHGMVDDEDFDPETGVMIPVYEMDVSGGPGAPILEFA 121

Query: 122 EIRS-------PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           E R            + A   +    + +  SM P     D ++++  +     +RL   
Sbjct: 122 ETRYKLHFTRKWLKDVKAKPEEIRVARVRGDSMQPTLWDNDKVVIHLGMTRIRNERLFAL 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCC---YPVDTVEMSDIE---WIARIL 219
              G+   K L       + ++S N     YP + +E  D+     I +++
Sbjct: 182 AYAGEARVKRLYQLADGRLRVVSDNPDKAKYPDEFIEGDDLNNVLIIGQVI 232


>gi|229098164|ref|ZP_04229112.1| Phage transcriptional repressor [Bacillus cereus Rock3-29]
 gi|228685355|gb|EEL39285.1| Phage transcriptional repressor [Bacillus cereus Rock3-29]
          Length = 223

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 76/226 (33%), Gaps = 12/226 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M  F  K   + + R+ +    +    A K GL PT+  +S      G+    S +++ K
Sbjct: 1   MVKFMEK--AKIVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIK 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +      T   L  L      T +++      +    S        G    G        
Sbjct: 55  VCKGLGITTDDLEVLTTKGDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEEN 114

Query: 121 PEIRSPHNGIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            E   P    +   + +      + TSM   +  G  +++     V  G   ++K    D
Sbjct: 115 IEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYD 174

Query: 180 IVAKVLISRRGRSIDLMSL--NCCYPVDTVE--MSDIEWIARILWA 221
              K +    G  I L+ L  +  +   T +    D++ I R++ A
Sbjct: 175 ATVKKISK-SGSIITLIPLSNHPIHEPQTYDLSAEDVKIIGRVVQA 219


>gi|145636817|ref|ZP_01792482.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae PittHH]
 gi|145269898|gb|EDK09836.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae PittHH]
          Length = 225

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 62/224 (27%), Gaps = 14/224 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M + S     E +  +     ++ + LAR  G+   S  K          +     +   
Sbjct: 1   MATLS-----ERLTSLMYEKGISQAELARLIGIKQPSVFKILSGETRNPKKILEIATALN 55

Query: 61  ILAA---TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           +      T E                      I +L    S   G +     PT     +
Sbjct: 56  VDPHWLKTGEGDPDPSYRIVEVSEPQNPNTVRIDILDVEVSAGNGAYL---SPTEQGLLS 112

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                         A          +  SM P    GD+L ++ +      D L +    
Sbjct: 113 QEFDLTFFRQQFGRADAKHLKLITVKGDSMAPTLESGDLLYVDVSENYFSADGLYVFTFD 172

Query: 178 GDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSD-IEWIARIL 219
                K L  R GR +  +S N   Y    ++  D +    R++
Sbjct: 173 DHTFIKRLQKR-GREMWAISDNKEEYKEWEIKQDDPVFIHGRVV 215


>gi|9633604|ref|NP_050962.1| P1 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|6118052|gb|AAF04000.1|AF157835_57 P1 [Endosymbiont phage APSE-1]
          Length = 260

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 83/232 (35%), Gaps = 32/232 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M   +  K+ + I ++     + + + L+R+ G+   + ++       G  + P  + I 
Sbjct: 29  MGMMT-AKLNKNIKKLMAEKGVKSVAELSRRIGMPQPTLHRML----SGEVKSPRLKIIQ 83

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG----------------GF 103
           KI         +LL         + + + +        +                   G+
Sbjct: 84  KIADFFRVEANELLYKDLITSHISIENKTKAYERVEVNAIPFNFCKVPVLGTTQLGGGGY 143

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
           ++      G+ +  +  P                   + Q  SM+P  + G+ +++    
Sbjct: 144 WNPKESSAGHDYGYIIWPTE----------DRDAFALRCQGESMMPRIQHGEFVVMEPNY 193

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           +   GD +L++   G ++ K  + +R   + L+S+N  +P   + +  IE I
Sbjct: 194 KYKPGDEVLVQDDHGQVMVKTFLYQRDDVVHLLSINSNHPPIRLAVPTIEKI 245


>gi|86138839|ref|ZP_01057411.1| LexA repressor [Roseobacter sp. MED193]
 gi|85824486|gb|EAQ44689.1| LexA repressor [Roseobacter sp. MED193]
          Length = 238

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/233 (12%), Positives = 64/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     +   I R  ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLNFIHRRLQKDGVPPSFDEMKVALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATN----ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
                I ++          +  Q          +                 +      G 
Sbjct: 61  ARAIEILRLPENMGGVPAPSANQTTAAGAFSPASARPPSTPRSTPAASVLAALEIPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSP-HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
              G     +     +      + +   +    + +  SM+      GDI+++      +
Sbjct: 121 IAAGVPIEAINQITHQIAIPQTMLSSNGKHYALEVRGDSMINAGINDGDIVVIRETDTAD 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K L  R   +I L + N  Y    +  + ++   R++
Sbjct: 181 DGDIVVALIADEEATLKRLFRR-NGAIALEAENPAYETRVLSPNQVKVQGRLV 232


>gi|134295270|ref|YP_001119005.1| putative phage repressor [Burkholderia vietnamiensis G4]
 gi|134138427|gb|ABO54170.1| putative phage repressor [Burkholderia vietnamiensis G4]
          Length = 238

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 64/227 (28%), Gaps = 16/227 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDP-TSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
             I + I        L+   LA   GL    S  + ++   EG    P  + + K+  A 
Sbjct: 10  DDIHKRIKAKRLEKGLSMQQLATAVGLKGWQSVQQWEKPDDEGGT-APRRDKLQKVADAL 68

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             T   L            + +    +          F        G             
Sbjct: 69  GVTAEWLQFGA---PAPENRDQARQVVHLRDEVEIPRFDARASMGPGAIIPENDTIVEFV 125

Query: 126 PHNGI--------YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                        +   +          SM   +  GD+L +++ +     D + +    
Sbjct: 126 RVTKSWIREALPTFTSMSNLALMPAHGDSMEESFSDGDLLWIDTGVCEVKIDAVYVLALN 185

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARILWA 221
             +  K L  R   SI ++S N  Y    +E  +      + R+++A
Sbjct: 186 DQLYVKRLQRRPDGSILMISDNKKYEPYLIENGERQRFRVLGRVIFA 232


>gi|293409515|ref|ZP_06653091.1| conserved hypothetical protein [Escherichia coli B354]
 gi|222032902|emb|CAP75642.1| phage-related repressor protein [Escherichia coli LF82]
 gi|281178259|dbj|BAI54589.1| phage transcriptional regulator [Escherichia coli SE15]
 gi|291469983|gb|EFF12467.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 230

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 62/229 (27%), Gaps = 23/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + ++   E+  ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLADRLNLAMEQSGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L           ++  K        P              G         E+
Sbjct: 55  ALGVRTEWLSSGIGPMRNDGQQLGKPTAN---HPKYFKIDVLDIEVSAGPGVINREFVEV 111

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                  +                    +  SM      GD+L ++  ++   GD +   
Sbjct: 112 LRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAF 171

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
                   K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 172 LYDDTAHVKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 219


>gi|77462544|ref|YP_352048.1| LexA repressor [Rhodobacter sphaeroides 2.4.1]
 gi|332557429|ref|ZP_08411751.1| LexA repressor [Rhodobacter sphaeroides WS8N]
 gi|6685608|sp|Q9ZFA4|LEXA_RHOS4 RecName: Full=LexA repressor
 gi|4185550|gb|AAD09122.1| LexA repressor [Rhodobacter sphaeroides]
 gi|77386962|gb|ABA78147.1| LexA repressor [Rhodobacter sphaeroides 2.4.1]
 gi|332275141|gb|EGJ20456.1| LexA repressor [Rhodobacter sphaeroides WS8N]
          Length = 228

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 65/223 (29%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + I    +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQMELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +               +              +    +G+      G    G     +
Sbjct: 61  ARAIEIVKLPEAMERAGFSARAAKAAAAPLPKGAVTVETAGALDLPLMGRIAAGLPIEAI 120

Query: 119 -GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
            G P+  +    + + + Q    + +  SM+      GDI+++      + GD ++    
Sbjct: 121 NGGPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTADNGDIVVALVA 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K    R G  I L   N  Y         ++   R++
Sbjct: 181 DHEATLKRYRRR-GGMIALEPANDSYETQVYPEQMVKVQGRLV 222


>gi|319776198|ref|YP_004138686.1| putative phage repressor [Haemophilus influenzae F3047]
 gi|301168972|emb|CBW28569.1| unnamed protein product [Haemophilus influenzae 10810]
 gi|317450789|emb|CBY87011.1| Putative phage repressor [Haemophilus influenzae F3047]
          Length = 219

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 73/222 (32%), Gaps = 24/222 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKA-GLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              + I + I +      LT   +A    G+   + ++ +    +     P++E++  + 
Sbjct: 1   MKSETIGKRIRQRRTELKLTQKDVANAIKGVSHVAISQWESDTTK-----PNSENLVDLS 55

Query: 63  AATNETICQ--LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
                 +      +   S+         ++PL+ +  +G+    D     TG+       
Sbjct: 56  TVLECDLLWLLRGEGSSSNVMPASIGTNKVPLISYVQAGTWTGIDDLKESTGDFNYIYTF 115

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
            +                  + +  SM P ++ GD++I++  I+   G+ +       + 
Sbjct: 116 IDTSD----------DAFALEIKGDSMEPDFKAGDVIIIDPRIEPRAGEFVAAINGDYEA 165

Query: 181 VAKVLISRRG------RSIDLMSLNCCYPVDTVEMSDIEWIA 216
             K                +L+ LN  YP  +    +I  I 
Sbjct: 166 TFKKYRPIGDIDELGRHHFELVPLNSDYPTLSSLKQEIRIIG 207


>gi|325529755|gb|EGD06606.1| putative phage repressor [Burkholderia sp. TJI49]
          Length = 212

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 67/207 (32%), Gaps = 28/207 (13%)

Query: 24  PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS----- 78
              LA  AG+   + ++      +G+ +    E    I          L+          
Sbjct: 9   QVELADAAGVTKGTVSQWL----DGKIKSIKLEYAVGIQKRYGYNPVWLVMGEGEKKLGT 64

Query: 79  ----DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQ 134
               +    +   + +PL+    +G         FP G  +  +              + 
Sbjct: 65  PGYANVTPAQVGSRRVPLISSVQAGRMTEAVD-PFPPGGAFEYL---------LTDLDLS 114

Query: 135 TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR--- 191
                 + +  SM P +  GD +I++ AIQ   GD ++ K    +   K   +R      
Sbjct: 115 DYAFALEIEGLSMAPDFNPGDRIIIDPAIQPRPGDFVVAKNGREEATFKKYRARGVGADG 174

Query: 192 --SIDLMSLNCCYPVDTVEMSDIEWIA 216
             + +L+ LN  YP  + E   +  I 
Sbjct: 175 REAFELIPLNPDYPTISSEHERVRIIG 201


>gi|237731126|ref|ZP_04561607.1| P22 repressor protein c2 [Citrobacter sp. 30_2]
 gi|226906665|gb|EEH92583.1| P22 repressor protein c2 [Citrobacter sp. 30_2]
          Length = 208

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 70/218 (32%), Gaps = 24/218 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + + I  +      +   L +  G+   +    ++         P  ES+ K+    N
Sbjct: 2   ETVGQRIKALRRVTKTSQKELGKFCGVSDVAVGYWEKDINV-----PGGESLSKLAKYFN 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +    +            K + IP++ +  +G      +               E+   
Sbjct: 57  TS-IDYILYGTEFEGNLITKMRRIPVISWVQAGQFTECKAAEV----------FSEVDKW 105

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDI 180
                 I       + +  SM     LP   +G  +I++   +   G  ++ +   T + 
Sbjct: 106 VETSLRIGDSAFALEVKGDSMTNPNGLPTIPEGATVIVDPDAEPLHGKIVVARLDGTNEA 165

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             K L+    +   L+ LN  YP  ++  + +  I  +
Sbjct: 166 TVKKLVIDGPQKF-LVPLNPRYPNISINGNCL-IIGVV 201


>gi|221140342|ref|ZP_03564835.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|296277216|ref|ZP_06859723.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           MR1]
 gi|302333665|gb|ADL23858.1| phage transcriptional regulator [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|329314675|gb|AEB89088.1| Phage transcriptional regulator [Staphylococcus aureus subsp.
           aureus T0131]
          Length = 235

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 76/246 (30%), Gaps = 39/246 (15%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+SFS       ++R+  + +++ S LA    ++ T+  + ++       R P  + + +
Sbjct: 1   MSSFS-----SNLERLMNKRDMSDSELAELVDVNRTTVTRWRKGI-----RSPKLDKLPE 50

Query: 61  ILAATNETICQLLDLPF--------SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP-- 110
           I          L+             +  +     ++  +L +  +      +       
Sbjct: 51  IANVFGVKPLDLIHDMDDSKIIEEIHNVSSQLTPPRQSNVLKYATNQLEEQNNDSDNLVD 110

Query: 111 ----------------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
                                      E  S       +   D   K    SM PL++ G
Sbjct: 111 FNSYIQEKSEVDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNG 170

Query: 155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIE 213
            I+ +  +  +  G   +     GD   K +       + L+SLN  Y      +   + 
Sbjct: 171 QIIFIEKSHTIKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLHFYDNESVR 228

Query: 214 WIARIL 219
            + +++
Sbjct: 229 LVGKVI 234


>gi|15676805|ref|NP_273950.1| transcriptional regulator [Neisseria meningitidis MC58]
 gi|121634684|ref|YP_974929.1| transcriptional regulator [Neisseria meningitidis FAM18]
 gi|254804773|ref|YP_003082994.1| putative phage repressor protein [Neisseria meningitidis alpha14]
 gi|7226147|gb|AAF41318.1| transcriptional regulator [Neisseria meningitidis MC58]
 gi|120866390|emb|CAM10133.1| Transcriptional regulator [Neisseria meningitidis FAM18]
 gi|254668315|emb|CBA05285.1| putative phage repressor protein [Neisseria meningitidis alpha14]
 gi|308389079|gb|ADO31399.1| Transcriptional regulator [Neisseria meningitidis alpha710]
 gi|325132324|gb|EGC55017.1| peptidase, S24 family [Neisseria meningitidis M6190]
 gi|325144297|gb|EGC66602.1| peptidase, S24 family [Neisseria meningitidis M01-240013]
 gi|325202301|gb|ADY97755.1| peptidase, S24 family [Neisseria meningitidis M01-240149]
          Length = 238

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/241 (14%), Positives = 71/241 (29%), Gaps = 25/241 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHN-LTPSGLARKAGLDPTSFNKSKRFGIEGR---------- 49
           MT   H+   + +  +A+    L P+ +A +  +   +    +  GI  +          
Sbjct: 1   MTM--HET-TDRLFEIAKEQGVLKPADIAERLNISQQALKNWESRGIAAKALPEVAKAFG 57

Query: 50  --NRWPSTESIFK-----ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG 102
               W  T    +     I       +  +              +  + + Y   S   G
Sbjct: 58  VSETWLRTGEGSRTAPVLIDPDLPHEVKDIHRPMTWSSNDPLPDDDYVFVPYLKESCFKG 117

Query: 103 FFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
              +   P  N +    +P  +S                    SM     +   + +++ 
Sbjct: 118 GVGTYEIPDYNGY---RLPFGKSTLKRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTG 174

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWA 221
                  ++    + G    K LI + G S+ + S N   Y  +   +  +  I R+ W 
Sbjct: 175 ETAIRDGKIYAFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYGDENAPLDSLTVIGRVFWW 234

Query: 222 S 222
           S
Sbjct: 235 S 235


>gi|24374516|ref|NP_718559.1| prophage LambdaSo, Cro/CI family transcriptional regulator
           [Shewanella oneidensis MR-1]
 gi|24349105|gb|AAN56003.1|AE015737_1 prophage LambdaSo, transcriptional regulator, Cro/CI family
           [Shewanella oneidensis MR-1]
          Length = 272

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/260 (15%), Positives = 74/260 (28%), Gaps = 46/260 (17%)

Query: 7   KKIWEAIDRMAERHNL-TPSGLARKAGLDPTS-FNKSKRFGIEGRNRWPSTESIFKILAA 64
           KK+   I R+  +  + + + LA   G    S     +             E++ K+L  
Sbjct: 8   KKVGRNIKRLRLKAGIKSQAALAELCGWKSQSRVGNYEAGTRAVS--AIDAETLAKVLNV 65

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP-------------SGSGGFFDSGVFPT 111
           T   I    +    D  +    +                       +     F+     T
Sbjct: 66  TPAEILYGENNKDDDFVSMPSAQYSSGPYEEEDPFQLFKPKQELQNAEWHAGFELWDGDT 125

Query: 112 GNKWNTVGVPEIR-------------------------SPHNGIYAIQTQDTRHKTQDTS 146
             + + V +P  R                         S         +          S
Sbjct: 126 PLRDDEVALPFYREVELAAGSGSTFVQENGGCKLRFAKSTLKKSRVEPSNAACVTVSGNS 185

Query: 147 MLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVD 205
           MLP+ R G  + ++++ +      +      G +  K+L    G  I + S N   +P +
Sbjct: 186 MLPVLRHGTTVGVDTSKKSIIDGEMYAIDHDGMLRVKMLYRTPGGGIRIKSYNNDEFPDE 245

Query: 206 TVEMS---DIEWIARILWAS 222
            +      DI+ I  + W S
Sbjct: 246 FIPPEKASDIKIIGWVFWWS 265


>gi|284025046|ref|ZP_06379444.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           132]
          Length = 235

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 76/246 (30%), Gaps = 39/246 (15%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+SFS       ++R+  + +++ S LA    ++ T+  + ++       R P  + + +
Sbjct: 1   MSSFS-----SNLERLMNKRDMSDSELAELVDVNRTTVTRWRKGI-----RSPKLDKLPE 50

Query: 61  ILAATNETICQLLDLPF--------SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP-- 110
           I          L+             +  +     ++  +L +  +      +       
Sbjct: 51  IANVFGVKPLDLIHDMNDSKIIEEIHNVSSQLTPPRQSNVLKYATNQLEEQNNDSDNLVD 110

Query: 111 ----------------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKG 154
                                      E  S       +   D   K    SM PL++ G
Sbjct: 111 FNSYIQEKSEVDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNG 170

Query: 155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIE 213
            I+ +  +  +  G   +     GD   K +       + L+SLN  Y      +   + 
Sbjct: 171 QIIFIEKSHTIKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLHFYDNESVR 228

Query: 214 WIARIL 219
            + +++
Sbjct: 229 LVGKVI 234


>gi|229117182|ref|ZP_04246561.1| Phage transcriptional repressor [Bacillus cereus Rock1-3]
 gi|228666350|gb|EEL21813.1| Phage transcriptional repressor [Bacillus cereus Rock1-3]
          Length = 223

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 76/226 (33%), Gaps = 12/226 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M  F  K   + + R+ +    +    A K GL PT+  +S      G+    S +++ K
Sbjct: 1   MVKFMEK--AKIVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIK 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +      T   L  L      T +++      +    S        G    G        
Sbjct: 55  VCKGLGITTDDLEVLTTKGDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEEN 114

Query: 121 PEIRSPHNGIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            E   P    +   + +      + TSM   +  G  +++     V  G   ++K    D
Sbjct: 115 IEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYD 174

Query: 180 IVAKVLISRRGRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
              K +    G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 175 ATVKKISK-SGSIITLIPLSNDPIHEPQTYDLSAEDVKIIGRVVQA 219


>gi|226940092|ref|YP_002795165.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
 gi|226715018|gb|ACO74156.1| Transcriptional regulator [Laribacter hongkongensis HLHK9]
          Length = 242

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/232 (16%), Positives = 75/232 (32%), Gaps = 24/232 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
            ++I   I  +A+R+ L+    A  AG+   S  +     +      P   ++ ++    
Sbjct: 13  EEEIGTRIRVVADRY-LSRQAAADAAGVSLISLRRYINGEV-----HPPFATLARLALPQ 66

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFP------PSGSGGFFDSGVFPTGNK-WNTV 118
             ++  L          T       P L                  S     G   W   
Sbjct: 67  GVSLHWLATGEGEQDEKTAAAAVPCPCLDTLGNPVDLEEFVFIPRYSVRAAAGCGQWPED 126

Query: 119 GVPEIRSPHNGIY------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
             P         +      A   + +       SM  +    D++++N A +   G   +
Sbjct: 127 ESPRFSMAFRRYWVENYLRANPDELSVIAVDGDSMEGVLNDRDVILVNHADRDPRGSIYV 186

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM----SDIEWIARILW 220
           ++   G +V K +    G  +++ S N  Y   TVE+     D + I R++W
Sbjct: 187 LRID-GHLVVKQVQRLPGGILEVSSSNPAYKPFTVELGKVGDDFDVIGRVVW 237


>gi|284008034|emb|CBA74134.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 232

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 70/230 (30%), Gaps = 22/230 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E I +    + +T   L ++ G+   + ++ +    E   +  +  S+ K L  T E + 
Sbjct: 4   ERIRQARNHNKMTQESLGKRIGVSKATISQWESGTTEPNGK--NLVSLAKALGVTIEWLL 61

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG-------FFDSGVFPTGNKWNTVGVPEI 123
              +            +       +  +   G       FF       G     V +   
Sbjct: 62  DGDEKNAEVNAQLANAKIIGNFAPWDSNTPLGEDEIELPFFKEISLSAGKGS-FVTLDNN 120

Query: 124 RSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                  Y+                    SM P+   G    ++ +       ++     
Sbjct: 121 GYKLRFAYSTLRKAGVDPANAACVSITGNSMEPVVPDGATAGIDRSDTNIKDGQMYAIEH 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCC-YPVDTV---EMSDIEWIARILWAS 222
            G +  K+L    G  I + S N   Y  +     ++S+I+ + ++ W S
Sbjct: 181 EGMLRVKILYRIPGG-IRIRSYNRDEYADEDYIGSDISNIKIMGKVFWYS 229


>gi|315143625|gb|EFT87641.1| peptidase S24-like domain protein [Enterococcus faecalis TX2141]
          Length = 228

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 72/229 (31%), Gaps = 27/229 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIE---------------------GRNR 51
           I  + ++  +T + LA K G+  ++ ++ +    +                     G   
Sbjct: 4   ITDLRKQKKMTSTELAEKVGIAKSAMSRYENRTRQFPVNKISDFAKALETSPEYLLGFEE 63

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            P ++ + KI   + +   +            EK+  +        +             
Sbjct: 64  EPLSQILTKINETSAKLETKRQKNVLIF---AEKELDKQNFETESRNRKVVPLVGKTAAN 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
                   +      H+  +  +  D     Q  SM PL + G I+       V  G+  
Sbjct: 121 PAVLEYGDI--DVEQHSFAHVPEGADCAINIQGDSMEPLIKDGSIVFYKKQCDVENGEIA 178

Query: 172 LIKPRTGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +++     +  K +I     + I L S+N  Y    +E   I  I +++
Sbjct: 179 IVEIDNDGVTCKKVIKDYSNKQIILRSINTKYEDRILENEKIRIIGKVI 227


>gi|149915046|ref|ZP_01903575.1| putative phage repressor [Roseobacter sp. AzwK-3b]
 gi|149811234|gb|EDM71071.1| putative phage repressor [Roseobacter sp. AzwK-3b]
          Length = 220

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/208 (20%), Positives = 76/208 (36%), Gaps = 8/208 (3%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            ER N++ + +ARKAG+   +    KR    G+ +  S E   KI  A    +  +    
Sbjct: 14  LERQNVSVAEIARKAGVPYDAVRDIKR----GKVQSTSWERAVKIAQALGIDLEDVSPAT 69

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
               +  E    ++  +           D  V        ++  P          A    
Sbjct: 70  SKTKQVIEPASSKLQAMVSVYDVYASAGDGAVVIHEEPIGSLAFPANYLR-QLTQANWRD 128

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI-VAKVLISRR-GRSID 194
                 +  SMLP     D+++L+ + +    D L +    G+  + K +        + 
Sbjct: 129 LAIISVKGDSMLPTLADDDVVMLDRSKRDLSYDGLFVIRDNGEALLVKRIQRAPTPGHVM 188

Query: 195 LMSLNCC-YPVDTVEMSDIEWIARILWA 221
           ++S N   Y     ++SDIE I R++WA
Sbjct: 189 IISDNRALYDPVEKKLSDIEVIGRVIWA 216


>gi|296504207|ref|YP_003665907.1| LexA repressor [Bacillus thuringiensis BMB171]
 gi|296325259|gb|ADH08187.1| LexA repressor [Bacillus thuringiensis BMB171]
          Length = 219

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 5   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 61  DLERLTTQEDNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST 120

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 121 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 179

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 180 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 215


>gi|149914774|ref|ZP_01903304.1| LexA repressor [Roseobacter sp. AzwK-3b]
 gi|149811567|gb|EDM71402.1| LexA repressor [Roseobacter sp. AzwK-3b]
          Length = 233

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 61/229 (26%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     +   I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLAFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +           P           +         S        G    G
Sbjct: 61  ARALEIVKLPESLGGEAS-HGFTPRVIEGDKPSAPQPANSYGVDASDVIDVPMMGRIAAG 119

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +          G   + +      + +  SM       GD++I+      + GD 
Sbjct: 120 VPIEAIAHASHNVTVPGSMLSGKGVHYALEVRGDSMIEAGINDGDVVIIRETNTADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G +I L + N  Y    +    ++   R++
Sbjct: 180 VVALVEDQEATLKKFYRR-GNAIALEAANPAYETRVLPEDQVKVQGRLV 227


>gi|38229113|ref|NP_938208.1| c repressor [Pseudomonas phage D3112]
 gi|579180|emb|CAA36500.1| putative repressor [Pseudomonas phage D3112]
 gi|37595164|gb|AAQ94439.1| c repressor [Pseudomonas phage D3112]
          Length = 240

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 78/230 (33%), Gaps = 22/230 (9%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
            +F+ + +   I  +A   + +   LA++ G+  T   +  +            E +  I
Sbjct: 20  PTFTQE-VGTRIAEVARLLD-SRRALAKQVGIHETQLYRYIKGINAAAP-----ELLSAI 72

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---- 117
             A   ++  L++      +  E  +                   G    G+   T    
Sbjct: 73  AKAGRVSLDWLINGEEVAAKPVEGAKS------IEGEYVYIPLYDGQVSAGHGSWTDGAT 126

Query: 118 --VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
             V +   R          +  +  +    SM PL   GD ++++          + +  
Sbjct: 127 VLVNLAFTRYSLRKKGLDPSSISAIRIGGDSMEPLLCDGDTVLVDHTKSTVQDAAVYVVR 186

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE---MSDIEWIARILWAS 222
               + AK L  R   S+ ++S N  Y    V    +SD+E I R++WAS
Sbjct: 187 LDDHLYAKRLQRRFDGSVSIISENKAYTEMIVPKAKLSDLEIIGRVVWAS 236


>gi|256843106|ref|ZP_05548594.1| transcriptional regulator [Lactobacillus crispatus 125-2-CHN]
 gi|256614526|gb|EEU19727.1| transcriptional regulator [Lactobacillus crispatus 125-2-CHN]
          Length = 209

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 75/222 (33%), Gaps = 18/222 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             S++++ + ++ + +  +++ + LAR+ GL  +S ++        + R      +    
Sbjct: 1   MRSNEEVVDYVNELRKSQHMSINELARETGLAKSSLSRYFN-----KTRGFPVNKVNLFA 55

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            A +    ++L +  ++ +  ++       +    + + G          + + T    E
Sbjct: 56  KALHVKPEEILGIQPTNMKPIDQTGMHAIRIPIIGTIACGTPILAEQNI-DGYTTELFEE 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIV 181
                             K Q  SM P    G  + +     V   +   ++     +  
Sbjct: 115 KPD---------GTLFALKCQGDSMEPKIPNGATVTVRLQPTVEDDEIAAVLVDDDEEAT 165

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARILWAS 222
            K +    G+ + LM  N  Y    +   +    + +++  S
Sbjct: 166 LKRV-KHVGKQVMLMPENKKYDPILLNEENPGRILGKVVKVS 206


>gi|254421027|ref|ZP_05034751.1| LexA repressor [Brevundimonas sp. BAL3]
 gi|196187204|gb|EDX82180.1| LexA repressor [Brevundimonas sp. BAL3]
          Length = 233

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 60/227 (26%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQHELLMFIHERIQETGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPF-----SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            + L  T          P                   P      + +      G    G 
Sbjct: 61  ARALEVTKLPEQATAGAPRGRAGFKPDVIEGGGGAPRPAAVSAANDTRELPLLGKIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
               +   + R         +      + +  SM       GD++++      N G+ ++
Sbjct: 121 PIAAIQHEQERLSVPESMLGKGDHYLLEIEGDSMIEAGILNGDLVVIRRGDTANNGEIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K L  + G SI L   N  Y         +E   +++
Sbjct: 181 ALVEGEEATLKRLRRK-GGSIALEPANRNYETRIFGPDQVEVQGKLV 226


>gi|288818209|ref|YP_003432557.1| putative prophage repressor [Hydrogenobacter thermophilus TK-6]
 gi|288787609|dbj|BAI69356.1| putative prophage repressor [Hydrogenobacter thermophilus TK-6]
          Length = 235

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/220 (12%), Positives = 69/220 (31%), Gaps = 15/220 (6%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   +  + +   L+      + G    +    +   ++         ++  I +    
Sbjct: 11  NIHNRLRYLRKTLGLSQEEFGERIGKSLRTIQYWEAGTVQ-----IPDTALKLIASTFGV 65

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT----VGVPEI 123
           +   L           +   +EI                 V   G  +      + V  +
Sbjct: 66  SYEWLKTGQGEMWGREKLSLEEIIEREQRKLLESKIKVPVVGKAGAGFPHSPSDIEVIGV 125

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS----AIQVNCGDRLLIKPRTGD 179
                  Y  + +    +    SM P   +GD ++  +       +  G  ++++  +G+
Sbjct: 126 VFVSKSPYLKEGKIFAVQVSGDSMHPALTEGDYVVFQTYEGDGSDIPNGKIVVVRNHSGE 185

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++ K L+     ++ L   N  YP    + ++ E + RI+
Sbjct: 186 LLVKRLLKM-NGTVLLAGDNPKYPPIFPQQAEAEGL-RIV 223


>gi|229151903|ref|ZP_04280100.1| Phage transcriptional repressor [Bacillus cereus m1550]
 gi|229191824|ref|ZP_04318797.1| Phage transcriptional repressor [Bacillus cereus ATCC 10876]
 gi|228591648|gb|EEK49494.1| Phage transcriptional repressor [Bacillus cereus ATCC 10876]
 gi|228631559|gb|EEK88191.1| Phage transcriptional repressor [Bacillus cereus m1550]
          Length = 223

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 9   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 64

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 65  DLERLATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENIEGYLPMLST 124

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 125 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 183

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 184 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|293402168|ref|ZP_06646306.1| LexA repressor [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304275|gb|EFE45526.1| LexA repressor [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 213

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 18/210 (8%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + ++ E   L+   +++  G+  TSF+  +R     +   PS + +  +    N  I 
Sbjct: 11  NRLMKILEEKGLSSYQVSKDTGISQTSFSDWRR-----KKSSPSFKKLKILADYLNVDIE 65

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  +     +  + KE +I +  F          +G F   +    + +P+     N  
Sbjct: 66  YLGGVTDERIKKPDIKEHQIQIPLFARLS----CGTGSFVDEDIIEYISLPDTILKPNKE 121

Query: 131 YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           Y        +  +  SM+      GD+L+      ++ G          + V K +    
Sbjct: 122 Y------FANYAKGDSMIGAGINDGDLLVFEKTNVLDNGSIGAFCVDNEEAVCKRIRKSE 175

Query: 190 GRSIDLMSLNCCYPVDTVEMSD--IEWIAR 217
              I L+  N  Y    +++ D     + +
Sbjct: 176 QGLIMLLPANEKYDPIIIDVKDTCFRIVGK 205


>gi|226328528|ref|ZP_03804046.1| hypothetical protein PROPEN_02422 [Proteus penneri ATCC 35198]
 gi|225203261|gb|EEG85615.1| hypothetical protein PROPEN_02422 [Proteus penneri ATCC 35198]
          Length = 239

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 67/203 (33%), Gaps = 5/203 (2%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + + +  +  N+    L+ + G+      +        + R    E + K + +T   + 
Sbjct: 22  KRLTQRMKEVNVDIRQLSEQVGVSYEMARRYTLGTA--KPRDDKMELVAKTVFSTPAYLD 79

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
             + L         K    +  +    S   G+      P      ++ +P+ R      
Sbjct: 80  YGIGLETDPKNEFNKDTAIVRQIEVFASAGNGY---VNNPFPEVVRSIEIPQERVYELFG 136

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
            +             SM P     D+L +++ I    GD + I         K L   +G
Sbjct: 137 RSNLDGVMIINVDGDSMTPTLNPKDLLFIDTKINQFNGDGIYIFNFEDSTFIKRLQRVKG 196

Query: 191 RSIDLMSLNCCYPVDTVEMSDIE 213
           R + ++S N  YP   ++  +I 
Sbjct: 197 RKLAVISDNDFYPPFFIDDHEIH 219


>gi|171742503|ref|ZP_02918310.1| hypothetical protein BIFDEN_01615 [Bifidobacterium dentium ATCC
           27678]
 gi|171278117|gb|EDT45778.1| hypothetical protein BIFDEN_01615 [Bifidobacterium dentium ATCC
           27678]
          Length = 244

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 65/219 (29%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +K+ +AI     +    PS   +   AGL  P+S  ++ +    +G  R  + +     
Sbjct: 31  QRKVLDAIKTHLAQRGFAPSFREIGEAAGLKSPSSVKHQLQVLEEKGFIRMSANKGRAIE 90

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +                   T     + I   +  P          +    +  + + +P
Sbjct: 91  VVDLEGPASGNGVAEVIPFPTGVDSSESIMASHDVPLVGRIAAGVPITAEQHIDDVMRLP 150

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E  +               +    SM+      GD +++        GD +       + 
Sbjct: 151 ERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQHTAENGDIVAALLD-DEA 202

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y     + +  E + +++
Sbjct: 203 TVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 238


>gi|218551631|ref|YP_002385423.1| Repressor protein C2 [Escherichia fergusonii ATCC 35469]
 gi|218359173|emb|CAQ91836.1| Repressor protein C2 [Escherichia fergusonii ATCC 35469]
          Length = 208

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/218 (12%), Positives = 69/218 (31%), Gaps = 24/218 (11%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + + I  +      +   L +  G+   +    ++         P  E++ K+    N
Sbjct: 2   ETVGQRIKALRRVTRTSQKELGKFCGVSDVAVGYWEKDINV-----PGGEALSKLAKFFN 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +    +              + +P++ +  +G      +               E+   
Sbjct: 57  TS-IDYILYGAEFEGKLVTNMRRVPVISWVQAGQFTECRAAEV----------FSEVDKW 105

Query: 127 HNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDI 180
            +    I       + +  SM     LP   +G  +I++   +   G  ++ +   T + 
Sbjct: 106 VDTSLKIGDNSFALEVKGDSMTNPNGLPTIPEGATVIVDPDAEPRHGKIVIARLDGTNEA 165

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             K L+    +   L+ LN  YP   +  + +  I  +
Sbjct: 166 TVKKLVIDGPQKF-LVPLNPRYPNIPINGNCL-IIGVV 201


>gi|317154419|ref|YP_004122467.1| peptidase S24/S26A/S26B [Desulfovibrio aespoeensis Aspo-2]
 gi|316944670|gb|ADU63721.1| Peptidase S24/S26A/S26B, conserved region [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 223

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 68/212 (32%), Gaps = 13/212 (6%)

Query: 15  RMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
           R+    ++ + S LAR+  +   + + SKR G     RW    S    L        +  
Sbjct: 17  RLCSETDIASQSQLARELEVGRAAVSLSKRKGTVP-PRWILDLSARFGLNPLWLEKGKGA 75

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
               +     +    EIP +       GG F++     G                G    
Sbjct: 76  VRAEAACDPADTPYHEIPKVRARLCAGGGSFET----EGQVEGYYSFRSDWLRSRG---N 128

Query: 134 QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSI 193
                  +    SM P  ++GD+++++ A        +        ++ K +       +
Sbjct: 129 PANMVLMEVVGNSMEPEIKEGDMVLIDQARCDILSGSIYAVGVEDTVMVKRVERLP-GIL 187

Query: 194 DLMSLNCCYPVDTVEMSD---IEWIARILWAS 222
            L S N  Y    +   +   +  I +ILW S
Sbjct: 188 VLRSDNMDYSPIHLSGDELNNVRVIGKILWTS 219


>gi|228909524|ref|ZP_04073348.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 200]
 gi|228850115|gb|EEM94945.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 200]
          Length = 223

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 9   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 64

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 65  DLERLATQEDNTVKEEVSIYETIQKDQSNIIHIPIIGSVAAGTPIFAEENIEGYLPMLST 124

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 125 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 183

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 184 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|114705892|ref|ZP_01438795.1| LexA repressor [Fulvimarina pelagi HTCC2506]
 gi|114538738|gb|EAU41859.1| LexA repressor [Fulvimarina pelagi HTCC2506]
          Length = 238

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 24/233 (10%), Positives = 62/233 (26%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + ID       + PS    K  L+  S +   R       R       + 
Sbjct: 1   MLTRKQHELLKFIDARLNETGVPPSFDEMKDALELKSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATN----ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG------- 107
            + L            +         + +  +  +        +   G  +         
Sbjct: 61  ARALEVLKLPDAMRRPEPQQPAQRGFKPSVIEGSKGQPPKPRGASDEGAANENVSIPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVN 166
               G   + +              +  +    + +  SM       GD +++  +    
Sbjct: 121 RIAAGVPISAIQHNTHSISIPPDMIMGGEHYALEVKGDSMIEAGILDGDTVVIRRSETAV 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+ ++      +   K    ++G +I L + N  Y         +    +++
Sbjct: 181 PGEIVVALVDDEEATLKRF-RKKGDTIALEAANPAYETRIFGADRVRVQGKLV 232


>gi|228959912|ref|ZP_04121578.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229128978|ref|ZP_04257952.1| Phage transcriptional repressor [Bacillus cereus BDRD-Cer4]
 gi|229146271|ref|ZP_04274645.1| Phage transcriptional repressor [Bacillus cereus BDRD-ST24]
 gi|228637190|gb|EEK93646.1| Phage transcriptional repressor [Bacillus cereus BDRD-ST24]
 gi|228654476|gb|EEL10340.1| Phage transcriptional repressor [Bacillus cereus BDRD-Cer4]
 gi|228799764|gb|EEM46715.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 223

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 9   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 64

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 65  DLERLATQEDNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST 124

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 125 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 183

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 184 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|30021801|ref|NP_833432.1| LexA repressor [Bacillus cereus ATCC 14579]
 gi|29897357|gb|AAP10633.1| LexA repressor [Bacillus cereus ATCC 14579]
          Length = 219

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 5   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 61  DLERLATQEDNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST 120

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 121 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 179

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 180 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 215


>gi|85058275|ref|YP_453977.1| hypothetical protein SG0297 [Sodalis glossinidius str. 'morsitans']
 gi|84778795|dbj|BAE73572.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 232

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/224 (14%), Positives = 83/224 (37%), Gaps = 25/224 (11%)

Query: 4   FSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              +K+   I+ +     + + + L+R+ G+   + ++     ++   R    ++I K  
Sbjct: 3   LGTEKLKRNINSLMSNKQVKSVAELSRRIGMPQPTLHRMLNGEVK-SPRLAVVQNIAKFF 61

Query: 63  A-------------ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
                           N    ++        +       ++P+L     G GG++D   +
Sbjct: 62  NVEANDLLYKDLTLKDNHQPKEIPQTEIFPDKPIPLAFTKVPMLGTAQLGGGGYWDLQEY 121

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGD 169
             G     V  P                   K Q  SM+P  + G+ +++        GD
Sbjct: 122 AVGQGDGYVLWPTK----------DKDAFALKCQGDSMMPRIQHGEFVVVEPNRGYKPGD 171

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
            +L++   G+++ K+ + ++   ++L+S+N  +    ++   I+
Sbjct: 172 EVLVQDEQGEVMIKIFLFQKDGIVNLLSVNSKHAPTRLDAHTIK 215


>gi|312127456|ref|YP_003992330.1| transcriptional repressor, lexa family [Caldicellulosiruptor
           hydrothermalis 108]
 gi|312793672|ref|YP_004026595.1| transcriptional repressor, lexa family [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312875826|ref|ZP_07735816.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311777475|gb|ADQ06961.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311797307|gb|EFR13646.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180812|gb|ADQ40982.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 202

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 59/221 (26%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 8   KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                       +      +   P          +    N   T+ 
Sbjct: 68  EIVD---------------------DEFYVHRNVVQLPLVGKVTAGEPILAVENIEETMT 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM        DI+I+        GD ++      
Sbjct: 107 LPYDLVGTE-------DAFLLRVRGDSMIEAGIFDNDIIIVRRQNVAENGDIVVALID-D 158

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 159 EATVKRFYKEHD-HIRLQPENKAMEPIIVK--DVKILGKVI 196


>gi|254455849|ref|ZP_05069278.1| LexA repressor [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082851|gb|EDZ60277.1| LexA repressor [Candidatus Pelagibacter sp. HTCC7211]
          Length = 225

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 61/223 (27%), Gaps = 4/223 (1%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +   K +   I++      ++PS    K  L+  S +   R       R        K
Sbjct: 1   MLTKKQKNLLLFINKKLRSSGVSPSYEEMKQSLNLKSKSGIHRLISALEERGFIKRLAHK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
             A     + +           +    K         S        G    G     +  
Sbjct: 61  ARALEVIKLPETASANDIYNSFSPSVIKGGLDEVNINSDEIEVPVLGKIAAGTPVEAIQN 120

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              R P              K Q  SM      +GD +I+      + G  ++      +
Sbjct: 121 EVSRIPLPNNLEKNGDYFGLKVQGDSMIEAGINEGDTVIIKRTDTADNGKIVVALIDEHE 180

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
            + K +  ++G+ + L S N  Y         ++     +  S
Sbjct: 181 AMLKRI-RKKGKVVALESANRNYETKIFGPDRVKVQG--VLVS 220


>gi|26006818|sp|Q9A724|LEXA_CAUCR RecName: Full=LexA repressor
          Length = 234

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 65/230 (28%), Gaps = 14/230 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRN-- 50
           M +    ++   I    +   ++PS         LA K+G+        +  G   R   
Sbjct: 1   MLTRKQHELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHR-LITALEERGFIRRLAH 59

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R  + E +     AT     +                          + S      G   
Sbjct: 60  RARALEVVKLPQQATAAAPPKGRGAFRPQVFEGGGAPPPAASPAAAANDSRELPILGRIA 119

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G   + +     R P         +    + Q  SM       GD +I+        G+
Sbjct: 120 AGTPIDAIQHERERLPVPEAMLGAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTATSGE 179

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K L  ++G SI L + N  Y         +E   +++
Sbjct: 180 IVVAL-VGEEATLKRL-RKKGGSIALEAANPKYETRIFGPDQVEVQGKLV 227


>gi|315655235|ref|ZP_07908136.1| LexA repressor [Mobiluncus curtisii ATCC 51333]
 gi|315490490|gb|EFU80114.1| LexA repressor [Mobiluncus curtisii ATCC 51333]
          Length = 306

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/220 (12%), Positives = 63/220 (28%), Gaps = 12/220 (5%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
            +++   + R++++    PS   LA   GL   S  K     +  +    R P+T    +
Sbjct: 87  QQEVLTTLYRLSQKLAYPPSVRELAEAMGLSSPSSVKHHLDVLTQKGYLRRAPNTPRALE 146

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            +        +        G +       IP+     + +      G    G       +
Sbjct: 147 FVKLP--EGLETPSPDPVSGTSQSATITTIPVGIADTAVATPVPLVGQIAAGAPITAEEM 204

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            E        +    +      +  SM       GD +++    +   G+ +      G+
Sbjct: 205 VEDTFALPRRFTGSGELFMLAVKGDSMQEGGILDGDWVVVRHQNEARNGEIVAAMLD-GE 263

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K         + L+  N  Y            + +++
Sbjct: 264 ATVKEFSR-ADGHVWLLPHNENYAPI--PGDTATILGKVV 300


>gi|310815580|ref|YP_003963544.1| LexA repressor [Ketogulonicigenium vulgare Y25]
 gi|308754315|gb|ADO42244.1| LexA repressor [Ketogulonicigenium vulgare Y25]
          Length = 221

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 65/220 (29%), Gaps = 6/220 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +    ++ E ID+  +   + PS    K  LD  S +   R       R      I +
Sbjct: 1   MLTRKQLELLEFIDQRVKATGVPPSFEEMKEALDLKSKSGIHRLITALEERGF----IRR 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +           +    +       ++ ++         +      G    G     +  
Sbjct: 57  LAHRARALEVVRMPEMTAHKPAAAARKPQLVASALNTLAAIEVDVMGRIAAGVPIAAISE 116

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGD 179
              +                + Q  SM+ +    GDI+++  A   + GD ++      +
Sbjct: 117 VSHQVAVPQGMIGTGNHYALEVQGDSMIGIGINDGDIVVIRHADLASNGDIVVALVDEAE 176

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K    +    I L + N  Y    +  + +    +++
Sbjct: 177 ATLKRFRRQ-NGMIALEAANPAYETRLLPEARVRVQGKLV 215


>gi|167032201|ref|YP_001667432.1| putative phage repressor [Pseudomonas putida GB-1]
 gi|166858689|gb|ABY97096.1| putative phage repressor [Pseudomonas putida GB-1]
          Length = 234

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 65/223 (29%), Gaps = 12/223 (5%)

Query: 11  EAIDRMAERHN-LTPSGLARKAGLDPTSFNKSKRFGIE-GRNRWPSTESIFKILAATNET 68
             I  + +    ++    A    LD +  ++      + G     + E    + A    +
Sbjct: 6   RRIASLRKIMGTMSQKEFAEAHDLDASYLSQLLNGHRKLGEKAALNLELKIGLTAGMLTS 65

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
                    +         +      F          S        +  + V    + H 
Sbjct: 66  PPSESPTHKAPDNVVHLSARAGKDKNFILIPHLDIAASMGHGKAAPYMHIEVIRDMTVHL 125

Query: 129 GIYAIQT-------QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
               +Q                  SM   +  GD L+++  I     D + +    GD+ 
Sbjct: 126 DWLRMQGLTFSKVDNLAIISGNGDSMTGTFADGDALLVDRGITEVKTDAIYVFTLDGDLY 185

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEM---SDIEWIARILWA 221
            K L    G  + ++S N  YP  T+++     +   AR+L A
Sbjct: 186 IKRLQRLTGGQLRMISDNPIYPPITIDLSMIDRMHIQARVLLA 228


>gi|302871708|ref|YP_003840344.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574567|gb|ADL42358.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 202

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 59/221 (26%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 8   KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                       +      +   P          +    N   T+ 
Sbjct: 68  EIVD---------------------DEFYVHRNVVQLPLVGKVTAGEPILAVENIEETMT 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM        DI+I+        GD ++      
Sbjct: 107 LPYDLVGTE-------DAFLLRVRGDSMIEAGIYDNDIIIVRRQNVAENGDIVVALID-D 158

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 159 EATVKRFYKEHD-HIRLQPENKAMEPIIVK--DVKILGKVI 196


>gi|9635682|ref|NP_061595.1| repressor [Staphylococcus prophage phiPV83]
 gi|8918752|dbj|BAA97812.1| repressor [Staphylococcus prophage phiPV83]
 gi|298694365|gb|ADI97587.1| putative phage repressor [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 236

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/247 (13%), Positives = 76/247 (30%), Gaps = 40/247 (16%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+SFS       ++R+  + +++ S LA    ++ T+  + ++       R P  + + +
Sbjct: 1   MSSFS-----SNLERLMNKRDMSDSELAELVDVNRTTVTRWRKGI-----RSPKLDKLPE 50

Query: 61  ILAATNETICQLLDLPF--------SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP-- 110
           I          L+             +  +     ++  +L +  +      +       
Sbjct: 51  IANVFGVKPLDLIHDMDDSKIIEEIHNVSSQLTPPRQSNVLKYATNQLEEQNNDSDDNLV 110

Query: 111 -----------------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153
                                       E  S       +   D   K    SM PL++ 
Sbjct: 111 DFNSYIQEKSEVDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKN 170

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDI 212
           G I+ +  +  +  G   +     GD   K +       + L+SLN  Y      +   +
Sbjct: 171 GQIIFIEKSHTIKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLHFYDNESV 228

Query: 213 EWIARIL 219
             + +++
Sbjct: 229 RLVGKVI 235


>gi|312622282|ref|YP_004023895.1| transcriptional repressor, lexa family [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202749|gb|ADQ46076.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 202

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 60/221 (27%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 8   KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                      ++      +   P          +    N   T+ 
Sbjct: 68  EIVD---------------------EEFYVHRNVVQLPLVGKVTAGEPILAVENIEETMT 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM        DI+I+        GD ++      
Sbjct: 107 LPYDLVGTE-------DAFLLRVRGDSMIEAGIFDNDIIIVRRQNVAENGDIVVALID-D 158

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 159 EATVKRFYKEHD-HIRLQPENKAMEPIIVK--DVKILGKVI 196


>gi|330814024|ref|YP_004358263.1| SOS-response repressor and protease LexA [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327487119|gb|AEA81524.1| SOS-response repressor and protease LexA [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 208

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/201 (12%), Positives = 45/201 (22%), Gaps = 3/201 (1%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            +   ++PS    +  L   S +   R       R    + +     A            
Sbjct: 1   MKSDGVSPSYDEMRKSLSLKSKSGIHRLISALEERGF-IKRLAHKARALEVVKLPENASV 59

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
                       +  L     +        G    G     +       P          
Sbjct: 60  KDLFNNFTPSLIKGGLDDVKKTKENFIPLIGKIAAGLPIEAIEEHHEDIPCPPGTKNPDD 119

Query: 137 DTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDL 195
               K +  SM+      GD +I+        G  ++      +   K    +   +I L
Sbjct: 120 FYALKVEGDSMIDAGIHDGDTVIIKKTSTAENGKIVVALIDNHEATLKRYRKKSN-AIAL 178

Query: 196 MSLNCCYPVDTVEMSDIEWIA 216
            S N  Y         I+   
Sbjct: 179 ESANPAYETRIFGPERIKIQG 199


>gi|83311965|ref|YP_422229.1| LexA repressor [Magnetospirillum magneticum AMB-1]
 gi|123740455|sp|Q2W3A5|LEXA_MAGMM RecName: Full=LexA repressor
 gi|82946806|dbj|BAE51670.1| LexA repressor [Magnetospirillum magneticum AMB-1]
          Length = 235

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 58/230 (25%), Gaps = 12/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   ID       ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQYELLMFIDERLRATGISPSFDEMKDALDLKSKSGIHRLITGLEERGFIRRLAHR 60

Query: 59  FKILA--ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP------ 110
            + L      E        P +        +          +   G  DS   P      
Sbjct: 61  ARALEVVRLPENRNDQTLPPPAKAFAPNVIKGGFAASQLAGAPVAGPSDSVTLPLYGKIA 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G     +                           SM       GD +++ S      G 
Sbjct: 121 AGTPIEALRDHSNSVDIPASMLGSGNHYALTVDGDSMIEAGINDGDTVVIRSCDSAETGT 180

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      ++  K L  + G S+ L   N  Y    +    ++   R++
Sbjct: 181 IVVALVDDTEVTLKRLRRK-GTSVALEPANKAYETRVLPPDRVKVQGRLV 229


>gi|167465660|ref|ZP_02330749.1| LexA repressor [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322382028|ref|ZP_08055972.1| LexA repressor-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154007|gb|EFX46343.1| LexA repressor-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 205

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 61/227 (26%), Gaps = 37/227 (16%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           M   S ++  I E I    +     PS   +    GL   ++ +   +R   +G   R P
Sbjct: 1   MGKLSQRQQAILEFIKNEVKEKGYPPSVREIGEAVGLASSSTVHGHLERLEKKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL   + +                            P          +  T N
Sbjct: 61  TKPRAIEILDMDSSSTFSFSVTR-------------------VPLIGKVTAGMPITATEN 101

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P         Y              SM       GD++I+      + GD ++
Sbjct: 102 IEDYFPLPSH-------YVGDHNVFMLSVLGDSMIETGIHDGDLVIVRQQQTADNGDIVV 154

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       +    +  + +++
Sbjct: 155 AMTEDDEATVKRFYKEKD-HIRLQPENSSMAPIILSN--VSILGKVI 198


>gi|152989242|ref|YP_001346150.1| transcriptional regulator PrtR [Pseudomonas aeruginosa PA7]
 gi|150964400|gb|ABR86425.1| transcriptional regulator PrtR [Pseudomonas aeruginosa PA7]
          Length = 256

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 65/238 (27%), Gaps = 33/238 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + +     NL    LA  AG+   + +K      +      ST  + +I AA   +  
Sbjct: 14  ARLKQAMAMRNLKQETLAEAAGVSQNTIHKLTSGKAQ------STRKLIEIAAALGVSPV 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKWNT 117
            L     +    +     +   L   P                   +       G     
Sbjct: 68  WLQTGEGAPAARSPVPVADGSPLVLEPLHPWDSETPLDEDEVELPLYKEVEMSAGAGRTA 127

Query: 118 VGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           V   E R      YA         +     +    SM PL   G  + +++A        
Sbjct: 128 VREIEGR-KLRFSYATLRASGVDPSAAICAQLTGNSMEPLIMDGSTIGVDTATTHITDGE 186

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD-----IEWIARILWAS 222
           +      G +  K +    G  I L S N   YP +     D     I  I  + W S
Sbjct: 187 IYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDEEYSPEDMRSRQISMIGWVFWWS 244


>gi|194430884|ref|ZP_03063221.1| repressor protein C2 [Escherichia coli B171]
 gi|194411072|gb|EDX27557.1| repressor protein C2 [Escherichia coli B171]
 gi|324014358|gb|EGB83577.1| helix-turn-helix protein [Escherichia coli MS 60-1]
          Length = 207

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 69/211 (32%), Gaps = 21/211 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-STESIFKILAATNE 67
           +            +T   +A  AG+   S    +     GR R P +   + K L  +  
Sbjct: 3   LAARFKARRLELGMTQVEVANSAGVSQQSIESIE----SGRTRKPRNLLDLAKALKCSP- 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                L    +     E   + IP+L +  +G           TG  +  +         
Sbjct: 58  ---DWLLNGKNIMPLAEISTRRIPILSYVQAGELTEARDITDLTGE-FEYILADSD---- 109

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                I       +    SM P +++GDI+I++  +    G+ ++ K    +   K    
Sbjct: 110 -----IPETCFALRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNDGHEATFKKYRP 164

Query: 188 RRGRS--IDLMSLNCCYPVDTVEMSDIEWIA 216
                   +L+ LN  YP+      +++ I 
Sbjct: 165 LGIGIDDFELIPLNPDYPIFRSADMNLQIIG 195


>gi|228922414|ref|ZP_04085718.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837239|gb|EEM82576.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 223

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 75/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 9   EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 64

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +G T +++      +    S        G    G         E   P    
Sbjct: 65  DLERLATQEGNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST 124

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 125 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 183

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 184 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 219


>gi|225023311|ref|ZP_03712503.1| hypothetical protein EIKCOROL_00164 [Eikenella corrodens ATCC
           23834]
 gi|224943956|gb|EEG25165.1| hypothetical protein EIKCOROL_00164 [Eikenella corrodens ATCC
           23834]
          Length = 211

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 68/218 (31%), Gaps = 25/218 (11%)

Query: 17  AERHNLTPS---GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
             +  L+ S     A K G++ ++    K+ G+         E   KI   T  ++  L+
Sbjct: 4   RAKLALSASSDKDFAHKLGINASTVVGYKQRGVVP------LEQCIKIAEQTGVSLDWLI 57

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF-DSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
                  + T   +    ++  P             F   N    +           + A
Sbjct: 58  LGKGESDKNTAAGKATPSVVLVPLYDVPVSAGHGSFFDAENVIQQIPFDAEWLEREDLIA 117

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
              Q      +  SM P  +  DI++++  +    GD + +    G +  K L       
Sbjct: 118 --GQLACLPIEGDSMSPGLKTSDIVLVD--LTHQRGDGVFVLRLNGALRIKRLQWLADGR 173

Query: 193 IDLMSLNCCYPVDTVE----MSDIEW-------IARIL 219
           + + S N  Y  + V+      D          I R++
Sbjct: 174 LRISSDNPIYETEYVDPNTPPDDFAIIGFCHTKIGRVV 211


>gi|323699001|ref|ZP_08110913.1| putative phage repressor [Desulfovibrio sp. ND132]
 gi|323458933|gb|EGB14798.1| putative phage repressor [Desulfovibrio desulfuricans ND132]
          Length = 220

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 62/216 (28%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
               R+     +   S LAR+  +   + + +KR G     RW    S    L       
Sbjct: 7   AFFKRLCSETEIRNQSQLARELDVGRAAVSLAKRKGAVP-ARWILDLSARFGLNPLWLEQ 65

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
            +    P +      +       +    +             G                G
Sbjct: 66  GKGFPRPEAALAAAAEDGASYAEIPKVRARLCAGGG-SFETEGQVEGYYSFRSDWLTRRG 124

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                      +    SM P  ++GD+++++ +        +        ++ K +    
Sbjct: 125 ---NPANMVLMEVIGNSMEPEIKEGDMVLIDQSRTDVLSGGIYAVGVEDTVMVKRVERLP 181

Query: 190 GRSIDLMSLNCCYPVDTVEMSD---IEWIARILWAS 222
             ++ L S N  Y    +   +   +  I ++LWAS
Sbjct: 182 -GTLVLRSDNVDYSPVHLSGDELDNVRVIGQVLWAS 216


>gi|33600663|ref|NP_888223.1| putative phage repressor [Bordetella bronchiseptica RB50]
 gi|33568263|emb|CAE32175.1| putative phage repressor [Bordetella bronchiseptica RB50]
          Length = 227

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/224 (12%), Positives = 64/224 (28%), Gaps = 17/224 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M++       E +        ++ S LAR+  +   + +        G  +  + +++  
Sbjct: 1   MSTLQ-----ERLRDALADAQISQSELARRVKVSRGAISLWL----TGATKELTADNLLA 51

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
              A       L             ++        P +          +    +   +G 
Sbjct: 52  AAQALGVNPVWLGSGKGPKRSGEVAEQPYFDNNVAPAAAGSRRVPLINYVQAGELTEIGA 111

Query: 121 PEIRSPHNGIYA---IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                    +     +       +    SM P ++ GD +I++  I    GD ++ +   
Sbjct: 112 AFSGEAVEYLLTDMNLSQHAFALEITGLSMYPDFKPGDRIIVDQEICPQPGDFVVARNGG 171

Query: 178 GDIVAKVLISR-----RGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
            +   K    R          +L+ LN  YP    +   +  I 
Sbjct: 172 YEATFKKYRPRGLDANGNDVFELVPLNDDYPTLYSDRELLTIIG 215


>gi|153001771|ref|YP_001367452.1| putative phage repressor [Shewanella baltica OS185]
 gi|151366389|gb|ABS09389.1| putative phage repressor [Shewanella baltica OS185]
          Length = 241

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 67/241 (27%), Gaps = 24/241 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
              ++   + +    +    T + L    G+   S  K      +   +      I K+L
Sbjct: 1   MNKNESFADRLRTAMDEAGYTQASLGEAIGMAQPSVWKLTTGKTKNTRK---LYEIAKVL 57

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLY------------FPPSGSGGFFDSGVFP 110
             + E +    +      +   +++      +                    F     F 
Sbjct: 58  RVSPEWLLNGREPKKMGEQPNRQQQIPEKEEWGTLDAWDDSTPINSDEVEVPFLRDVEFA 117

Query: 111 TGNK----WNT----VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
            G+      +     +   +      G     +       +  SM P    G  + +N+ 
Sbjct: 118 CGDGTFNDEDYNGFKLRFSKSTLRKVGANTDGSGVICFPARGNSMEPYIPDGTTVAVNTN 177

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWA 221
            +     ++      G    KVL       ++++S N   Y  +      +E I R+ W 
Sbjct: 178 DKKIVDGKIYAINENGWKRIKVLRRSSPDKLNILSFNSDEYEPEDKPAESVEIIGRVFWY 237

Query: 222 S 222
           S
Sbjct: 238 S 238


>gi|71901484|ref|ZP_00683571.1| Peptidase S24, S26A and S26B [Xylella fastidiosa Ann-1]
 gi|71728740|gb|EAO30884.1| Peptidase S24, S26A and S26B [Xylella fastidiosa Ann-1]
          Length = 336

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 68/222 (30%), Gaps = 15/222 (6%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             I  + +   +T S +A    +   + +  KR G   +  + +  +  K+         
Sbjct: 107 RFIAALGKNREVTQSAIATFCNVSEQAVSGWKRTGRIDKKHFAALSTALKV--PLEYWYG 164

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW---NTVG----VPEI 123
           +              +  +      P +             G        V     +P  
Sbjct: 165 EAYGAERVGIDVRRIRAVDGEEGTDPETDVMIPVYDLEVSGGPGCTVPEYVETRYKLPFQ 224

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            +      A        K + +SM  +  +GD +++++  +    D +      G+   K
Sbjct: 225 INWLRTWDAKPNDILIAKVRGSSMEDVLYEGDKVVIHTKRRRIRNDAVYALVYGGEARIK 284

Query: 184 VLISRRGRSIDLMSLNCC---YPVDTVEMS---DIEWIARIL 219
            L      S+ ++S N     +P + V+      +  I +++
Sbjct: 285 RLFVMADGSLRIVSHNPDKGRFPDEVVQPDNLEQVSIIGQVI 326


>gi|16126145|ref|NP_420709.1| LexA repressor [Caulobacter crescentus CB15]
 gi|221234916|ref|YP_002517352.1| LexA repressor [Caulobacter crescentus NA1000]
 gi|13423353|gb|AAK23877.1| repressor LexA [Caulobacter crescentus CB15]
 gi|220964088|gb|ACL95444.1| LexA repressor [Caulobacter crescentus NA1000]
          Length = 245

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 65/230 (28%), Gaps = 14/230 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRN-- 50
           M +    ++   I    +   ++PS         LA K+G+        +  G   R   
Sbjct: 12  MLTRKQHELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHR-LITALEERGFIRRLAH 70

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           R  + E +     AT     +                          + S      G   
Sbjct: 71  RARALEVVKLPQQATAAAPPKGRGAFRPQVFEGGGAPPPAASPAAAANDSRELPILGRIA 130

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G   + +     R P         +    + Q  SM       GD +I+        G+
Sbjct: 131 AGTPIDAIQHERERLPVPEAMLGAGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTATSGE 190

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K L  ++G SI L + N  Y         +E   +++
Sbjct: 191 IVVAL-VGEEATLKRL-RKKGGSIALEAANPKYETRIFGPDQVEVQGKLV 238


>gi|148255849|ref|YP_001240434.1| LexA repressor [Bradyrhizobium sp. BTAi1]
 gi|166224555|sp|A5EK34|LEXA_BRASB RecName: Full=LexA repressor
 gi|146408022|gb|ABQ36528.1| SOS-response transcriptional repressor, LexA [Bradyrhizobium sp.
           BTAi1]
          Length = 232

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 60/227 (26%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I+   +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLRFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-----FDSGVFPTGN 113
            + +                    +  +     +    P+   G         G    G 
Sbjct: 61  ARAIEVIKLPELSQAASNRRGFTPSVIEGNLGKVRTSTPALDDGERPVAVPVMGRIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
               +                      + +  SM+      GD+ ++      + GD ++
Sbjct: 121 PIEALQTRSHTISVPADMLGNGDHYALEVRGDSMVDAGILDGDMALIQRNETADTGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K    R   SI L   N  Y V  +  + ++   +++
Sbjct: 181 ALIDDEEATLKRFRRRGA-SIALEPANTAYEVRILPPNRVKIQGKLV 226


>gi|167755401|ref|ZP_02427528.1| hypothetical protein CLORAM_00915 [Clostridium ramosum DSM 1402]
 gi|237733631|ref|ZP_04564112.1| SOS-response transcriptional repressor [Mollicutes bacterium D7]
 gi|167704340|gb|EDS18919.1| hypothetical protein CLORAM_00915 [Clostridium ramosum DSM 1402]
 gi|229383229|gb|EEO33320.1| SOS-response transcriptional repressor [Coprobacillus sp. D7]
          Length = 206

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 56/213 (26%), Gaps = 22/213 (10%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I ++ +   LT   L    G+  ++  K +      R      ++I K+    +   
Sbjct: 3   GERIKKLRKEKGLTQEQLGNLLGVKKSAIAKYENN----RVENLKKDTIQKLSEIFDVPA 58

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
              L +  S+                      G F        N    + +PE     + 
Sbjct: 59  SYFLGIDESNQPIITDSITIPLYSDIS--CGTGLFVDD-----NVDEYISLPETLLSPSK 111

Query: 130 IYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            Y              SM+     +GD+++   + Q+  G+             K     
Sbjct: 112 EY------FCQYADGDSMINENINQGDLIVFEKSNQIRNGEVGCFTIDDNVATCKKFYRD 165

Query: 189 RGRS-IDLMSLNCCYPVDTVEMSD---IEWIAR 217
                I L   N  Y    +          I +
Sbjct: 166 DNNHCIILQPANPEYTPIVINQESQAGFRVIGK 198


>gi|146341049|ref|YP_001206097.1| LexA repressor [Bradyrhizobium sp. ORS278]
 gi|166224556|sp|A4YVE6|LEXA_BRASO RecName: Full=LexA repressor
 gi|146193855|emb|CAL77872.1| SOS response transcriptional repressor, lexA [Bradyrhizobium sp.
           ORS278]
          Length = 232

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 60/227 (26%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I+   +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLRFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-----FDSGVFPTGN 113
            + +                    +  +     +    P+   G         G    G 
Sbjct: 61  ARAIEVIKLPELSQAAGNRRGFTPSVIEGNLGKVRTSTPALEDGERPVAVPVMGRIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
               +                      + +  SM+      GD+ ++      + GD ++
Sbjct: 121 PIEALQTRSHTISVPADMLGNGDHYALEVRGDSMVDAGILDGDMALIQRNETADTGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K    R   SI L   N  Y V  +  + ++   +++
Sbjct: 181 ALIDDEEATLKRFRRRGA-SIALEPANTAYEVRILPPNRVKIQGKLV 226


>gi|295689577|ref|YP_003593270.1| LexA family transcriptional repressor [Caulobacter segnis ATCC
           21756]
 gi|295431480|gb|ADG10652.1| transcriptional repressor, LexA family [Caulobacter segnis ATCC
           21756]
          Length = 232

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 64/227 (28%), Gaps = 10/227 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +    ++   I    +   ++PS    K  LD  S +   R       R        +
Sbjct: 1   MLTRKQHELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLAHR 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-------GVFPTGN 113
             A     + Q              + +       PP  +    +        G    G 
Sbjct: 61  ARALEVVKLPQQATTAAPPKGRGAFRPQVFEGGGTPPPAATAPANDSRELPILGRIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             + +     R P         +    + Q  SM       GD +I+        G+ ++
Sbjct: 121 PIDAIQHERERLPVPEAMLGGGEHYVLEVQGDSMIEAGILDGDYVIIKKGDTATSGEIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K L  ++G SI L + N  Y         +E   +++
Sbjct: 181 AL-VGEEATLKRL-RKKGGSIALEAANPKYETRIFGPDQVEVQGKLV 225


>gi|257056735|ref|YP_003134567.1| SOS-response transcriptional repressor, LexA [Saccharomonospora
           viridis DSM 43017]
 gi|256586607|gb|ACU97740.1| SOS-response transcriptional repressor, LexA [Saccharomonospora
           viridis DSM 43017]
          Length = 235

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 63/219 (28%), Gaps = 23/219 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSF--NKSKRFGIEGRNRWPSTESIFKI 61
            +K+ E I    +++   PS   +    GL  TS   ++ K    +G  R          
Sbjct: 29  QQKVLEVIRTWVDKYGYPPSVREIGEAVGLTSTSSVSHQLKALQRKGYLR-------RDA 81

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                  +  L         T+   E+ +P   F P          V    +  +   +P
Sbjct: 82  NRPRAVGVLALDSEHPIPPTTSATAERSMPQPAFVPLVGRIAAGKPVLAEESIEDVYPLP 141

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           +           +           SM+      GD +++        GD +      G+ 
Sbjct: 142 KDIVG-------EGDVFLLSVTGDSMIDAAITDGDWVVVRQQPTAENGDIVAAMID-GEA 193

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    I L+  N  Y        D   + +++
Sbjct: 194 TVKTFKRK-DGHIWLVPQNEAYEPI--PGDDATILGKVV 229


>gi|325292754|ref|YP_004278618.1| LexA repressor [Agrobacterium sp. H13-3]
 gi|325060607|gb|ADY64298.1| LexA repressor [Agrobacterium sp. H13-3]
          Length = 240

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 66/234 (28%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  A             S    +  K K       P + +     +   P  
Sbjct: 61  ARALEVIKLPEAYTPGARPQRGFSPSVIEGSLGKPKTPEPAPAPKTPANDLGGAVTVPVM 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQ------TQDTRHKTQDTSM-LPLYRKGDILILNSAIQV 165
            +            +    A+        +    + +  SM       GD +I+ +    
Sbjct: 121 GRIAAGVPISAIQNNTHDVAVPVDMLGTGEHYALEVKGDSMIEAGIFDGDTVIIRNGNTA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           N GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 NPGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKIQGKLV 233


>gi|288920758|ref|ZP_06415058.1| SOS-response transcriptional repressor, LexA [Frankia sp. EUN1f]
 gi|288347834|gb|EFC82111.1| SOS-response transcriptional repressor, LexA [Frankia sp. EUN1f]
          Length = 249

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 63/225 (28%), Gaps = 20/225 (8%)

Query: 4   FSHKK--IWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTE 56
            + ++  I E I    E+    PS   +    GL  TS   ++ K    +G   R P+  
Sbjct: 30  LTQRQKGILEVIRAAVEQRGYPPSVREIGEAVGLTSTSSVAHQLKVLQEKGFLRRDPNRP 89

Query: 57  SIFKILAATNETICQLLDLPFSDGRT-TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
              ++L    +     L                E     + P          +       
Sbjct: 90  RAMEVLPIGGQKAGARLRSAGGRPAEVGGAVAAEAGTPTYVPLIGRIAAGGPILAEQAVE 149

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIK 174
           +   +P            +      K    SM+      GD +++      + G+ +   
Sbjct: 150 DVYPLPREIVG-------EGTLFLLKVVGQSMINAAICDGDYVVVRQQPVADNGEIVAAM 202

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              G+   K    +R   + L   N  +        D   + RI+
Sbjct: 203 ID-GEATVKRF-RQRDGRVWLAPENPAFSDI--PAEDATILGRIV 243


>gi|87200045|ref|YP_497302.1| LexA repressor [Novosphingobium aromaticivorans DSM 12444]
 gi|123763475|sp|Q2G6Q5|LEXA_NOVAD RecName: Full=LexA repressor
 gi|87135726|gb|ABD26468.1| SOS-response transcriptional repressor, LexA [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 234

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/227 (11%), Positives = 56/227 (24%), Gaps = 12/227 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRN--R 51
           M +    ++   I    E   ++PS   +     L   S      +  +  G   R   R
Sbjct: 1   MLTRKQHELLTFIQTRLEDSGISPSFEEMKEALDLKSKSGVHRLISALEERGFIRRLPNR 60

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
             + E + +  +A  +          +                 P +        G    
Sbjct: 61  ARALEVLRQPDSAVGKAAPVSQREAANTNSALPPLRAAPKAAPAPANDVIELPLHGKIAA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           G     +       P         +    +    SM       GD  ++        G+ 
Sbjct: 121 GVPIEALETTATL-PVPAALLGAGEHYALEVSGDSMVEAGIFDGDYALVRKTDVARDGEI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
           ++   R  +   K L   +   + L   N  Y        ++    +
Sbjct: 180 VVALVRGEEATLKYLHREK-GMVRLDPANAAYDPQYYRPEEVAVQGK 225


>gi|148261865|ref|YP_001235992.1| LexA repressor [Acidiphilium cryptum JF-5]
 gi|326405370|ref|YP_004285452.1| LexA repressor [Acidiphilium multivorum AIU301]
 gi|166224548|sp|A5G2J1|LEXA_ACICJ RecName: Full=LexA repressor
 gi|146403546|gb|ABQ32073.1| SOS-response transcriptional repressor, LexA [Acidiphilium cryptum
           JF-5]
 gi|325052232|dbj|BAJ82570.1| LexA repressor [Acidiphilium multivorum AIU301]
          Length = 231

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/226 (13%), Positives = 60/226 (26%), Gaps = 8/226 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   ID+   R   +PS    K  LD  S +   R       R      +  
Sbjct: 1   MLTRKQHELLVYIDQHLRRTGCSPSFEEMKEALDLKSKSGIHRLIGALEERGFLRRHKHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKK----EKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
            + L           D P +       +     +        P+ +      G    G  
Sbjct: 61  ARALEVLRLPSDAAADRPDTGFAPNVIRGDFTARLQGARAADPAAAITLPLYGRIAAGQP 120

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLI 173
              +   +             +    +    SM+      GD  I+        G  ++ 
Sbjct: 121 IEALREHQAEIEIPASLVGPGEHYALEVAGDSMVDAGILDGDTAIIRRGETAETGQIVVA 180

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                ++  K L  R   +  L   N  Y +       ++   R++
Sbjct: 181 LIDDVEVTLKRLRRRGNST-ALEPANPRYEIRIFPAERVKVQGRLV 225


>gi|163796784|ref|ZP_02190742.1| hypothetical protein BAL199_13618 [alpha proteobacterium BAL199]
 gi|159178038|gb|EDP62585.1| hypothetical protein BAL199_13618 [alpha proteobacterium BAL199]
          Length = 222

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 71/224 (31%), Gaps = 17/224 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
              + + +   A +  +    +A  A ++ +      R    GR+  P+ E + KI A  
Sbjct: 2   QTTLADRLRARARQIGMNAREVAEDARVNRSFVYDIMR----GRSEHPNLEKLDKIAATL 57

Query: 66  NETICQ------LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                        +            +   IP +    S  GG   +     G  +    
Sbjct: 58  KVDRNWLLHGKGEIQGDEPLTHKEPDEFISIPSVEVTASMGGGTIVANEVAIGEPY---H 114

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                  H  + A          +  SM+P  + GD+++++    +     + +      
Sbjct: 115 FKSSWIAHR-LRANPANLRIMHVEGDSMMPTLQDGDVVLVDLGRALPTPPGIFVLFDGMG 173

Query: 180 IVAKVLISRRGR---SIDLMSLNCCYPVDTVEMSDIEWIARILW 220
           +VAK L          + ++S N  Y        +I+ I RI W
Sbjct: 174 LVAKRLEYIPNSDPPCVRIISDNPFYTPYDRTADEIKIIGRIRW 217


>gi|309802478|ref|ZP_07696584.1| repressor LexA [Bifidobacterium dentium JCVIHMP022]
 gi|308220878|gb|EFO77184.1| repressor LexA [Bifidobacterium dentium JCVIHMP022]
          Length = 237

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 65/219 (29%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +K+ +AI     +    PS   +   AGL  P+S  ++ +    +G  R  + +     
Sbjct: 24  QRKVLDAIKTHLAQRGFAPSFREIGEAAGLKSPSSVKHQLQVLEEKGFIRMSANKGRAIE 83

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +                   T     + I   +  P          +    +  + + +P
Sbjct: 84  VVDPEGPASGNGVAEVIPFPTGVDSSESIMGSHDVPLVGRIAAGVPITAEQHIDDVMRLP 143

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E  +               +    SM+      GD +++        GD +       + 
Sbjct: 144 ERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQHTAENGDIVAALLD-DEA 195

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y     + +  E + +++
Sbjct: 196 TVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 231


>gi|307295058|ref|ZP_07574900.1| transcriptional repressor, LexA family [Sphingobium
           chlorophenolicum L-1]
 gi|306879532|gb|EFN10750.1| transcriptional repressor, LexA family [Sphingobium
           chlorophenolicum L-1]
          Length = 228

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/221 (11%), Positives = 49/221 (22%), Gaps = 6/221 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   +++   I    E   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTPKQQELLSFIQTRLEEGGVSPSFEEMKEALDLRSKSGIHRLINALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFF-DSGVFPTGNKWNT 117
            + L                   +               +         G    G     
Sbjct: 61  ARALEVLKLPEAMHRAPKVVAPASAPLATGSAVSKPPVAANDIVEIPMHGRIAAGVPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           +   +                  +    SM       GD  ++        G  ++    
Sbjct: 121 LE-GQNMLSVPAALLGTGDHYALEVAGDSMVEAGILDGDFALIQRTDVAREGQIVVALID 179

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
             +   K    R G+ + L   N  Y     +   +    +
Sbjct: 180 ENEATLKYF-RREGQKVRLDPANGAYEPQYYDPRQVRIQGK 219


>gi|116054339|ref|YP_788784.1| transcriptional regulator PrtR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115589560|gb|ABJ15575.1| transcriptional regulator PrtR [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 256

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 65/238 (27%), Gaps = 33/238 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + +     NL    LA  AG+   + +K      +      ST  + +I AA   +  
Sbjct: 14  ARLKQAMAMRNLKQETLAEAAGVSQNTIHKLTSGKAQ------STRKLIEIAAALGVSPV 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKWNT 117
            L     +    +     +   L   P                   +       G     
Sbjct: 68  WLQTGEGTPAARSAVSVADGSPLVLEPLHPWDSDTPLDEDEVELPLYKEVEMSAGAGRTA 127

Query: 118 VGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           V   E R      YA         +     +    SM PL   G  + +++A        
Sbjct: 128 VREIEGR-KLRFSYATLRASGVDPSAAICAQLTGNSMEPLIMDGSTIGVDTATTHITDGE 186

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD-----IEWIARILWAS 222
           +      G +  K +    G  I L S N   YP +     D     I  I  + W S
Sbjct: 187 IYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDEEYSPEDMRSRQISMIGWVFWWS 244


>gi|297584124|ref|YP_003699904.1| LexA family transcriptional repressor [Bacillus selenitireducens
           MLS10]
 gi|297142581|gb|ADH99338.1| transcriptional repressor, LexA family [Bacillus selenitireducens
           MLS10]
          Length = 207

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 64/226 (28%), Gaps = 33/226 (14%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M   S   K I + I    +     PS   +    GL   ++ +    R   +G  R   
Sbjct: 1   MKKLSTRQKSILDFIRDQVQARGYPPSVREIGEAVGLASSSTVHGHLSRLEKKGYIRR-- 58

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
                     T     +L+         T      IP++    +GS            N 
Sbjct: 59  --------DPTKPRAIELIQKDRYGSEITSSPSISIPVVGKVTAGSPIT------AIENV 104

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
              + +P         +    +    +    SM       GD ++++     N GD ++ 
Sbjct: 105 EEYLPMPVS-------FVQDEESFILEISGDSMIEAGIFNGDFVVVHPQSTANNGDIVVA 157

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +   + L   N       +   ++  + R++
Sbjct: 158 MTDEDEATVKRFFKEKD-HVRLQPENASLQPIIL--ENVTILGRVI 200


>gi|156974239|ref|YP_001445146.1| hypothetical protein VIBHAR_01954 [Vibrio harveyi ATCC BAA-1116]
 gi|156525833|gb|ABU70919.1| hypothetical protein VIBHAR_01954 [Vibrio harveyi ATCC BAA-1116]
          Length = 221

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/215 (14%), Positives = 70/215 (32%), Gaps = 17/215 (7%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +    +   +T + LA   G+  ++           +NR PS E++  I+     T    
Sbjct: 9   VKARMKEVGITQNALAEMMGVSQSAIAHWLN-----KNREPSIENVAAIMKCVGLTHM-- 61

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG---VPEIRSPHNG 129
           +          +     +  L   P+    F        G     +    + EI   H  
Sbjct: 62  MLDSDGFIDYPDDSVANVKKLDIQPTYQKSFPVLSSVQAGQWHEAIEPYSIEEISEWHPT 121

Query: 130 IYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVAKV 184
                 +      Q  SM       + +G ++++++ +    G  ++       +   K 
Sbjct: 122 TERCSERCFWLTVQGDSMTSPTGFSFPEGTMVLVDTEVDAENGKLVVAKLTDVNEATFKK 181

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            I   G+   L +LN  +P+  +  +  + I  ++
Sbjct: 182 FIVDSGQKY-LKALNPAFPILPINGN-CKIIGVVI 214


>gi|220927204|ref|YP_002502506.1| LexA repressor [Methylobacterium nodulans ORS 2060]
 gi|254809101|sp|B8IN87|LEXA_METNO RecName: Full=LexA repressor
 gi|219951811|gb|ACL62203.1| SOS-response transcriptional repressor, LexA [Methylobacterium
           nodulans ORS 2060]
          Length = 240

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 64/235 (27%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     +   I +      + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQLDLLRFIQQRMRETGVPPSFDEMKDALDLKSKSGIHRLITALEERGFLRRLPNR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS-------GSGGFFD 105
                + +I  A      +++    S                 P S        S     
Sbjct: 61  ARAIEVIRIPDAVVPPSGEVVRFTPSVVEGGRTAAPAAKAAPMPSSLGSDDNGRSISIPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
            G    G   + +         +  +    +    + +  SM       GD++++     
Sbjct: 121 MGRIAAGTPISAIQSQSRTVAMSPDFLAGGEHYALEVRGDSMIEAGILDGDLVVIRRQDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N GD ++      +   K L  R G SI L + N  Y    +    +    R++
Sbjct: 181 ANTGDIVVALIDDEEATLKRLRRR-GSSIALEAANPAYETRVLGPDRVRIQGRLV 234


>gi|313111743|ref|ZP_07797536.1| transcriptional regulator PrtR [Pseudomonas aeruginosa 39016]
 gi|310884038|gb|EFQ42632.1| transcriptional regulator PrtR [Pseudomonas aeruginosa 39016]
          Length = 256

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 65/238 (27%), Gaps = 33/238 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + +     NL    LA  AG+   + +K      +      ST  + +I AA   +  
Sbjct: 14  ARLKQAMAMRNLKQETLAEAAGVSQNTIHKLTSGKAQ------STRKLIEIAAALGVSPV 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKWNT 117
            L     +    +     +   L   P                   +       G     
Sbjct: 68  WLQTGEGTPAARSAVSVADGSPLVLEPLHPWDSDTPLDEDEVELPLYKEVEMSAGAGRTA 127

Query: 118 VGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           V   E R      YA         +     +    SM PL   G  + +++A        
Sbjct: 128 VREIEGR-KLRFSYATLRASGVDPSAAICAQLTGNSMEPLIMDGSTIGVDTATTHITDGE 186

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD-----IEWIARILWAS 222
           +      G +  K +    G  I L S N   YP +     D     I  I  + W S
Sbjct: 187 IYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDEEYSPEDMRSRQISMIGWVFWWS 244


>gi|159037047|ref|YP_001536300.1| LexA family transcriptional regulator [Salinispora arenicola
           CNS-205]
 gi|157915882|gb|ABV97309.1| transcriptional repressor, LexA family [Salinispora arenicola
           CNS-205]
          Length = 258

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 61/219 (27%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAG-LDPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            ++I E I    ERH   PS   +    G + P+S   + K    +G  R          
Sbjct: 57  QRRILEFIRTWVERHGYPPSVREIGEAVGLVSPSSVAYQLKELEKKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                     +   P  D    E      P   + P          +       +   +P
Sbjct: 107 --RDPNRPRAVDVRPPGDPLDDEATRSHRPTPAYVPMLGRIAAGGPILAEQAVEDVFPLP 164

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    + +  SML      GD +++        GD +      G+ 
Sbjct: 165 RELVG-------EGEVFMLQVKGDSMLDAAICDGDWVVVRQQPTAESGDIVAAMLD-GEA 216

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + LM  N  +        D   + R++
Sbjct: 217 TVKTYRRR-DGHVWLMPQNPAFDPI--PGDDATIMGRVV 252


>gi|289675330|ref|ZP_06496220.1| S24 family peptidase [Pseudomonas syringae pv. syringae FF5]
          Length = 217

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/217 (12%), Positives = 64/217 (29%), Gaps = 19/217 (8%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +        L+ + L+   G+   +    +           +  ++ K L  +     
Sbjct: 5   DRLRARMTELKLSATDLSASIGVSKATITFWRNGTNGATGS--NLMALAKALRCSP---- 58

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-GVPEIRSPHNG 129
                  +        E     +   P+    +        G     V   P+  S    
Sbjct: 59  ---QWLETGKGEATDSEPSNVAMISQPAQMYSYPVVSWVAAGAWTEAVQPFPDGFSDRYD 115

Query: 130 I--YAIQTQDTRHKTQDTSM----LPLYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVA 182
           +  Y  +      + +  SM     P   +G  +++++ + V  G  ++     + +   
Sbjct: 116 VSDYKAKGAAFWLEVKGDSMTSTSAPSIPEGSQILVDTEVDVRPGKLVIAKLADSNEATF 175

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K L+   G    L  LN  YP       D + I  ++
Sbjct: 176 KKLVEDGGVRY-LKPLNPAYPTVQCS-DDCKIIGVVV 210


>gi|238855030|ref|ZP_04645359.1| SOS-response transcriptional repressor [Lactobacillus jensenii
           269-3]
 gi|282934070|ref|ZP_06339350.1| SOS-response transcriptional repressor [Lactobacillus jensenii
           208-1]
 gi|238832401|gb|EEQ24709.1| SOS-response transcriptional repressor [Lactobacillus jensenii
           269-3]
 gi|281301872|gb|EFA94136.1| SOS-response transcriptional repressor [Lactobacillus jensenii
           208-1]
          Length = 225

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/218 (11%), Positives = 60/218 (27%), Gaps = 15/218 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-PSTESIFKIL-AA 64
             + +A+    ++ +++ + L  K G+   + +  +      +     +  ++  +    
Sbjct: 12  NNLAKALKEYRKKQHISQTELGEKLGVSKQTVSYWESKKKSPKMSAVINISNLIGVSVKE 71

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                  +           E            P          +    N  + V +    
Sbjct: 72  LMFGTSDVAYSNEDLSMLHEPNNNYQTNSSIIPILGTIACGEPILAEQNIEDYVSLVP-- 129

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR--LLIKPRTGDIVA 182
                  +        K +  SM P    G I I+     V  G+   +L+     +   
Sbjct: 130 -------SDDATYFGLKCRGHSMEPTIHDGAIAIIRQQPTVEDGEIAAVLVGEDANEATL 182

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
           K +      +I L+  N  +        D I  + + +
Sbjct: 183 KRV-RHVNNAILLVPDNENFEPILGTKKDPIRIVGKAV 219


>gi|306822416|ref|ZP_07455794.1| repressor LexA [Bifidobacterium dentium ATCC 27679]
 gi|304553961|gb|EFM41870.1| repressor LexA [Bifidobacterium dentium ATCC 27679]
          Length = 244

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 65/219 (29%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +K+ +AI     +    PS   +   AGL  P+S  ++ +    +G  R  + +     
Sbjct: 31  QRKVLDAIKTHLAQRGFAPSFREIGEAAGLKSPSSVKHQLQVLEEKGFIRMSANKGRAIE 90

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +                   T     + I   +  P          +    +  + + +P
Sbjct: 91  VVDPEGPASGNGVAEVIPFPTGVDSSESIMGSHDVPLVGRIAAGVPITAEQHIDDVMRLP 150

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E  +               +    SM+      GD +++        GD +       + 
Sbjct: 151 ERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQHTAENGDIVAALLD-DEA 202

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y     + +  E + +++
Sbjct: 203 TVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 238


>gi|291283823|ref|YP_003500641.1| hypothetical protein G2583_3129 [Escherichia coli O55:H7 str.
           CB9615]
 gi|290763696|gb|ADD57657.1| hypothetical protein G2583_3129 [Escherichia coli O55:H7 str.
           CB9615]
          Length = 224

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 69/211 (32%), Gaps = 21/211 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-STESIFKILAATNE 67
           +            +T   +A  AG+   S    +     GR R P +   + K L  +  
Sbjct: 20  LAARFKARRLELGMTQVEVANSAGVSQQSIESIE----SGRTRKPRNLLDLAKALKCSP- 74

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
                L    +     E   + IP+L +  +G           TG  +  +         
Sbjct: 75  ---DWLLNGKNIMPLAEISTRRIPILSYVQAGELTEARDITDLTGE-FEYILADSD---- 126

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                I       +    SM P +++GDI+I++  +    G+ ++ K    +   K    
Sbjct: 127 -----IPETCFALRIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNDGHEATFKKYRP 181

Query: 188 RRGRS--IDLMSLNCCYPVDTVEMSDIEWIA 216
                   +L+ LN  YP+      +++ I 
Sbjct: 182 LGIGIDDFELIPLNPDYPIFRSADMNLQIIG 212


>gi|117928686|ref|YP_873237.1| LexA repressor [Acidothermus cellulolyticus 11B]
 gi|171460816|sp|A0LUZ1|LEXA_ACIC1 RecName: Full=LexA repressor
 gi|117649149|gb|ABK53251.1| SOS-response transcriptional repressor, LexA [Acidothermus
           cellulolyticus 11B]
          Length = 275

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 64/221 (28%), Gaps = 11/221 (4%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
            ++I + I     R    PS   +    GL  TS    +   ++ +    R P+     +
Sbjct: 53  QRRILDVIRDSVRRRGYPPSMREIGEAVGLTSTSSVAHQLMVLQRKGFLRRDPNRPRAVE 112

Query: 61  I-LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           I  A +          P +D   + ++    P               G    G       
Sbjct: 113 IRSAESAVPDASAGHSPAADRAPSARRPPRGPSPIDSNPDVVAVPLVGRIAAGGPALAEQ 172

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
           + E   P       +      + +  SM+      GD +++        GD +      G
Sbjct: 173 LIEDVVPLPRQLVGEGTLFLLQVKGDSMVDAAICDGDWVVVRQQPVAENGDIVAAMID-G 231

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K    R    I LM  N  Y        +   + R++
Sbjct: 232 EATVKTFKRRGA-HIWLMPHNPQYEPI--PGDEATILGRVV 269


>gi|332160963|ref|YP_004297540.1| putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665193|gb|ADZ41837.1| Putative repressor CI from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862119|emb|CBX72283.1| hypothetical protein YEW_AK02200 [Yersinia enterocolitica W22703]
          Length = 225

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 82/222 (36%), Gaps = 25/222 (11%)

Query: 5   SHKKIWEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
           + + I   I  +  ++ ++  + L++K  +  ++ ++       G    P   ++ +I  
Sbjct: 4   TLQNIQNNIKYLMHKNGISSVTELSQKIKMQQSTMHRLL----TGEVNDPKYGTLKQIAD 59

Query: 64  ATNETICQ----------LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
               ++               +    G   E   ++IP++     G+GGF++   +P G+
Sbjct: 60  YFRVSVIDLTECNLMDGTAKTVIDVGGDPHEMHFRDIPVVGNAQLGNGGFWNDMEYPIGS 119

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
               +  P          +        K    SM+P  ++G+ +I+        GD +L+
Sbjct: 120 GDGFIRWP----------SYDPDAYALKCVGDSMMPRIKEGEFVIIEPGHNYIPGDEVLV 169

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
                +++ K  +  R   I L+ +N  +       + +  I
Sbjct: 170 VTDKDEVMVKTFLFERDGYIHLLPVNEDHAPIKYPRTAVVKI 211


>gi|294668808|ref|ZP_06733901.1| putative repressor protein [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309325|gb|EFE50568.1| putative repressor protein [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 244

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 74/231 (32%), Gaps = 34/231 (14%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
           A+R   + S L R+  +   +  K  + G E     PST ++ KI  A    +  L    
Sbjct: 16  AKRLG-SVSELCRRVDVAYPTATKWVKEGAE-----PSTTNLIKIADAAGVNLLWLATGQ 69

Query: 77  FSDGRTTEKKEKEI----------------PLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
            +  +   +  K+                                +     G+ +     
Sbjct: 70  GAMLKEDSEDGKQPAAYDGDQYAQPVLDTLNRPVDIEEFVFIPRYNVKVAAGHGYIAEDE 129

Query: 121 PEIRSPHNGIYAI-------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
               +     Y I           +  K    SM  +   GD ++++ +     G+ L +
Sbjct: 130 KPRFTMAFRKYWIRVHLRTDPKSLSVVKVAGDSMEGILFDGDNVLVDHSRN-QPGNGLYV 188

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD----IEWIARILW 220
                +++ K   +  G  + + S N  Y    + ++D    +E I +++W
Sbjct: 189 LRIGEELIVKRTQTLPGNHLLVSSANEAYQPFELNLADETSGVEIIGKVVW 239


>gi|77457362|ref|YP_346867.1| phage repressor [Pseudomonas fluorescens Pf0-1]
 gi|77381365|gb|ABA72878.1| putative regulatory protein of cro/cI family [Pseudomonas
           fluorescens Pf0-1]
          Length = 270

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 79/248 (31%), Gaps = 33/248 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++       G+   PS + I K
Sbjct: 24  MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSRIL----SGKIVDPSDKHISK 79

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS-----------GSGGFFDSGVF 109
           I      +  QL             +++    L                 S  F      
Sbjct: 80  IAEYFAVSTDQLRGRADVAPAANAGRDELHSELKDISLWDDDTPVDDDEVSVPFLREVEL 139

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSAI 163
             G+    +   E  S   G  +++              +  SMLP+ R G  + +N+  
Sbjct: 140 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 199

Query: 164 ----QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTV-----EMSDIE 213
                +  GD L      G +  K L       I L S N   +P +       +   I 
Sbjct: 200 CGIGDIIDGD-LYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPDEDYSFQDMQEEQIV 257

Query: 214 WIARILWA 221
            +  + W 
Sbjct: 258 ILGHVFWW 265


>gi|15595808|ref|NP_249302.1| transcriptional regulator PrtR [Pseudomonas aeruginosa PAO1]
 gi|107099597|ref|ZP_01363515.1| hypothetical protein PaerPA_01000610 [Pseudomonas aeruginosa PACS2]
 gi|218889352|ref|YP_002438216.1| transcriptional regulator PrtR [Pseudomonas aeruginosa LESB58]
 gi|254243705|ref|ZP_04937027.1| transcriptional regulator PrtR [Pseudomonas aeruginosa 2192]
 gi|2498811|sp|Q06553|PRTR_PSEAE RecName: Full=HTH-type transcriptional regulator prtR; AltName:
           Full=Pyocin repressor protein
 gi|9946485|gb|AAG04000.1|AE004497_7 transcriptional regulator PrtR [Pseudomonas aeruginosa PAO1]
 gi|286176|dbj|BAA02198.1| negative regulator of pyocin genes [Pseudomonas aeruginosa]
 gi|5725148|dbj|BAA83146.1| prtR [Pseudomonas aeruginosa]
 gi|5725181|dbj|BAA83132.1| PRF4 [Pseudomonas aeruginosa]
 gi|126197083|gb|EAZ61146.1| transcriptional regulator PrtR [Pseudomonas aeruginosa 2192]
 gi|218769575|emb|CAW25335.1| transcriptional regulator PrtR [Pseudomonas aeruginosa LESB58]
          Length = 256

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 65/238 (27%), Gaps = 33/238 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + +     NL    LA  AG+   + +K      +      ST  + +I AA   +  
Sbjct: 14  ARLKQAMAMRNLKQETLAEAAGVSQNTIHKLTSGKAQ------STRKLIEIAAALGVSPV 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKWNT 117
            L     +    +     +   L   P                   +       G     
Sbjct: 68  WLQTGEGAPAARSAVSVADGSPLVLEPLHPWDSDTPLDEDEVELPLYKEVEMSAGAGRTA 127

Query: 118 VGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           V   E R      YA         +     +    SM PL   G  + +++A        
Sbjct: 128 VREIEGR-KLRFSYATLRASGVDPSAAICAQLTGNSMEPLIMDGSTIGVDTATTHITDGE 186

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD-----IEWIARILWAS 222
           +      G +  K +    G  I L S N   YP +     D     I  I  + W S
Sbjct: 187 IYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDEEYSPEDMRSRQISMIGWVFWWS 244


>gi|329768682|ref|ZP_08260166.1| LexA repressor [Gemella haemolysans M341]
 gi|328836396|gb|EGF86061.1| LexA repressor [Gemella haemolysans M341]
          Length = 224

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/223 (13%), Positives = 61/223 (27%), Gaps = 24/223 (10%)

Query: 11  EAIDRMAERHNLTPSG---LAR------KAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
           E I+++ +   L       LA+            +  ++         N       + K+
Sbjct: 6   ERINQIMKEKRLRQIDVLNLAKPFQEKYNIKFSKSHLSQYVNGKSNPDNEKIFL--LSKV 63

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
              T   +       +      +  E +       P          +    +  +   VP
Sbjct: 64  FGVTEAWLLGYDVHRYERIEEAKINEPQTLQGLKIPVLGTVAAGIPISAVEDILDYEEVP 123

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +           Q +    + +  SM P    GD +I+      N GD ++      D  
Sbjct: 124 QSWEN-------QGEFFGLRIKGDSMKPDINDGDTVIVRQQSTANNGDVVIALVNGDDAT 176

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARIL 219
            K         I L+S N  Y        +     +  I R++
Sbjct: 177 CKKFEKLGNG-IMLISNNSEYSPMYFSNEEVLTKPVVIIGRVV 218


>gi|158423825|ref|YP_001525117.1| LexA repressor [Azorhizobium caulinodans ORS 571]
 gi|172047964|sp|A8I825|LEXA_AZOC5 RecName: Full=LexA repressor
 gi|158330714|dbj|BAF88199.1| peptidase S24 protein [Azorhizobium caulinodans ORS 571]
          Length = 236

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/231 (12%), Positives = 55/231 (23%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-----------EGR 49
           M +     +   I    +   + PS    K  LD  S +   R                R
Sbjct: 1   MLTRKQYDLLRFIHERLKETGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            R      +    A                            +    P+        G  
Sbjct: 61  ARALEVVRLPDSAAPGLAAARSGGRGFSPSVIEGSLGRVRPVVDDEEPAAVVAVPVMGRI 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G+  + +                 +    + +  SM       GD +++      + G
Sbjct: 121 AAGSPISAIQTRSNTLNLPPEMLGTGEHFALEVRGDSMIEAGILDGDTVLIRKCDTADTG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K L  +   SI L + N  Y         +    R++
Sbjct: 181 DIIVALVDDEEATLKRLRRKGA-SIALEAANPAYETRIFGPDRVRIQGRLV 230


>gi|52080407|ref|YP_079198.1| LexA repressor [Bacillus licheniformis ATCC 14580]
 gi|52785786|ref|YP_091615.1| LexA repressor [Bacillus licheniformis ATCC 14580]
 gi|319645635|ref|ZP_07999867.1| LexA repressor [Bacillus sp. BT1B_CT2]
 gi|59799805|sp|Q65J42|LEXA_BACLD RecName: Full=LexA repressor
 gi|52003618|gb|AAU23560.1| transcriptional regulator [Bacillus licheniformis ATCC 14580]
 gi|52348288|gb|AAU40922.1| LexA [Bacillus licheniformis ATCC 14580]
 gi|317392521|gb|EFV73316.1| LexA repressor [Bacillus sp. BT1B_CT2]
          Length = 207

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 64/227 (28%), Gaps = 35/227 (15%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +R    PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILRFIKEEVKRKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                   T E+       +   P        + +    N
Sbjct: 61  TKPRAIEILD------------------TEEEIHIPKNQVVNVPVIGKVTAGTPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +PE  +P              +    SM+       D +I+      N GD ++
Sbjct: 103 IEEYFPLPERLAPP------DEHVFMLEIMGESMIDAGILDQDYVIVKQQNTANNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K         I L   N       ++   +  + +++
Sbjct: 157 AMTEDDEATVKRFFKEE-THIRLQPENPTMEPIILQN--VTILGKVI 200


>gi|294010830|ref|YP_003544290.1| repressor LexA [Sphingobium japonicum UT26S]
 gi|292674160|dbj|BAI95678.1| repressor LexA [Sphingobium japonicum UT26S]
          Length = 228

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/221 (10%), Positives = 47/221 (21%), Gaps = 6/221 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   +++   I    E   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTPKQQELLSFIQTRLEEGGVSPSFEEMKEALDLRSKSGIHRLINALEERGFIRRLPNR 60

Query: 59  FKILAATN-ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
            + L                   +        +       +        G    G     
Sbjct: 61  ARALEVLKLPDAMHRAPKLAVPAKAPLTSGPALSQPPVAANDILEIPLHGRIAAGVPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           +   +                  +    SM       GD  ++        G  ++    
Sbjct: 121 LE-GQNMLSVPAALLGTGDHYALEVAGDSMVEAGILDGDFALIQRTDVAREGQIVVALID 179

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
             +   K         + L   N  Y     +   +    +
Sbjct: 180 ENEATLKYFRREGP-KVRLDPANSAYEPQIYDPRQVRIQGK 219


>gi|297562266|ref|YP_003681240.1| transcriptional repressor, LexA family [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296846714|gb|ADH68734.1| transcriptional repressor, LexA family [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 239

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/224 (13%), Positives = 52/224 (23%), Gaps = 25/224 (11%)

Query: 2   TSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTES 57
              +   + +   I R        PS   +    GL   S                S   
Sbjct: 29  PKLTARQQSVLNCIQRYVRERGFPPSIREIGEAVGLSSPS----------------SVAH 72

Query: 58  IFKILAATNETICQLLDLPFSD-GRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
             K+L                +         + +       S +      G    G    
Sbjct: 73  QLKVLQRKGYLHRDQNRPRAVELRTPGRASGRTLVPEDIDLSRAAAVPLVGRIAAGGPIL 132

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKP 175
                E           + +         SM       GD++++      N GD +    
Sbjct: 133 AEESVEDVLALPRQLVGEGRLFMLTVVGDSMTDAAITDGDMVVVRQQQDANNGDIVAALL 192

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              +   KVL    G  + LM  N  Y        D   + +++
Sbjct: 193 D-EEATVKVLRREEGGHVWLMPRNEAYEPI--NGDDATILGKVV 233


>gi|15802659|ref|NP_288686.1| putative repressor protein CI of prophage CP-933V [Escherichia coli
           O157:H7 EDL933]
 gi|12516411|gb|AAG57241.1|AE005443_9 putative repressor protein CI of prophage CP-933V [Escherichia coli
           O157:H7 str. EDL933]
          Length = 215

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 77/226 (34%), Gaps = 28/226 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  H+ I E I  + E   L+ + LA+  G    S    +    E   R  S +    
Sbjct: 1   MKTM-HEIIGERIKSLREAKGLSQAQLAKLCGWAAPS----RLGNYELGTRKVSADDALV 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           + AA   +  +++         ++   ++     F    +G F + G +   +    V  
Sbjct: 56  LGAALGVSPAKIMFGED-----SDAVFRQYEYPLFSSVQAGPFXEVGXYTASDAKAWVPT 110

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIK 174
               S          +    + +  SM       P + +G +++++ A  V  GD  +  
Sbjct: 111 TTKASE---------KAFWLEVKGHSMTAPQGVRPSFPEGMLILVDPAEPVESGDFCVAS 161

Query: 175 PRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K      G S  L+ LN  Y     + S    I +++
Sbjct: 162 ANGDSEATFKKYEKDAGVSY-LVPLNPAYRTLDCDHS-CRIIGKVV 205


>gi|75761233|ref|ZP_00741217.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218898797|ref|YP_002447208.1| LexA repressor [Bacillus cereus G9842]
 gi|228902202|ref|ZP_04066364.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 4222]
 gi|74491268|gb|EAO54500.1| Phage transcriptional repressor [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218540796|gb|ACK93190.1| LexA repressor [Bacillus cereus G9842]
 gi|228857437|gb|EEN01935.1| Phage transcriptional repressor [Bacillus thuringiensis IBL 4222]
          Length = 239

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 25  EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 80

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 81  DLEKLATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENIEGYLPMLST 140

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 141 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 199

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 200 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 235


>gi|320528015|ref|ZP_08029181.1| helix-turn-helix protein [Solobacterium moorei F0204]
 gi|320131641|gb|EFW24205.1| helix-turn-helix protein [Solobacterium moorei F0204]
          Length = 229

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 71/219 (32%), Gaps = 17/219 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           +++  + E H+L+   LA   G+  ++    +        R P+ E++  I    N  + 
Sbjct: 7   KSLKSLREEHHLSQRQLADALGVAYSTIGMYESGQ-----REPNYETLEIIADFFNVDMN 61

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV-PEIRSPHNG 129
             L        +   +  EIPL                   G+    +   P+       
Sbjct: 62  -YLLGKSIIKNSYASELTEIPLDNIIFDDYFPLHYWSGLSAGSFEELIEAEPDSVVYVPI 120

Query: 130 IYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSA----IQVNCGDRLLIKPRTGDIVAKV 184
            +   + +    K   TSM  +   G I++        I+ + G  ++     G    K 
Sbjct: 121 TFQNKKKRLHAFKINGTSMNNVIPDGSIVVSEDNYNNAIKYSDGTIVVAFMD-GTATVKR 179

Query: 185 LISRRGRSIDLMSLNCC--YPVDTVEMS-DIEWIARILW 220
           L      SI L   +    +    V    ++  I +++W
Sbjct: 180 LYY-GEDSITLSPDSTDKSHMPIIVPKDKELVIIGKVIW 217


>gi|126737889|ref|ZP_01753619.1| LexA repressor [Roseobacter sp. SK209-2-6]
 gi|126721282|gb|EBA17986.1| LexA repressor [Roseobacter sp. SK209-2-6]
          Length = 240

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/235 (12%), Positives = 64/235 (27%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I R  +   + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHRRLKADGVPPSFDEMKIALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATN------ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS 106
                I ++  +         +     ++      +         +              
Sbjct: 61  ARAIEILRLPESLGGSADSATSHGFKPEVLNGGRASAPAAAPSASVTTASTPAVLELPVM 120

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
           G    G     +     +        +        + +  SM+      GDI+++     
Sbjct: 121 GRIAAGVPIEAINQVSHQIAIPQAMLSSAGHHYALEVRGDSMIDAGINDGDIVVIRETDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            + GD ++   +  +   K +  R   +I L + N  Y   T     ++   R++
Sbjct: 181 ADDGDIVVALVQNEEATLKRIFRR-DGAIALEAENPAYETRTYPEDQVQIQGRLV 234


>gi|307942169|ref|ZP_07657520.1| repressor LexA [Roseibium sp. TrichSKD4]
 gi|307774455|gb|EFO33665.1| repressor LexA [Roseibium sp. TrichSKD4]
          Length = 239

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/235 (12%), Positives = 64/235 (27%), Gaps = 18/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST----- 55
           M +    ++   I+   +   + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQYELLMFINERLKETGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 56  ----------ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                     ESI   L +         ++        + + ++        + +     
Sbjct: 61  ARAMEVVRLPESIAPGLGSPRPRGSFSPEVIEGSLGKPQAEARQPSAP-VVEAQTTEIPV 119

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
            G    G     +               + +    + +  SM       GD +++  +  
Sbjct: 120 MGRIAAGVPIEAIQTHSHSISVPPELIGKGEHYALEVRGDSMIEAGILDGDTVLIRRSDS 179

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            + GD ++      +   K L  +   SI L + N  Y         +    +++
Sbjct: 180 ADSGDIVVALVDDEEATLKRLRKKGA-SIALEAANPAYETRIFGPGRVRVQGKLV 233


>gi|312135294|ref|YP_004002632.1| transcriptional repressor, lexa family [Caldicellulosiruptor
           owensensis OL]
 gi|311775345|gb|ADQ04832.1| transcriptional repressor, LexA family [Caldicellulosiruptor
           owensensis OL]
          Length = 202

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 59/221 (26%), Gaps = 38/221 (17%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIF 59
             ++I E I +  +     P+   +    GL  TS       R   +G   R PS     
Sbjct: 8   KQEEILEFIKKRIKEKGYPPAVREICEATGLKSTSTVHGHLTRLEKKGYIRRDPSKPRAI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +I+                       +      +   P          +    N   T+ 
Sbjct: 68  EIVD---------------------DEFYVHRNVVQLPLVGKVTAGEPILAVENIEETMT 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P                   + +  SM        DI+I+        GD ++      
Sbjct: 107 LPYDLVGTE-------DAFLLRVRGDSMIEAGIFDNDIIIVRRQNIAENGDIVVALID-D 158

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K         I L   N       V+  D++ + +++
Sbjct: 159 EATVKRFYKEHD-HIRLQPENKAMEPIIVK--DVKILGKVI 196


>gi|92117275|ref|YP_577004.1| LexA repressor [Nitrobacter hamburgensis X14]
 gi|123265283|sp|Q1QMK3|LEXA_NITHX RecName: Full=LexA repressor
 gi|91800169|gb|ABE62544.1| SOS-response transcriptional repressor, LexA [Nitrobacter
           hamburgensis X14]
          Length = 233

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 58/228 (25%), Gaps = 10/228 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++   I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQYELLRFINERLKESGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+         +    P        K       +             G    G
Sbjct: 61  ARAIEVIKLPEVAGNGGGRRGFTPSVIEGNLGKVRPSGGGVVDDAERPVAVPVMGRIAAG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
                +                 +    + +  SM       GD+ ++        GD +
Sbjct: 121 TPIEALQTRSHTISVPPDMLGSGEHYALEVRGDSMVEAGILDGDMALIQRNETAETGDIV 180

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K    R   SI L   N  Y V  +  + ++   +++
Sbjct: 181 VALIDDEEATLKRFRRRGA-SIALEPANTAYEVRILPPNRVQIQGKLI 227


>gi|254237175|ref|ZP_04930498.1| transcriptional regulator PrtR [Pseudomonas aeruginosa C3719]
 gi|296387119|ref|ZP_06876618.1| transcriptional regulator PrtR [Pseudomonas aeruginosa PAb1]
 gi|126169106|gb|EAZ54617.1| transcriptional regulator PrtR [Pseudomonas aeruginosa C3719]
          Length = 256

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 65/238 (27%), Gaps = 33/238 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             + +     NL    LA  AG+   + +K      +      ST  + +I AA   +  
Sbjct: 14  ARLKQAMAMRNLKQETLAEAAGVSQNTIHKLTSGKAQ------STRKLIEIAAALGVSPV 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------GFFDSGVFPTGNKWNT 117
            L     +    +     +   L   P                   +       G     
Sbjct: 68  WLQTGEGAPAARSAVSVADGSPLVLEPLHPWDSDTPLDEDEVELPLYKEVEMSAGAGRTA 127

Query: 118 VGVPEIRSPHNGIYA-------IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           V   E R      YA         +     +    SM PL   G  + +++A        
Sbjct: 128 VREIEGR-KLRFSYATLRASGVDPSAAICAQLTGNSMEPLIMDGSTIGVDTATTHITDGE 186

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD-----IEWIARILWAS 222
           +      G +  K +    G  I L S N   YP +     D     I  I  + W S
Sbjct: 187 IYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDEEYSPEDMRSRQISMIGWVFWWS 244


>gi|284007338|emb|CBA72703.1| phage transcriptional regulator [Arsenophonus nasoniae]
          Length = 232

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 88/232 (37%), Gaps = 32/232 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M   +   + + I  + +   + + + L+R+ G+   + ++       G  + P  E + 
Sbjct: 1   MGMGTQ-NLNKNIKILMDEKGVKSVAELSRRIGMPQPTLHRMLN----GEVKSPRLEIVQ 55

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEI----------------PLLYFPPSGSGGF 103
           KI         +LL    S    +E+++                   P+L     G GG+
Sbjct: 56  KIANFFRVEANELLYKDLSTTNISEERDTTSFTRIELNAIPFNFCKVPVLGTTQLGGGGY 115

Query: 104 FDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI 163
           ++S      + +  +  P                   + Q  SM+P  + G+ +++    
Sbjct: 116 WNSKESSIEHDYGYIVWPTE----------DKDAFALRCQGESMMPRIQHGEFVVMEPNY 165

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
           +   GD +L++   G ++ K  + +R   I L+S+N  +P   +  S I+ I
Sbjct: 166 KYKPGDEVLVQDDNGQVMVKTFLYQRDDVIHLLSINADHPPIRLAASTIKKI 217


>gi|242280573|ref|YP_002992702.1| phage repressor [Desulfovibrio salexigens DSM 2638]
 gi|242123467|gb|ACS81163.1| putative phage repressor [Desulfovibrio salexigens DSM 2638]
          Length = 218

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 80/216 (37%), Gaps = 13/216 (6%)

Query: 11  EAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
              +R+ E  +++  + LAR+ G+   + +  K+ G     RW    S+   L +T    
Sbjct: 8   SFFERLKEHTDISTQAQLARELGVGRAAVSLVKKKGAVP-PRWILELSVRYNLDSTWLES 66

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
                 P  +      +   IP +    S  GG F++G    G         +      G
Sbjct: 67  GLGSPRPEVNAVEFADEFSRIPKVAARLSAGGGSFETG----GEIEGFYAFRKDWIGGKG 122

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
                +     +    SM P  ++GDI++L+ + +      +        ++ K +  R 
Sbjct: 123 ---NPSDMVLMEVYGNSMEPELKEGDIVLLDQSRKDILAGGIYAVGVEDTVMVKRVEKRP 179

Query: 190 GRSIDLMSLNCCYPVDTVEMSD---IEWIARILWAS 222
           G+ + L S N  Y    +   +   +  + +++W S
Sbjct: 180 GQ-VVLHSDNKDYAPIYLGGDELENVRVLGQVVWVS 214


>gi|269956058|ref|YP_003325847.1| SOS-response transcriptional repressor, LexA [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269304739|gb|ACZ30289.1| SOS-response transcriptional repressor, LexA [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 243

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 64/220 (29%), Gaps = 21/220 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
            +++ E I    E     P+   +    GL   S  K +   +E +    R P+     +
Sbjct: 33  QRRVLETIRASVETRGYPPTMREIGEAVGLASPSSVKHQLMTLERKGYLRRDPNRPRAME 92

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           ++    E        P   G   E+      +       +GG   +         +   +
Sbjct: 93  VVDPAGEAPTGDPAQPSLSGLDEEQLSAPSYVPVVGRIAAGGPILAEQL----VEDVFPL 148

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P              +    K Q  SM+      GD +++        G+ +      G+
Sbjct: 149 PRQLVG-------DGELFLLKVQGDSMVDAAICDGDWVVVRRQPVAENGEIVAAMID-GE 200

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K         + L+  N  Y        + + + R++
Sbjct: 201 ATVKTF-KHDHGHLWLLPQNPNYAPI--PGDEAQILGRVV 237


>gi|257455556|ref|ZP_05620786.1| phage repressor [Enhydrobacter aerosaccus SK60]
 gi|257447022|gb|EEV22035.1| phage repressor [Enhydrobacter aerosaccus SK60]
          Length = 222

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 65/220 (29%), Gaps = 14/220 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + I   + +  +   LT   LA+K+G    + +  +        R  S+  + ++  A  
Sbjct: 3   ETIGSRVKKARKYAGLTQVELAKKSGSKQGAISDLESG------RNESSTKLVEMAEAMG 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
            +   L     +      K      + + P               G+  +          
Sbjct: 57  VSAKWLATGEGNMLDQDIKVPSISNVDFIPQKIRKAPVL-NWVQAGHPADVFDNGYDEYE 115

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG-DIVAKVL 185
           +        Q      +  SM P + +GD +++++  Q   GD ++           K  
Sbjct: 116 YFYDEGYGLQVYWLYVRGDSMNPEFFEGDKILVDAERQARAGDYVIAMVDHEAQATFKRY 175

Query: 186 IS------RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                          L+ LN  YP        I+ +  ++
Sbjct: 176 KPCGYDPNLGREYCQLVPLNDFYPTIDSRAVRIDIVGVVV 215


>gi|229104259|ref|ZP_04234930.1| Phage transcriptional repressor [Bacillus cereus Rock3-28]
 gi|228679155|gb|EEL33361.1| Phage transcriptional repressor [Bacillus cereus Rock3-28]
          Length = 223

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 75/226 (33%), Gaps = 12/226 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M  F  K   + +  + +    +    A K GL PT+  +S      G+    S +++ K
Sbjct: 1   MVKFMEK--AKIVTHLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIK 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +      T   L  L      T +++      +    S        G    G        
Sbjct: 55  VCKGLGITTDDLEVLTTKGDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEEN 114

Query: 121 PEIRSPHNGIYAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
            E   P    +   + +      + TSM   +  G  +++     V  G   ++K    D
Sbjct: 115 IEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYD 174

Query: 180 IVAKVLISRRGRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
              K +    G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 175 ATVKKISK-SGSIITLIPLSNDPIHEPQTYDLSAEDVKIIGRVVQA 219


>gi|219681216|ref|YP_002455861.1| C2 [Salmonella enterica bacteriophage SE1]
 gi|318065925|ref|YP_004123783.1| C2 [Salmonella phage ST160]
 gi|66473831|gb|AAY46477.1| C2 [Salmonella phage SE1]
 gi|289066911|gb|ADC81122.1| C2 [Salmonella phage ST160]
          Length = 229

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 62/229 (27%), Gaps = 24/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + +++  E   ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLSDRLNKAMELAGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A   +   L        +         P      +             G         EI
Sbjct: 55  ALGVSSEWLSTGIGPMKKDGTTPINASP----SSNTFKIDILDLEVSAGPGVINREFVEI 110

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                                       +  SM      GD+L ++ +I+   GD +   
Sbjct: 111 LRSVEYSQDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDVSIKNFDGDGIYAF 170

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCY---PVDTVE-MSDIEWIARIL 219
                   K L   +   + ++S N  Y        + M+ +    +++
Sbjct: 171 LYDDTAHVKRLQKMKD-KLLVISDNKSYSAWDPIERDEMNRVFVFGKVI 218


>gi|188586129|ref|YP_001917674.1| SOS-response transcriptional repressor, LexA [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350816|gb|ACB85086.1| SOS-response transcriptional repressor, LexA [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 222

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 71/226 (31%), Gaps = 22/226 (9%)

Query: 1   MTSFSHK--KIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSK--RFGIEGRNRWPS 54
           M+  S+K  +I+  I+  A ++   PS   + +  GL  TS           +G  R  S
Sbjct: 1   MSKKSNKPMQIYNFINDYASKNGYPPSVREICQGVGLSSTSTVHLHLSSLEKQGYIRRDS 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T      + + N       +   ++ +   +      +       +G      +    N 
Sbjct: 61  TRPRAIEILSKNNNKNTDQEKSNNNEKIDNEDLNTTKIPIVGQVTAG----EPILAEENI 116

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
                +P+  S          +    + +  SM        D++I+N     N G+ ++ 
Sbjct: 117 LEYFPIPKQLSYG-------KELFMLQIKGDSMIEAGIYDSDLVIVNKQNTANNGEIIVA 169

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K         I L   N  Y        D+  I +++
Sbjct: 170 L-LEDEATVKRFYK-ENEYIRLQPENKAYSPIY--SRDVSIIGKVV 211


>gi|210632226|ref|ZP_03297243.1| hypothetical protein COLSTE_01137 [Collinsella stercoris DSM 13279]
 gi|210159684|gb|EEA90655.1| hypothetical protein COLSTE_01137 [Collinsella stercoris DSM 13279]
          Length = 222

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/219 (10%), Positives = 65/219 (29%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H  I + I R+ ++  +T   LA K  +  ++  + +          P    + K+    
Sbjct: 10  HMGISQNIKRLRKQAGMTQVELAEKLDVARSTITQWETGWS-----SPRMGMVQKLAGVF 64

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             T   +L        +               S +      G    G   +   V     
Sbjct: 65  GVTSADMLAEDSEGLPSGAMPVA-------ASSATVPLLAIGRVHAGALTDEEEVSHRVE 117

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
             + + +   +    + +   M  +  +G  ++++   +   G   +++  +   V +  
Sbjct: 118 VPSSVLSGHPRAFALEVEGDCMDRVIPEGSHVLVDPDREPGNGSIAVVETDSYQAVMRRW 177

Query: 186 ISRRGRSIDLMSL-NCCYPVDTVEMSD--IEWIARILWA 221
                 ++ L +  +           D  +  +  ++W 
Sbjct: 178 YR-GSSTLMLTADSHSEQEDMVFGPEDGPVRVVGTVVWW 215


>gi|289642424|ref|ZP_06474570.1| SOS-response transcriptional repressor, LexA [Frankia symbiont of
           Datisca glomerata]
 gi|289507769|gb|EFD28722.1| SOS-response transcriptional repressor, LexA [Frankia symbiont of
           Datisca glomerata]
          Length = 249

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 59/220 (26%), Gaps = 17/220 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIFK 60
            +K+ E I    ER    PS   +    GL  TS   ++ K    +G   R P      +
Sbjct: 35  QRKVLEVIRDAVERRGYPPSVREIGDAVGLTSTSSVAHQLKTLEEKGFLRRDPHRPRAME 94

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +L+A           P     T            + P          +           +
Sbjct: 95  VLSAQAPVRPVARQAPGVGTLTAGSSTDGPAQAAYVPVLGRIAAGGPILAEQAVEEVFPL 154

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P            +      +    SM       GD +++      + G+ +      G+
Sbjct: 155 PREIVG-------EGTLFTLRVVGDSMVNAAICDGDWVVVRQQPVADNGEIVAAMID-GE 206

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L  R    + L   N  Y            + RI+
Sbjct: 207 ATVKTLRRR-DGHVWLEPQNPAYADI--PGDSATILGRIV 243


>gi|303327568|ref|ZP_07358009.1| peptidase, S24 family [Desulfovibrio sp. 3_1_syn3]
 gi|302862508|gb|EFL85441.1| peptidase, S24 family [Desulfovibrio sp. 3_1_syn3]
          Length = 230

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 65/226 (28%), Gaps = 25/226 (11%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++  A+D        + + LAR  G+ P S + +++ G      W  T       A T  
Sbjct: 13  RLMRALDAA------SEAELARALGITPQSVSGARKRGEVP-PAWIQT-----CAAQTGV 60

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-GFFDSGVFPTGNKWNTVGVPEI--- 123
               L             + +   +     +              G     V        
Sbjct: 61  NAHWLFFGSGPMRLPEAAEGELPSMQEDCDTELITVPLAEARLSAGTGSLEVSSNSNEGG 120

Query: 124 ---RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
              RS          +    +    SM+P     D+++L+         RL        I
Sbjct: 121 YAFRSDFLRRKGNPRRMVLMRVSGDSMVPEIFDNDLVLLDRGQTEISPGRLYAVGFEDAI 180

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
             K +       I L S+N  YP  +++           I R+LW+
Sbjct: 181 YIKRIDKLP-GKIILHSVNPAYPPLSLDLRGDCADQFRVIGRVLWS 225


>gi|194099007|ref|YP_002002080.1| putative phage repressor [Neisseria gonorrhoeae NCCP11945]
 gi|193934297|gb|ACF30121.1| putative phage repressor [Neisseria gonorrhoeae NCCP11945]
          Length = 228

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 69/215 (32%), Gaps = 13/215 (6%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLD-PTSFNKSKRFGI--EGRNRWPSTESIFKILAATN 66
            + +  + E    + + LA++AG   P+   +         G+ +        K+ +A N
Sbjct: 9   LQNMKNLVEEAG-SVAELAKRAGYAQPSYLYQIINQTAIQNGKPKNIGGAMARKLESAMN 67

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG---FFDSGVFPTGNKWNTVGVPEI 123
           +    L            +  + I + +   +G+ G     D    P  +    V  P  
Sbjct: 68  KAEGWLDMNHGETLPLPPEDTETIRIDHLDMAGACGGGIEADDWPSPISS----VEFPLD 123

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
                      +      T+  SM P   +   +++++      GD +      G +  K
Sbjct: 124 AVRRLFSGRDTSGLKIVGTRGDSMEPTIPETSAVLIDTKADTFAGDGIYFFAYAGGLYTK 183

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIAR 217
            L       + L S N  Y    ++ +D    I R
Sbjct: 184 RLQKTPAGLLAL-SDNPLYQSFPIDENDRFRIIGR 217


>gi|315453658|ref|YP_004073928.1| hypothetical protein HFELIS_12540 [Helicobacter felis ATCC 49179]
 gi|315132710|emb|CBY83338.1| putative uncharacterized protein [Helicobacter felis ATCC 49179]
          Length = 206

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 69/212 (32%), Gaps = 16/212 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E + ++   +NLT   LA K G+   S  + +           + +++ K+  A N  
Sbjct: 2   LKEKLKQLRNANNLTQEELALKCGVSLQSIKRYESEQKS----NITLDTLEKLANALNTD 57

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +                   +    +           +  F        +   +     +
Sbjct: 58  LHFFTSTHRKVEDVVMVPYIKDVKAHIRRDKIDDDNSNMTF--------LPQSKSFLKRH 109

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                       +    SM PL ++GD+L+  +      G  + +    G+   K +  R
Sbjct: 110 FGIVSTEHLGLLQAMGNSMEPLIKEGDLLLFQNDGSCYEG-AVYVIDLGGEYYVKRISKR 168

Query: 189 RGRSIDLMSLNCCYPVDTVE-MSDIEWIARIL 219
               + L+S N  Y    ++ + +I  + R++
Sbjct: 169 P--EVSLISDNPAYKPIILQSLEEIIILGRVV 198


>gi|229047381|ref|ZP_04192978.1| Phage transcriptional repressor [Bacillus cereus AH676]
 gi|228723966|gb|EEL75314.1| Phage transcriptional repressor [Bacillus cereus AH676]
          Length = 239

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 10/216 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + R+ +    +    A K GL PT+  +S      G+    S +++ K+      T  
Sbjct: 25  EVVTRLIKEAGYSKRAFAEKIGLPPTTL-QSMLSRGIGKA---SVDNVIKVCKGLGITTD 80

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L  L   +  T +++      +    S        G    G         E   P    
Sbjct: 81  DLERLATQEDNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST 140

Query: 131 YAI-QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
           +   + +      + TSM   +  G  +++     V  G   ++K    D   K +    
Sbjct: 141 FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISK-S 199

Query: 190 GRSIDLMSL-N-CCYPVDTVE--MSDIEWIARILWA 221
           G  I L+ L N   +   T +    D++ I R++ A
Sbjct: 200 GSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQA 235


>gi|15827479|ref|NP_301742.1| LexA repressor [Mycobacterium leprae TN]
 gi|221229956|ref|YP_002503372.1| LexA repressor [Mycobacterium leprae Br4923]
 gi|254809104|sp|B8ZQU5|LEXA_MYCLB RecName: Full=LexA repressor
 gi|327478573|sp|Q49848|LEXA_MYCLE RecName: Full=LexA repressor
 gi|467099|gb|AAA17282.1| lexA [Mycobacterium leprae]
 gi|13093029|emb|CAC31384.1| LexA, SOS repressor protein [Mycobacterium leprae]
 gi|219933063|emb|CAR71098.1| LexA, SOS repressor protein [Mycobacterium leprae Br4923]
          Length = 235

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 63/220 (28%), Gaps = 23/220 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIFK 60
            + I   I          PS   +A   GL  TS   ++ +    +G   R P+      
Sbjct: 27  QRTILNVIRASVTSRGYPPSIREIADAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVN 86

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +             L    G     +   +P+L    +GS        F  G   +   +
Sbjct: 87  VRGVEETQAAGPAVLTEVAGSDVLPEPTFVPILGRIAAGSPI------FAEGTVEDIFPL 140

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P            +      K    SM       GD +++      + GD +      G+
Sbjct: 141 PRELVG-------EGTLFLLKVTGDSMVEAAICDGDWVVVRQQKVADNGDIVAAMID-GE 192

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K      G  + L+  N  +       +D   + +++
Sbjct: 193 ATVKTFKR-AGGQVWLIPHNPAFDPI--PGNDATVLGKVV 229


>gi|300949501|ref|ZP_07163497.1| peptidase S24-like domain protein [Escherichia coli MS 116-1]
 gi|300451077|gb|EFK14697.1| peptidase S24-like domain protein [Escherichia coli MS 116-1]
          Length = 231

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 72/229 (31%), Gaps = 20/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           KI   I ++    N+  + LA   G+D  + ++ +     G+ +  S +++ ++  A + 
Sbjct: 2   KIGSRIRQLRLAKNIKIAELAEAVGVDAANISRLE----TGKQKQFSEQTLNRLAQALSV 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---------- 117
           ++  L     +D       EK    +                  G               
Sbjct: 58  SVPDLFTSDENDTTVHINSEKHASPVKDVDVY-RVEVLDVSASAGAGHIHGSDVIDVIHA 116

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +     ++         +       +  SM      GD++ ++  I    GD + +    
Sbjct: 117 IEFSNDQALAMFGGRTPSGVKVINVRGDSMASTIEPGDLIFVDVTINEFDGDGIYVFGFD 176

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
           G +  K L     + + ++S N  Y    +            ++L  SQ
Sbjct: 177 GKVYVKRLQMIPDQ-LLVISDNPRYREWNITKENEHRFYIYGKVL-ISQ 223


>gi|261245569|emb|CBG23364.1| repressor protein cI [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
          Length = 241

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 61/229 (26%), Gaps = 24/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + +++  E   ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 13  MKKETLSDRLNKAMELAGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 66

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L        +         P      +             G         EI
Sbjct: 67  ALGVNSEWLSTGIGPMKKDGTTPINASP----SSNTFKIDILDLEVSAGPGVINREFVEI 122

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                                       +  SM      GD+L ++ +I+   GD +   
Sbjct: 123 LRSVEYSQDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDVSIKNFDGDGIYAF 182

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCY---PVDTVE-MSDIEWIARIL 219
                   K L   +   + ++S N  Y        + M+ +    +++
Sbjct: 183 LYDDTAHVKRLQKMKD-KLLVISDNKSYSAWDPIERDEMNRVFVFGKVI 230


>gi|193070526|ref|ZP_03051466.1| repressor protein CI [Escherichia coli E110019]
 gi|192956220|gb|EDV86683.1| repressor protein CI [Escherichia coli E110019]
          Length = 215

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 77/226 (34%), Gaps = 28/226 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  H+ I E I  + E   L+ + LA+  G    S    +    E   R  S +    
Sbjct: 1   MKTM-HEIIGERIKSLREAKGLSQAQLAKLCGWAAPS----RLGNYELGTRKVSADDALV 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           + AA   +  +++         ++   ++     F    +G F + G +   +    V  
Sbjct: 56  LGAALGVSPAKIMFGED-----SDAVFRQYEYPLFSSVQAGPFSEVGSYTASDAKAWVPT 110

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIK 174
               S          +    + +  SM       P + +G +++++ A  V  GD  +  
Sbjct: 111 TTKASE---------KAFWLEVKGHSMTAPQGVRPSFPEGMLILVDPAEPVESGDFCVAS 161

Query: 175 PRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K      G S  L+ LN  Y     + S    I +++
Sbjct: 162 ANGDSEATFKKYEKDAGVSY-LVPLNPAYRTLDCDHS-CRIIGKVV 205


>gi|300919981|ref|ZP_07136440.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
 gi|300412928|gb|EFJ96238.1| peptidase S24-like domain protein [Escherichia coli MS 115-1]
          Length = 235

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/228 (12%), Positives = 73/228 (32%), Gaps = 17/228 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E ++       ++ S LA   G+   +  K       G  +     +  K+      +  
Sbjct: 6   ERLNAAMSSAGVSQSQLADMVGISQPAIQKMSSGKTNGSRKMVELANALKVRPEWLSSGI 65

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTVGVPEIRS 125
             +     +  +  ++     +++     +   F +          G+    +      S
Sbjct: 66  GEMRDGAHEEPSNVRESSLKAVVWEDIKRNDDEFVALPLLNVSLSAGSGSCELEESSEFS 125

Query: 126 PHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                + +      +      +    SM P    GD++ +N+        +     ++  
Sbjct: 126 LVFRKHYLKKMGVSERSAKLVRVVGQSMEPTLHDGDVVGVNTQDTTIRDGKTYAICQSDL 185

Query: 180 IVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           +  K LI     S+ + S+N   YP + ++  +    +  I R+ W+S
Sbjct: 186 LRVKTLI-ATPTSVIIRSINREEYPDEVMDRDEFHETVRIIGRVFWSS 232


>gi|302522304|ref|ZP_07274646.1| LexA repressor [Streptomyces sp. SPB78]
 gi|302431199|gb|EFL03015.1| LexA repressor [Streptomyces sp. SPB78]
          Length = 262

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 61  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 110

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 111 --RDPHRPRAYEVRGSDQPSPQPADTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 168

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 169 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 220

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 221 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 256


>gi|194014993|ref|ZP_03053610.1| LexA repressor [Bacillus pumilus ATCC 7061]
 gi|194014019|gb|EDW23584.1| LexA repressor [Bacillus pumilus ATCC 7061]
          Length = 206

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 60/227 (26%), Gaps = 36/227 (15%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILTFIKEEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     ++L      I                       +   P          +    N
Sbjct: 61  TKPRAIEVLDEEEMNIP-------------------KSAVMNVPVIGKVTAGLPITAVEN 101

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +PE  +      A   Q    +    SM+       D +I+      N GD ++
Sbjct: 102 VEEYFPLPETFA------APDEQVFMLEIMGESMIDAGILDKDYVIVRQQSTANNGDIVV 155

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K           L   N       ++   +  + +++
Sbjct: 156 AMTEEDEATVKRFYK-EDTHFRLQPENPSMEPIILQN--VSILGKVI 199


>gi|183602410|ref|ZP_02963776.1| LexA repressor [Bifidobacterium animalis subsp. lactis HN019]
 gi|219683275|ref|YP_002469658.1| LexA repressor [Bifidobacterium animalis subsp. lactis AD011]
 gi|241191236|ref|YP_002968630.1| LexA repressor [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241196642|ref|YP_002970197.1| LexA repressor [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|183218329|gb|EDT88974.1| LexA repressor [Bifidobacterium animalis subsp. lactis HN019]
 gi|219620925|gb|ACL29082.1| LexA repressor [Bifidobacterium animalis subsp. lactis AD011]
 gi|240249628|gb|ACS46568.1| LexA repressor [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240251196|gb|ACS48135.1| LexA repressor [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|289177352|gb|ADC84598.1| LexA repressor [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295794229|gb|ADG33764.1| LexA repressor [Bifidobacterium animalis subsp. lactis V9]
          Length = 231

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 72/218 (33%), Gaps = 23/218 (10%)

Query: 8   KIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFKIL 62
           ++ +AI ++ E     PS   + + A L  TS  + +   +E +    R P+     +++
Sbjct: 25  QVLDAIRKLLEEQGFAPSLREIGKAANLKSTSSVQHQLHALESKGFIRRDPNKGRAIELV 84

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
              + T      +PF           ++PL+    +G             +  + + +P 
Sbjct: 85  ETQDGTSGGNPIVPFDGMDLEPSDFLDVPLVGAIAAGQPIT------AEQHVEDVMRLPV 138

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
             +               + +  SM+      GD +++        GD +       +  
Sbjct: 139 RLTGT-------GNLFMLEVKGDSMIDAAICDGDFVVVREQHNAENGDIVAALLD-DEAT 190

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            K    +      L+  N  Y     + +  + + +++
Sbjct: 191 VKTF-RQEHGHTWLIPHNPNYAPI--DGTHAQIMGKVV 225


>gi|75676032|ref|YP_318453.1| LexA repressor [Nitrobacter winogradskyi Nb-255]
 gi|123745685|sp|Q3SRJ0|LEXA_NITWN RecName: Full=LexA repressor
 gi|74420902|gb|ABA05101.1| SOS-response transcriptional repressor, LexA [Nitrobacter
           winogradskyi Nb-255]
          Length = 233

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/228 (11%), Positives = 60/228 (26%), Gaps = 10/228 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++   I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQYELLRFINERLKESGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+         +    P        K  +                  G    G
Sbjct: 61  ARAIEVIKLPELAASGGGRRGFTPSVIEGNLGKVRRGGGGGADEAERPVAVPVMGRIAAG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRL 171
                +                 +    + +  SM+      GD+ ++      + GD +
Sbjct: 121 TPIEALQTCSHTISLPPDMLGAGEHYALEVRGDSMVDAGILDGDMALIQRNPTADTGDIV 180

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K    R   SI L   N  Y V  +  + ++   R++
Sbjct: 181 VALIDDEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVQIQGRLV 227


>gi|85703338|ref|ZP_01034442.1| LexA repressor [Roseovarius sp. 217]
 gi|85672266|gb|EAQ27123.1| LexA repressor [Roseovarius sp. 217]
          Length = 233

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 63/229 (27%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIQKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I ++  +           P           +         + +      G    G
Sbjct: 61  ARALEIVRLPESLGGEAR-HSFTPRVIDGDRPNGPRPANSQPVEVAHAFEVPLMGRIAAG 119

Query: 113 NKWNTVGVPE-IRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +   +   S  + +          + +  SM       GD++I+      + GD 
Sbjct: 120 VPIEAIAHVQHNVSVPSTMIRGAANHYALEVRGDSMIEAGINDGDVVIIRETSVADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G +I L + N  Y         ++   R++
Sbjct: 180 VVALIEDQEATLKRFYRR-GNAIALEAANPAYETRLFPEDQVQVQGRLV 227


>gi|251792258|ref|YP_003006980.1| HTH-type transcriptional regulator PrtR [Aggregatibacter
           aphrophilus NJ8700]
 gi|157921532|gb|ABW02839.1| putative repressor CI [Aggregatibacter aphrophilus NJ8700]
 gi|247533647|gb|ACS96893.1| HTH-type transcriptional regulator PrtR (Pyocin repressor protein)
           [Aggregatibacter aphrophilus NJ8700]
          Length = 231

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 57/227 (25%), Gaps = 11/227 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA-- 64
             + E +    +R       LA  AG    + +       +            KI     
Sbjct: 2   NTLAERLQFAMDRMGKNQVELAALAGTSQVTISNILNGVTKSPRNGLQIAKALKISPEWL 61

Query: 65  -TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK-------WN 116
                      +  +   T      +              F       GN        +N
Sbjct: 62  LNGTGEMVQPKIESNVAETGSFDLWDRNTPLNDDEVEVPLFQEIRLAAGNGFADDIMDYN 121

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
              +   R+                    SM P+   G  + +++  +      +     
Sbjct: 122 NFKLRFSRATLRRQGVQYENAVCVVADGNSMEPVIPNGATVGIDTGNKTIRDGSIYAINH 181

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
            G +  K+L +     I + S N   Y  +   + D+  I ++ W S
Sbjct: 182 GGLLRIKLLYNMPNNQIKIRSYNTDEYDDEIASLDDVSVIGKVFWYS 228


>gi|296444565|ref|ZP_06886529.1| transcriptional repressor, LexA family [Methylosinus trichosporium
           OB3b]
 gi|296257833|gb|EFH04896.1| transcriptional repressor, LexA family [Methylosinus trichosporium
           OB3b]
          Length = 235

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/230 (13%), Positives = 60/230 (26%), Gaps = 12/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +     +   I    +   + PS    K  LD  S +   R  +    R      P+ 
Sbjct: 1   MLTKKQSDLLRFIHERLKETGVPPSFDEMKDALDLRSKSGIHRLILALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS-----GSGGFFDSGVFP 110
               ++L        +          +  +            +             G   
Sbjct: 61  ARALEVLRLPESATPRAAARGGKFSPSVIEGALGRVRPMAERAESEVDQQVAVPVMGRIA 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGD 169
            G   + +                 +    + +  SM+      GDI+++      + GD
Sbjct: 121 AGTPISALQNRSHTISLPPDLLGGGEHFALEVRGDSMIDAGILDGDIVVVKKQDSADTGD 180

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K L  R   SI L + N  Y         +    R++
Sbjct: 181 IVVALIDDEEATLKRLRKRGA-SIALEAANPAYETRIFGPDRVRIQGRLV 229


>gi|316985836|gb|EFV64778.1| peptidase S24-like family protein [Neisseria meningitidis H44/76]
 gi|325128010|gb|EGC50908.1| peptidase, S24 family [Neisseria meningitidis N1568]
 gi|325130061|gb|EGC52850.1| peptidase, S24 family [Neisseria meningitidis OX99.30304]
 gi|325133952|gb|EGC56607.1| peptidase, S24 family [Neisseria meningitidis M13399]
 gi|325136816|gb|EGC59414.1| peptidase, S24 family [Neisseria meningitidis M0579]
 gi|325138493|gb|EGC61059.1| peptidase, S24 family [Neisseria meningitidis ES14902]
 gi|325139936|gb|EGC62465.1| peptidase, S24 family [Neisseria meningitidis CU385]
 gi|325142187|gb|EGC64610.1| peptidase, S24 family [Neisseria meningitidis 961-5945]
 gi|325198111|gb|ADY93567.1| peptidase, S24 family [Neisseria meningitidis G2136]
 gi|325200404|gb|ADY95859.1| peptidase, S24 family [Neisseria meningitidis H44/76]
 gi|325206257|gb|ADZ01710.1| peptidase, S24 family [Neisseria meningitidis M04-240196]
 gi|325207946|gb|ADZ03398.1| peptidase, S24 family [Neisseria meningitidis NZ-05/33]
          Length = 236

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 67/231 (29%), Gaps = 22/231 (9%)

Query: 11  EAIDRMAERHN-LTPSGLARKAGLDPTSFNKSKRFGIEGR------------NRWPSTES 57
           + +  +A+    L P+ +A +  +   +    +  GI  +              W  T  
Sbjct: 6   DRLFEIAKEQGVLKPADIAERLNISQQALKNWESRGIAAKALPEVAKAFGVSETWLRTGE 65

Query: 58  IFK-----ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
             +     I       +  +              +  + + Y   S   G   +   P  
Sbjct: 66  GSRTAPVLIDPDLPHEVKDIHRPMTWSSNDPLPDDDYVFVPYLKESCFKGGVGTYEIPDY 125

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           N +    +P  +S                    SM     +   + +++        ++ 
Sbjct: 126 NGY---RLPFGKSTLKRKGINPDNVFCCTLTGDSMEEKIAEDAAIAVDTGETAIRDGKIY 182

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIEWIARILWAS 222
              + G    K LI + G S+ + S N   Y  +   +  +  I R+ W S
Sbjct: 183 AFAQDGMFRVKYLIRQPGNSVLIRSHNSGFYGDENAPLDSLTVIGRVFWWS 233


>gi|162147707|ref|YP_001602168.1| LexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542331|ref|YP_002274560.1| LexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|189046538|sp|A9HJ64|LEXA_GLUDA RecName: Full=LexA repressor
 gi|161786284|emb|CAP55866.1| putative lexA repressor [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530008|gb|ACI49945.1| SOS-response transcriptional repressor, LexA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 253

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 63/248 (25%), Gaps = 30/248 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-------- 52
           M +    ++   IDR  ++   +PS    K  L+  S +   R       R         
Sbjct: 1   MLTRKQHELLLFIDRHLKQTGFSPSFDEMKDALNLRSKSGIHRLISALEERDFLRRRHHR 60

Query: 53  --------------------PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPL 92
                               P  ES    + A         +    +    +   +    
Sbjct: 61  ARALEVLRLPETMPAATGKPPLAESGPPPVTAPATDESAAAESFVPNVIKGDFANRLAGA 120

Query: 93  LYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLY 151
                +G+      G    G     +     +           +    +    SM     
Sbjct: 121 SVATEAGAIHLPFYGRIAAGQPIEALRETGAQIEVPMNLLGHGEHYALEVAGDSMIEAGI 180

Query: 152 RKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD 211
             GD +I+        G  ++      ++  K L  R G +I L   N  Y    V    
Sbjct: 181 LDGDTVIIRRGDVAQNGQIVVALIDDQEVTLKRLRRR-GSTIALEPANARYEPRIVPSDR 239

Query: 212 IEWIARIL 219
           +    +++
Sbjct: 240 VRIQGQLV 247


>gi|239826731|ref|YP_002949355.1| LexA repressor [Geobacillus sp. WCH70]
 gi|259494476|sp|C5D9K3|LEXA_GEOSW RecName: Full=LexA repressor
 gi|239807024|gb|ACS24089.1| SOS-response transcriptional repressor, LexA [Geobacillus sp.
           WCH70]
          Length = 207

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 63/227 (27%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I + I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILDFIKKEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                          +   +   P          +    N
Sbjct: 61  TKPRAIEILD------------------ADFSASNQTDDVISVPIIGKVTAGQPITAIEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P        + + +      +    SM       GD +I+      + GD ++
Sbjct: 103 IEDYFPLP------KRLVSSEDHVFMLEVMGDSMIEAGILDGDYVIVRQQQSADNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEDNEATVKRFFKEKD-HIRLQPENSNLEPIIVR--DCTILGKVI 200


>gi|209967957|ref|YP_002265383.1| putative peptidase, S24-like [Aliivibrio salmonicida LFI1238]
 gi|208011481|emb|CAQ81944.1| putative peptidase, S24-like [Aliivibrio salmonicida LFI1238]
          Length = 205

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/217 (14%), Positives = 69/217 (31%), Gaps = 22/217 (10%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I  +     L+   LA K  +  ++ ++ +    + +N+         +   T   
Sbjct: 4   IGERIKSLRLNQGLSQESLAEKINVTKSTISQWEVGKAQPKNKNL-------LSIVTFFD 56

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
                     +      +   +P      +   G  +     T      + V  I     
Sbjct: 57  TTYEYLKGGGEIDDRCPRVVSVPFYNVSVAAGLGIINDSETYTYVDIENLQVSNI----- 111

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                            SM P+ + G IL++++  +      + +  +   +  K LIS 
Sbjct: 112 ------EHLVSLTASGDSMEPVLKDGSILVVDTQSKNIIDGHMYVFRQDDLLRVK-LISY 164

Query: 189 RGRSIDLMSLNCCYPVDTV---EMSDIEWIARILWAS 222
               + + S N  Y  +     E+ D+  I +++W S
Sbjct: 165 EKNHLIVTSYNKEYKDEMYKFSELDDLNIIGQVIWHS 201


>gi|125973291|ref|YP_001037201.1| SOS-response transcriptional repressor, LexA [Clostridium
           thermocellum ATCC 27405]
 gi|256003771|ref|ZP_05428759.1| SOS-response transcriptional repressor, LexA [Clostridium
           thermocellum DSM 2360]
 gi|281417495|ref|ZP_06248515.1| transcriptional repressor, LexA family [Clostridium thermocellum
           JW20]
 gi|166990798|sp|A3DDH9|LEXA_CLOTH RecName: Full=LexA repressor
 gi|125713516|gb|ABN52008.1| SOS-response transcriptional repressor, LexA [Clostridium
           thermocellum ATCC 27405]
 gi|255992332|gb|EEU02426.1| SOS-response transcriptional repressor, LexA [Clostridium
           thermocellum DSM 2360]
 gi|281408897|gb|EFB39155.1| transcriptional repressor, LexA family [Clostridium thermocellum
           JW20]
 gi|316940477|gb|ADU74511.1| transcriptional repressor, LexA family [Clostridium thermocellum
           DSM 1313]
          Length = 213

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 65/221 (29%), Gaps = 27/221 (12%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRN-RWPSTESIF 59
             +KI + ++   E++   PS   +    G   TS   +  ++   +G   + PS     
Sbjct: 8   KQQKILDFLNEQIEKNGYPPSVREICNAVGFKSTSTVHSYLEKLRKQGLIQKDPSKPRAL 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           K++     +                K       L   P          +    N  +T  
Sbjct: 68  KVINNKKNSKTD-----------EPKNIYSGKELVEVPIIGKVTAGQPILAVENIEDTFP 116

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P         +   +     + Q  SM        D +++      N GD ++      
Sbjct: 117 LPLD-------FVQNSTVFMLRVQGDSMIEAGIFDNDYIVVKQQSTANNGDIVVALID-D 168

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K     +   I L   N  Y    V   ++  + +++
Sbjct: 169 EATVKTFYKEK-GFIRLQPANKFYDPIIV-RDNLSILGKVI 207


>gi|260856429|ref|YP_003230320.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|257755078|dbj|BAI26580.1| predicted phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
          Length = 235

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/228 (12%), Positives = 72/228 (31%), Gaps = 17/228 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E ++       ++ S LA   G+   +  K       G  +     +  K+      +  
Sbjct: 6   ERLNAAMSSAGVSQSQLADMVGISQPAIQKMSSGKTNGSRKMVELANALKVRPEWLSSGI 65

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTVGVPEIRS 125
             +     +  +  +      +++     +   F +          G+    +      S
Sbjct: 66  GEMRDGAHEEPSNVRDSSLKAVVWEDIKRNDDEFVALPLLNVSLSAGSGSCELEESSEFS 125

Query: 126 PHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                + +      +      +    SM P    GD++ +N+        +     ++  
Sbjct: 126 LVFRKHYLKKMGVSERSAKLVRVVGQSMEPTLHDGDVVGVNTQDTTIRDGKTYAICQSDL 185

Query: 180 IVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           +  K LI     S+ + S+N   YP + ++  +    +  I R+ W+S
Sbjct: 186 LRVKTLI-ATPTSVIIRSINREEYPDEVMDRDEFHETVRIIGRVFWSS 232


>gi|227878761|ref|ZP_03996672.1| SOS-response transcriptional repressor [Lactobacillus crispatus
           JV-V01]
 gi|256849961|ref|ZP_05555392.1| transcriptional regulator [Lactobacillus crispatus MV-1A-US]
 gi|262046793|ref|ZP_06019753.1| transcriptional regulator [Lactobacillus crispatus MV-3A-US]
 gi|227861654|gb|EEJ69262.1| SOS-response transcriptional repressor [Lactobacillus crispatus
           JV-V01]
 gi|256713450|gb|EEU28440.1| transcriptional regulator [Lactobacillus crispatus MV-1A-US]
 gi|260572775|gb|EEX29335.1| transcriptional regulator [Lactobacillus crispatus MV-3A-US]
          Length = 208

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 65/216 (30%), Gaps = 16/216 (7%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I     +++LT + LA K  +   +    +R       R    E + K+    +  
Sbjct: 4   ISENIKFYRSKNSLTQAQLADKLNVSEQAVYNWERGTRI--PRMGYIEKMAKLFNIESPD 61

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           I ++   P +    ++     + +              G    G         E  +   
Sbjct: 62  ILKVNKQPTNMKPLSQSGMHAVRIPII-----------GTIACGTPILAEQNIEGYTTEL 110

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLIS 187
                       + Q  SM P    G  +I+     V   +   ++     +   K +  
Sbjct: 111 FNEKPDGTLFVLRCQGDSMEPKIPDGATVIVREQPTVEDDEIAAVLVDDNTEATLKRI-K 169

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSD-IEWIARILWAS 222
             G+ + LM  N  Y    +   +    + +++  S
Sbjct: 170 HVGKQVMLMPENKKYDPILLNEENPGRILGKVIKVS 205


>gi|295402356|ref|ZP_06812311.1| transcriptional regulator, XRE family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294975629|gb|EFG51252.1| transcriptional regulator, XRE family [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 206

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 63/215 (29%), Gaps = 26/215 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           K I + I++  +   ++   L  + GL   +  + +    E R       +I   L    
Sbjct: 6   KIIGKNIEKYRKLKGISAEELGNRVGLTKKTIRRYE--TGEIRIINDRVLAIADALDIDP 63

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             + +  D+        +                      G    GN        E    
Sbjct: 64  ADLYEGTDIVEFTDEVDKLPIV------------------GTISCGNGVIAYEDIEGYEE 105

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
               +    +    + +  SM+      GD+L++     V  GD   +    G+ V K +
Sbjct: 106 VPRSWLNGGEYFFLRAKGDSMINARIMDGDLLLIRRQDDVENGDIAAVLID-GEAVLKRV 164

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIAR 217
                 +I L S N  Y    +   D   I  I +
Sbjct: 165 YK-TDDTIILQSENPAYKPIILRKDDMKNIRIIGK 198


>gi|109289970|ref|YP_655502.1| CI repressor [Mannheimia phage phiMHaA1]
 gi|254360842|ref|ZP_04976989.1| bacteriophage repressor [Mannheimia haemolytica PHL213]
 gi|90110576|gb|ABD90586.1| CI repressor [Mannheimia phage phiMhaA1-PHL101]
 gi|90110627|gb|ABD90636.1| CI repressor [Mannheimia phage phiMhaA1-BAA410]
 gi|153092316|gb|EDN73385.1| bacteriophage repressor [Mannheimia haemolytica PHL213]
          Length = 228

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 64/218 (29%), Gaps = 7/218 (3%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             +   +  + ++  LT    A + G+   S  K          R     ++  +     
Sbjct: 2   DTLASRLKIVLDQKGLTQEKFAEQIGVSQPSVFKILNGQTRNPTRIYEIANVLDVDVNWL 61

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---VGVPEI 123
           +T           G+     E+E  +L            +G F TG+       V     
Sbjct: 62  KTGKGEAPDFAKIGKNPTAYEEESSMLRLEVLDVYASAGNGSFVTGDLTAYTHAVEFENA 121

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
                   A     +       SM P    GD+L +++      GD + +     ++  K
Sbjct: 122 YFAQVFQRANAKGLSIINVDGDSMEPTIGNGDLLFVDTTKSAYQGDGVYVFSYGENLYVK 181

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARI 218
            L    G  + ++S N  Y    +        +   ++
Sbjct: 182 RLQF-AGDELLVISDNPLYKEWRITSENEHKFQIHGKV 218


>gi|70728592|ref|YP_258341.1| Cro/CI family transcriptional regulator [Pseudomonas fluorescens
           Pf-5]
 gi|68342891|gb|AAY90497.1| transcriptional regulator, Cro/CI family [Pseudomonas fluorescens
           Pf-5]
          Length = 248

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 74/249 (29%), Gaps = 34/249 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M S   + +   +  + +R  ++P+ L R+ G+  ++ ++       G+   PS + I +
Sbjct: 1   MRSMQIRNVSTVLRELLDRDGISPTELHRRTGVPQSTLSRIL----SGKIVDPSDKHISR 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLL------------YFPPSGSGGFFDSGV 108
           I      +  QL                EI                     S  F     
Sbjct: 57  IAEYFQVSTDQLRGRVDIAPARAAAPRGEIHSELKDISLWDDDTPVDDDEVSVPFLREVE 116

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSA 162
              G+    +   E  S   G  +++              +  SMLP+ R G  + +N+ 
Sbjct: 117 LAAGSGRFVIEESERASLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAG 176

Query: 163 IQVNCGDRL----LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV------DTVEMSDI 212
                GD +          G +  K L       I L S N             ++   I
Sbjct: 177 KCAI-GDIVDGDLYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPDEDYSFQEIQEEQI 234

Query: 213 EWIARILWA 221
             +  + W 
Sbjct: 235 SILGHVFWW 243


>gi|46358671|ref|YP_006379.1| CI [Enterobacteria phage ST104]
 gi|56414532|ref|YP_151607.1| transcriptional activator-regulatory protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363463|ref|YP_002143100.1| transcriptional activator-regulatory protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|46357907|dbj|BAD15186.1| CI [Enterobacteria phage ST104]
 gi|56128789|gb|AAV78295.1| transcriptional activator-regulatory protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094940|emb|CAR60477.1| transcriptional activator-regulatory protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|312911317|dbj|BAJ35291.1| transcriptional activator-regulatory protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
          Length = 229

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 61/229 (26%), Gaps = 24/229 (10%)

Query: 4   FSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
              + + + +++  E   ++   LA+ +G+   +  +       G  +      I +I  
Sbjct: 1   MKKETLSDRLNKAMELAGMSQGALAKASGVAQPTIWRLTSGNARGSTK------IVEIAN 54

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
           A       L        +         P      +             G         EI
Sbjct: 55  ALGVNSEWLSTGIGPMKKDGTTPINASP----SSNTFKIDILDLEVSAGPGVINREFVEI 110

Query: 124 RSPHNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                                       +  SM      GD+L ++ +I+   GD +   
Sbjct: 111 LRSVEYSQDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDVSIKNFDGDGIYAF 170

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCY---PVDTVE-MSDIEWIARIL 219
                   K L   +   + ++S N  Y        + M+ +    +++
Sbjct: 171 LYDDTAHVKRLQKMKD-KLLVISDNKSYSAWDPIERDEMNRVFVFGKVI 218


>gi|289649967|ref|ZP_06481310.1| XRE family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|320321116|gb|EFW77260.1| XRE family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330988517|gb|EGH86620.1| XRE family transcriptional regulator [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 221

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 61/219 (27%), Gaps = 16/219 (7%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            + + +        L+   LA KAG+     ++ +     G +      SI K       
Sbjct: 3   NLADRLKIARAHAGLSQGELALKAGIKQPVISQLETGKNAGSS---FVVSIAKACGV--- 56

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV--PEIRS 125
              + L                       P     + +      G     + +       
Sbjct: 57  -NAEWLVNGQGGMLPETSGFDANVEPALAPVKFYEYPEISWVQAGAATEALVIGNVANCD 115

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
            H             K +  SM       + +G ++++     +  G  ++     T + 
Sbjct: 116 VHPSDAWAGPNGFWLKVKGPSMTAPGGISFVEGMLILIAPGFDIQSGQYVVAKITDTNEA 175

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K      GRS  L  LN  +    ++  D + I R++
Sbjct: 176 TFKQFYKDSGRSY-LRPLNPVFSTIEID-EDWQIIGRVV 212


>gi|316933939|ref|YP_004108921.1| LexA family transcriptional repressor [Rhodopseudomonas palustris
           DX-1]
 gi|315601653|gb|ADU44188.1| transcriptional repressor, LexA family [Rhodopseudomonas palustris
           DX-1]
          Length = 236

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/231 (12%), Positives = 62/231 (26%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++ + I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQFELLKFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG---FFDSGVF 109
                + K+   +            S       K +    +     G  G       G  
Sbjct: 61  ARAIEVIKLPDTSGMPGNARRGFTPSVIEGNLGKVRPPSPVPSEDDGDRGSVAVPVMGRI 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +                 +    + +  SM       GD+ ++      N G
Sbjct: 121 AAGTPIEALQTRSHTVSVPADMLGSGEHYALEVRGDSMVEAGILDGDMALIQKNDVANTG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 DIVVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 230


>gi|319897230|ref|YP_004135425.1| hypothetical protein HIBPF09641 [Haemophilus influenzae F3031]
 gi|317432734|emb|CBY81099.1| Conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 230

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 56/213 (26%), Gaps = 19/213 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   +    +   LT   L +  G+   +  K +  G               + +     
Sbjct: 4   LANRLKIARKAAGLTQDQLGKLVGVSQNAIQKIEAGGETKYT--------LALASVLGVD 55

Query: 69  ICQLLDLPFSDGRTTEKKEKE-IPLLYFPPSGSGGFFDSGVFPTG-NKWNTVGVPEIRSP 126
              L          T     E +             +       G +       PEI S 
Sbjct: 56  PIWLQSGEGKTPEKTTALSTELVTTQRDNEHRHRIDYLDVYLAAGISGIENSDYPEIIST 115

Query: 127 HNGIYAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                    +                  SM P  RKGDI+ +++ I    GD +      
Sbjct: 116 LFLSDEGMARLVGKRSSQGVSIVNVPTDSMEPTIRKGDIVFIDTTINCYIGDGIYAFSIN 175

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
           G++  K +         ++S N  YP + +   
Sbjct: 176 GELYIKRIQKLMSGGYRMISDNQAYPSEIISDE 208


>gi|295836144|ref|ZP_06823077.1| repressor LexA [Streptomyces sp. SPB74]
 gi|197695239|gb|EDY42172.1| repressor LexA [Streptomyces sp. SPB74]
          Length = 262

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 61  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 110

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 111 --RDPHRPRAYEVRGSDQPSPQPADTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 168

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 169 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 220

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 221 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 256


>gi|99080976|ref|YP_613130.1| LexA repressor [Ruegeria sp. TM1040]
 gi|122984325|sp|Q1GHJ8|LEXA_SILST RecName: Full=LexA repressor
 gi|99037256|gb|ABF63868.1| SOS-response transcriptional repressor, LexA [Ruegeria sp. TM1040]
          Length = 241

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/236 (13%), Positives = 65/236 (27%), Gaps = 18/236 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ E I +  ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLQLLEFIHKRLQKDGVPPSFDEMKTALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKK-------------EKEIPLLYFPPSGSGGFFD 105
            + +                      +                   L     +G+     
Sbjct: 61  ARAIEVIRLPDSLGGGGALGAASDGFQPKVIAGGRGDSADGGAAAELKPVADTGATELTI 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAI 163
            G    G     +              +   Q    + +  SM+      GD++++    
Sbjct: 121 MGRIAAGVPIEAINQAAAHVAVPNAMLSSSGQHYALEVRGDSMIDAGINDGDVVVIRETD 180

Query: 164 QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             + GD ++      +   K    + GR I+L + N  YP  +     ++   R++
Sbjct: 181 AADNGDIVVALVEGHEATLKRFERK-GRMIELHAANPAYPTRSYTEDQVKVQGRLV 235


>gi|310779490|ref|YP_003967823.1| transcriptional regulator, XRE family [Ilyobacter polytropus DSM
           2926]
 gi|309748813|gb|ADO83475.1| transcriptional regulator, XRE family [Ilyobacter polytropus DSM
           2926]
          Length = 232

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/228 (11%), Positives = 64/228 (28%), Gaps = 25/228 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF----------- 59
           + +    +    + +  A+  G+  + FN  +R  ++        + I            
Sbjct: 5   KFLKDRRKNLGYSQNKFAKSIGITQSYFNTIERGEVKNPPSEEVLDKISQGLQLNEKETE 64

Query: 60  --KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
             K LAA   T   ++       +     E     +    S                   
Sbjct: 65  TLKYLAALERTPDIIMKELSKLKKELTSAESLKANINLKESLPLIKGIPVYERISAGIGA 124

Query: 118 VGVPEIRSPHNGIYAIQT-----QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
           +             +I       +         SM P  + G ++I    +++  G+   
Sbjct: 125 I----NDGEVTDYLSIPGIKNAQEVFAVNVWGDSMEPNIKDGSVIICRKDVEIRDGEIGA 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
                 +   K +     + + LMS N  YP   +   + +  + +++
Sbjct: 181 FLLN-DEAYVKRI-KVTNQYVALMSDNPNYPPIFIGPGENLIAVGKVI 226


>gi|291295793|ref|YP_003507191.1| putative phage repressor [Meiothermus ruber DSM 1279]
 gi|290470752|gb|ADD28171.1| putative phage repressor [Meiothermus ruber DSM 1279]
          Length = 210

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 73/213 (34%), Gaps = 17/213 (7%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             +   + +  +   L+   +A  AG+  T      R     +    ST  + ++  A +
Sbjct: 4   DDVSLFVQKRIKELGLSVRKVASMAGISHTHLGNLIRGISSWKEVQFST--LERLAYALD 61

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             +  L+ L      + + +E+  P+ +            G+   G   +  GVP +   
Sbjct: 62  IPVNDLVYLVRGKVPSLDHRERVTPVRFLIQPVR------GLASAGQPVDPEGVPVLAD- 114

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVL 185
                  +     ++ +  SM P    GD + ++ +  ++  G   + +        K +
Sbjct: 115 -----VWRRGSLLYRVEGDSMAPTLHDGDRVYVDPSETELREGRIYICEIPGDGHTIKRV 169

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
                  + L+S N  Y       S++  + R+
Sbjct: 170 RRLDDGQLWLVSDNPAYRPW--RPSEMRIVGRV 200


>gi|198385590|gb|ACH86126.1| PrtR [Pseudomonas phage DVM-2008]
          Length = 267

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 77/248 (31%), Gaps = 33/248 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++       G+   PS + I K
Sbjct: 15  MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSRIL----SGKIVDPSDKHISK 70

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFP-----------PSGSGGFFDSGVF 109
           I      +  QL            ++++    L                 S  F      
Sbjct: 71  IAEYFAVSTDQLRGRADVVPAGNARRDEPHSELKDISLWDDETPVEEDEVSVPFLREVEL 130

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSAI 163
             G+    +   E  S   G  +++              +  SMLP+ R G  + +N+  
Sbjct: 131 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 190

Query: 164 QVNCGDRL----LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV------DTVEMSDIE 213
               GD +          G +  K L       I L S N             ++   I 
Sbjct: 191 CGI-GDIVDGDLYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPDEDYTFQEMQDEQIV 248

Query: 214 WIARILWA 221
            +  + W 
Sbjct: 249 ILGHVFWW 256


>gi|149204799|ref|ZP_01881762.1| LexA repressor [Roseovarius sp. TM1035]
 gi|149141768|gb|EDM29821.1| LexA repressor [Roseovarius sp. TM1035]
          Length = 233

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 62/229 (27%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIQKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I ++  +           P           +         + +      G    G
Sbjct: 61  ARALEIVRLPESLGGEAR-HSFSPRVIDGDLSDAPRPANAQPVEVAHAFEVPLMGRIAAG 119

Query: 113 NKWNTVGVPE-IRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +   +   S  + +          + +  SM       GD++I+      + GD 
Sbjct: 120 VPIEAIAHAQHNVSVPSNMIRGAANHYALEVRGDSMIEAGINDGDVVIIRETSVADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G +I L + N  Y         +    R++
Sbjct: 180 VVALIEDQEATLKRFYRR-GNAIALEAANPAYETRLFPEDQVRVQGRLV 227


>gi|39935968|ref|NP_948244.1| LexA repressor [Rhodopseudomonas palustris CGA009]
 gi|39649822|emb|CAE28344.1| SOS response transcriptional repressor, lexA [Rhodopseudomonas
           palustris CGA009]
          Length = 275

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 58/231 (25%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-----------EGR 49
           M +    ++ + I+   +   + PS    K  LD  S +   R                R
Sbjct: 40  MLTRKQFELLKFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 99

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            R      +         +                +     P       GS      G  
Sbjct: 100 ARAIEVIKLPDTGGMPGNSRRGFTPSVIEGNLGKVRPPSPTPAEDDHDRGSVAVPVMGRI 159

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +                 +    + +  SM       GD+ ++      + G
Sbjct: 160 AAGTPIEALQSRSHTISVPADMLGSGEHYALEVRGDSMVEAGILDGDMALIQKNDVADTG 219

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 220 DIVVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 269


>gi|283786292|ref|YP_003366157.1| phage repressor protein [Citrobacter rodentium ICC168]
 gi|282949746|emb|CBG89365.1| putative phage repressor protein [Citrobacter rodentium ICC168]
          Length = 231

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 71/229 (31%), Gaps = 18/229 (7%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   I  +     +  S LA   G+D  + ++ +     G+ +  + +S+ K   A   
Sbjct: 2   NIGNRIRELRLARGMKISDLADAVGIDGANVSRVE----TGKQKSFTEQSLSKYANALGV 57

Query: 68  TICQLL---------DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +L               +     + +    +     S S G          +   ++
Sbjct: 58  DVAELFTPSINETTVYKSSENNPVYGEDDPVFRVEMLDVSASAGMGFIQGSDVIDVIRSI 117

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
                R+                 +  SM      GD++ ++ +I    GD + +     
Sbjct: 118 EYNSERAVALFGGRTPDTVKVINVRGDSMADTIEPGDLIFVDVSINEFDGDGIYVFGFDE 177

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVE---MSDIEWIARILWA-SQ 223
            I  K L       I ++S N  Y   +V+           +++ + SQ
Sbjct: 178 KIYVKRLQMIPD-KILVISDNPKYREWSVDQSNEDRFYVFGKVMLSQSQ 225


>gi|330807816|ref|YP_004352278.1| XRE family transcriptional regulator [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375924|gb|AEA67274.1| putative Transcription factor, Xre family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 247

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 77/248 (31%), Gaps = 33/248 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M     + +   +  + ++H ++P+ L R+ G+  ++ ++       G+   PS + I K
Sbjct: 1   MRVMQKRNVSTVLRALLDQHGISPTELHRRTGVPQSTLSRIL----SGKIVDPSDKHISK 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFP-----------PSGSGGFFDSGVF 109
           I      +  QL            ++++    L                 S  F      
Sbjct: 57  IAEYFAVSTDQLRGRADVVPAGNARRDEPHSELKDISLWDDETPVEEDEVSVPFLREVEL 116

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSAI 163
             G+    +   E  S   G  +++              +  SMLP+ R G  + +N+  
Sbjct: 117 AAGSGRFVIEESERSSLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNAGK 176

Query: 164 QVNCGDRL----LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV------DTVEMSDIE 213
               GD +          G +  K L       I L S N             ++   I 
Sbjct: 177 CGI-GDIVDGDLYAINHNGQLRVKQLYRLPTG-IRLRSFNRDEHPDEDYTFQEMQDEQIV 234

Query: 214 WIARILWA 221
            +  + W 
Sbjct: 235 ILGHVFWW 242


>gi|85374133|ref|YP_458195.1| LexA repressor [Erythrobacter litoralis HTCC2594]
 gi|123293744|sp|Q2NA93|LEXA_ERYLH RecName: Full=LexA repressor
 gi|84787216|gb|ABC63398.1| SOS-response transcriptional repressor [Erythrobacter litoralis
           HTCC2594]
          Length = 233

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/227 (10%), Positives = 54/227 (23%), Gaps = 13/227 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRN--R 51
           M +    ++   I +  E   ++PS   +     L   S      +  +  G   R   R
Sbjct: 1   MLTAKQHELIRFIQQRLEETGISPSFEEMKEALDLKSKSGVHRLISALEERGFIRRLPNR 60

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
             + E + +                 +      +  +   +              G    
Sbjct: 61  ARALEILKQPEDVVGGGAKAAQSGSEASNVVDIRTAQAKTVPAPINDVVEIPLH-GRIAA 119

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           G     +   +   P              +    SM       GD  ++        G+ 
Sbjct: 120 GAPIEALEDHQSL-PVPAALLGPGDHYALEVSGDSMIEAGIFDGDFALIRRTDSARDGEI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
           ++      +   K L       + L   N  Y     +   ++   +
Sbjct: 179 VVALVNNEEATLKYLHRDS-GRVRLDPANASYEAQVYDPHQVQVQGK 224


>gi|168260980|ref|ZP_02682953.1| CI protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|307311055|ref|ZP_07590699.1| transcriptional regulator, XRE family [Escherichia coli W]
 gi|205349860|gb|EDZ36491.1| CI protein [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|306908561|gb|EFN39058.1| transcriptional regulator, XRE family [Escherichia coli W]
 gi|315061677|gb|ADT76004.1| putative CI repressor [Escherichia coli W]
 gi|323377741|gb|ADX50009.1| phage repressor like transcriptional regulator, XRE family
           [Escherichia coli KO11]
          Length = 217

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 59/214 (27%), Gaps = 15/214 (7%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS + I  +            
Sbjct: 8   RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLDEIGVVFKYLGIDNVSFN 62

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNG 129
                                +P                F  G+    V   +  S    
Sbjct: 63  HDGTFSPAGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAF 122

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
              ++       T      P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 123 WLEVEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   L  LN  YP+          + +++ ASQ
Sbjct: 180 GQVF-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 210


>gi|163736564|ref|ZP_02143983.1| LexA repressor [Phaeobacter gallaeciensis BS107]
 gi|161390434|gb|EDQ14784.1| LexA repressor [Phaeobacter gallaeciensis BS107]
          Length = 224

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/228 (14%), Positives = 68/228 (29%), Gaps = 19/228 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + + I+   ++  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLDFINTRLQQDGVPPSFDEMKVALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I ++  +   T       P    + +         L      + G     +    
Sbjct: 61  ARAIEIIRLPDSLGNTAEAAPAAPGPANQVSAPAMIAAMELPVMGRIAAGVPIEAINQVS 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
           +    V VP          + Q Q    + +  SM       GDI+++      + GD +
Sbjct: 121 H---QVAVPASM------LSAQGQHFALEVRGDSMIEAGINDGDIVVIRETAVADNGDVV 171

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K +  + G +I L + N  Y         ++   R++
Sbjct: 172 VALVEGQEATLKRIYRK-GSTIALEAANPAYETRRYPQDQVKVQGRLV 218


>gi|212710117|ref|ZP_03318245.1| hypothetical protein PROVALCAL_01170 [Providencia alcalifaciens DSM
           30120]
 gi|212687324|gb|EEB46852.1| hypothetical protein PROVALCAL_01170 [Providencia alcalifaciens DSM
           30120]
          Length = 214

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 80/226 (35%), Gaps = 28/226 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTS-FNKSKRFGIEGRNRWPSTESIF 59
           M    ++ I E +  + E   L+ + LA+  G    S     +        R  S +   
Sbjct: 1   MKKI-NEIIGERLKSIRESRGLSQAQLAKLCGYSAASRIGNYELGE-----RKISADDAL 54

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            I  A   +  +L+    SD   +     E PLL    +G+    +S  +   +    + 
Sbjct: 55  VISEALGVSPAELMFGTQSDQVISN---YEYPLLTKIQAGAFTE-NSNSYTEKDAIAWIP 110

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLI 173
                           +    + +  SM       P + +G +++++    VN GD  + 
Sbjct: 111 T---------AKKASERAFWLEVEGHSMTAAQGGKPSFPEGMLILIDPKEPVNVGDFCIA 161

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +    +   K LI   G++  L  LN  + +  +   + E I +++
Sbjct: 162 RLNGNEFTFKKLIRESGQTF-LEPLNPKFDLIPIN-ENCEIIGKVI 205


>gi|115524578|ref|YP_781489.1| LexA repressor [Rhodopseudomonas palustris BisA53]
 gi|122296173|sp|Q07NH5|LEXA_RHOP5 RecName: Full=LexA repressor
 gi|115518525|gb|ABJ06509.1| SOS-response transcriptional repressor, LexA [Rhodopseudomonas
           palustris BisA53]
          Length = 237

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/232 (12%), Positives = 61/232 (26%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++   I+   +   + PS    K  LD  S +   R       R      P+ 
Sbjct: 1   MLTRKQFELLRFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTE-------KKEKEIPLLYFPPSGSGGFFDSGV 108
               +++      I            +         +    I         +      G 
Sbjct: 61  ARAIEVIKLPEFGINGGGQTRRGFTPSVIEGHLGKVRPHASIGSDEDSHDRNVAVPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNC 167
              G     +                 +    + +  SM+      GD+ ++      + 
Sbjct: 121 IAAGTPIEALQTRSHTISVPPDMLGSGEHYALEVRGDSMVDAGILDGDMALIQKNESADT 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 GDIVVALIDEEEATLKRFRRRGA-SIALEPANSAYEVRILPPNRVRIQGKLV 231


>gi|218690255|ref|YP_002398467.1| Repressor protein CI from phage [Escherichia coli ED1a]
 gi|218427819|emb|CAR08732.2| Repressor protein CI from phage [Escherichia coli ED1a]
          Length = 215

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/226 (16%), Positives = 77/226 (34%), Gaps = 28/226 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  H+ I E I  + E   L+ + LA+  G    S    +    E   R  S +    
Sbjct: 1   MKTM-HEIIGERIKSLREAKGLSQAQLAKLCGWAAPS----RLGNYELGTRKVSADDALV 55

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           + AA   +  +++         ++   ++     F    +G F + G +   +    V  
Sbjct: 56  LGAALGVSPAKIMFGED-----SDAVFRQYEYPLFSSVQAGPFSEVGSYTASDAKAWVPT 110

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIK 174
               S          +    + +  SM       P + +G +++++ A  V  GD  +  
Sbjct: 111 TTKASE---------KAFWLEVKGHSMTAPQGVRPSFPEGMLILVDPAEPVESGDFCVAS 161

Query: 175 PRTG-DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K      G S  L+ LN  Y     + +    I +++
Sbjct: 162 ANGDSEATFKKYEKDAGVSY-LVPLNPAYRTLDCDHT-CRIIGKVV 205


>gi|169333724|ref|ZP_02860917.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259573|gb|EDS73539.1| hypothetical protein ANASTE_00108 [Anaerofustis stercorihominis DSM
           17244]
          Length = 197

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 78/213 (36%), Gaps = 27/213 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E +  + + H +T   LA    LD +S  K +  GI      PS +++ KI A  N +I
Sbjct: 3   GEKLRSLRKEHGMTQVDLANALDLDKSSIAKYESAGII-----PSVDTLQKISALFNVSI 57

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNG 129
             LL+ PF D          + ++    +G  G             N             
Sbjct: 58  DYLLNAPFGDINNVMN----VEIIGTVVAGRDGIATYEFLGISQAIN------------- 100

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
               + +    K +  SM P   +GD+ ++     ++ GD  ++     + V K +    
Sbjct: 101 -INNKDEYKYLKVRGDSMAPQILEGDLALVRLQPDIDSGDLAVVIIGGEEGVIKKVQK-T 158

Query: 190 GRSIDLMSLNCCYPVDTV---EMSDIEWIARIL 219
             SI L+S N  Y        +M  ++   +++
Sbjct: 159 DNSISLISFNPMYDTRVFIGKDMEQLQIFGKVV 191


>gi|157692462|ref|YP_001486924.1| LexA repressor [Bacillus pumilus SAFR-032]
 gi|166990797|sp|A8FDP7|LEXA_BACP2 RecName: Full=LexA repressor
 gi|157681220|gb|ABV62364.1| transcriptional regulator [Bacillus pumilus SAFR-032]
          Length = 206

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 61/227 (26%), Gaps = 36/227 (15%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILTFIKEEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     ++L                     E+       +   P          +    N
Sbjct: 61  TKPRAIEVLD-------------------EEELNIPKSAVMNVPVIGKVTAGLPITAVEN 101

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +PE  +      A   Q    +    SM+       D +I+      N GD ++
Sbjct: 102 VEEYFPLPETFA------APDEQVFMLEIMGESMIDAGILDKDYVIVRQQSTANNGDIVV 155

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K           L   N       ++   +  + +++
Sbjct: 156 AMTEEDEATVKRFYK-EDTHFRLQPENPSMEPIILQN--VSILGKVI 199


>gi|86742192|ref|YP_482592.1| LexA repressor [Frankia sp. CcI3]
 gi|123737138|sp|Q2J779|LEXA_FRASC RecName: Full=LexA repressor
 gi|86569054|gb|ABD12863.1| SOS-response transcriptional repressor, LexA [Frankia sp. CcI3]
          Length = 256

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 64/222 (28%), Gaps = 12/222 (5%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIFK 60
            +++ E I    ER    PS   +    GL  TS   ++ K    +G   R P+     +
Sbjct: 33  QRRVLEVIRAAVERRGYPPSVREIGEAVGLTSTSSVAHQLKVLEEKGYLRRDPNRPRAME 92

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG--VFPTGNKWNTV 118
           +L   +      +    +    T     E        S S   +         G      
Sbjct: 93  VLTVEHPRQRADVGAGATTVAGTIPIVGEAAPGTTEGSKSDAAYVPVLGRIAAGGPILAE 152

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRT 177
              E   P       +      +    SM+      GD +++      + G+ +      
Sbjct: 153 QAVEDVFPLPREIVGEGTLFLLRVVGDSMINAAICDGDWVVVRQQPVADNGEIVAAMID- 211

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           G+   K L   R   I L   N  +        D   + RI+
Sbjct: 212 GEATVKRL-RVRDGKIWLHPENSAFADI--PGEDATILGRIV 250


>gi|60099615|gb|AAX12919.1| transcriptional regulator [Escherichia blattae DSM 4481]
          Length = 246

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 75/229 (32%), Gaps = 23/229 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
             +  + ++   + +  A  AG+ P+  N+       G    P   ++ K    + E + 
Sbjct: 19  SRLRALLKKFK-SNNAFAVAAGISPSGLNRLLEG---GYPTLPILIALAKAGGVSVEWLS 74

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-------GGFFDSGVFPTGNK-WNTVGVPE 122
              DL  S      + +     +      +            +     G   WN    P 
Sbjct: 75  TGGDLVESKLPALVQGDVVGATVTDVKGNNVDLEEFVFVPRYNVCASAGYGSWNDDETPM 134

Query: 123 IRSPHNGIY------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                   +      A   Q +       SM  +    DI+++N A +    + + +   
Sbjct: 135 FTVSFRRFWVTNHLKADPAQLSVISVYGDSMEGVLNDKDIILINHADK-EPREGIYVLRI 193

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI----EWIARILWA 221
            G ++ K +    G  + + S N  Y   ++ ++D+    + + +++W 
Sbjct: 194 DGQLIVKRVQRLPGSLLRITSTNPAYEPFSINLNDVPSDFDIVGKVVWY 242


>gi|313902000|ref|ZP_07835415.1| SOS-response transcriptional repressor, LexA [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467724|gb|EFR63223.1| SOS-response transcriptional repressor, LexA [Thermaerobacter
           subterraneus DSM 13965]
          Length = 201

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/229 (13%), Positives = 63/229 (27%), Gaps = 45/229 (19%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRNR 51
           M   +   ++I + I          PS   +    GL  TS       + +R G     R
Sbjct: 1   MEELTRRQRQILDYIKASIRERGYPPSVREIGEAVGLKSTSTVHTYLARLERKGYI--RR 58

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            P+     ++L  +      +           +                       +   
Sbjct: 59  DPTKPRAIEVLEESGLRTRTVPVPLVGQVTAGQP----------------------ILAV 96

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
            N  + + +P    P       + +    + +  SM+      GD +I+      + GD 
Sbjct: 97  ENIEDVLPLPTELVP-------EGEVFALRIRGDSMIGAGILDGDYVIVRRQETADNGDI 149

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K     R   I L   N       V  +    + +++
Sbjct: 150 VVALID-DEATVKRFYRERDG-IRLQPENPAMEPIRVRTA--RILGKVV 194


>gi|218890289|ref|YP_002439153.1| putative c repressor [Pseudomonas aeruginosa LESB58]
 gi|218770512|emb|CAW26277.1| putative c repressor [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/208 (13%), Positives = 68/208 (32%), Gaps = 22/208 (10%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           +  G +++ GL   +              +P+ + + +I  A   +   L          
Sbjct: 38  SLRGFSKECGLSEATLRSYLSGET-----FPTLDRLEQIAKAAGTSAMWL--------AF 84

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQT------Q 136
                 E        S +           G+   T G   +       Y+++        
Sbjct: 85  GTPTSAEDSREKGDDSYAYIPLYDARVSAGHGSWTEGARILAQLAFTRYSLRKQGLEIAN 144

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
            +  +    SM PL   GD ++++ +      + + +      + AK +  +    + ++
Sbjct: 145 MSAVRIGGDSMEPLLSDGDTVMIDHSCNEVRDEAVYVIRLDDHLYAKRVQRQINGGLAII 204

Query: 197 SLNCCYPVDTV---EMSDIEWIARILWA 221
           S N  Y    V   ++  ++ I R++W+
Sbjct: 205 SANPAYQTMFVSKQDLEAVDIIGRVVWS 232


>gi|56963932|ref|YP_175663.1| LexA repressor [Bacillus clausii KSM-K16]
 gi|71658808|sp|Q5WG03|LEXA_BACSK RecName: Full=LexA repressor
 gi|56910175|dbj|BAD64702.1| SOS-response transcriptional repressor [Bacillus clausii KSM-K16]
          Length = 208

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/226 (12%), Positives = 61/226 (26%), Gaps = 32/226 (14%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M+  S   ++I   I    ++    PS   +    GL   ++ +    R   +G  R   
Sbjct: 1   MSKLSKRQEEILAYIKDEVKKKGYPPSVREIGEAVGLASSSTVHGHLARLEKKGYIRRDP 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+     + +        +    +       K      +                   N 
Sbjct: 61  TKPRAIEVLSLGFDNDTFVKKETASFIPVIGKVTAGVPIT---------------AVENV 105

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            + + +P+         A          Q  SM       GD +I+      + GD ++ 
Sbjct: 106 EDYLPLPDHL-------AAYDNTYALVIQGESMIEAGIYDGDQVIVRQQQTADNGDIIVA 158

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +   I L   N       +   +   + +++
Sbjct: 159 MTEDNEATVKRFFREKD-YIRLQPENSSMEPIIL--ENCTILGKVI 201


>gi|327254477|gb|EGE66099.1| helix-turn-helix family protein [Escherichia coli STEC_7v]
          Length = 237

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/228 (12%), Positives = 73/228 (32%), Gaps = 17/228 (7%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E ++       ++ S LA   G+   +  K       G  +     +  K+      +  
Sbjct: 8   ERLNAAMSLAGVSQSQLADMVGISQPAIQKMSSGKTNGSRKMVELANALKVRPEWLSSGI 67

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTVGVPEIRS 125
             +     +  +  ++     +++     +   F +          G+    +      S
Sbjct: 68  GEMRDGAHEEPSNVRESSLKAVVWEDIKRNDDEFVALPLLNVSLSAGSGSCELEESSEFS 127

Query: 126 PHNGIYAI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                + +      +      +    SM P    GD++ +N+        +     ++  
Sbjct: 128 LVFRKHYLKKMGVSERSAKLVRVVGQSMEPTLHDGDVVGVNTQDTTIRDGKTYAICQSDL 187

Query: 180 IVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           +  K LI     S+ + S+N   YP + ++  +    +  I R+ W+S
Sbjct: 188 LRVKTLI-ATPTSVIIRSINREEYPDEVMDRDEFHETVRIIGRVFWSS 234


>gi|152965474|ref|YP_001361258.1| SOS-response transcriptional repressor, LexA [Kineococcus
           radiotolerans SRS30216]
 gi|151359991|gb|ABS02994.1| SOS-response transcriptional repressor, LexA [Kineococcus
           radiotolerans SRS30216]
          Length = 244

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 69/218 (31%), Gaps = 22/218 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +++  AI    E+    PS   + +  GL  P+S  ++ K     G  R        + 
Sbjct: 37  QRRVLAAIQECVEQRGYPPSMREIGQAVGLTSPSSVAHQVKTLEKLGYLR--KDPRRPRT 94

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           L     +      L  ++  + E + +   +       +GG   +         +   +P
Sbjct: 95  LEVVAPSSAGPGLLDGTEAGSAENRPRPRYVPVVGRIAAGGPILAEQL----VEDVFALP 150

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E             +    +    SM       GD +++        GD ++     G+ 
Sbjct: 151 EQLVGT-------GEHFMLRVVGESMLEAAICDGDWVVVRQQPTAENGD-VVAAMIDGEA 202

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
             KVL  +    + L+  N  +     +  +   + R+
Sbjct: 203 TVKVLQRK-DGHVKLLPRNPLFDPI--DGDEATILGRV 237


>gi|119026133|ref|YP_909978.1| LexA repressor [Bifidobacterium adolescentis ATCC 15703]
 gi|154488907|ref|ZP_02029756.1| hypothetical protein BIFADO_02216 [Bifidobacterium adolescentis
           L2-32]
 gi|171473029|sp|A1A2G3|LEXA_BIFAA RecName: Full=LexA repressor
 gi|118765717|dbj|BAF39896.1| LexA repressor [Bifidobacterium adolescentis ATCC 15703]
 gi|154083044|gb|EDN82089.1| hypothetical protein BIFADO_02216 [Bifidobacterium adolescentis
           L2-32]
          Length = 257

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 67/219 (30%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +K+ +AI     +    PS   +   AGL  P+S  ++ +    +G  R  + +     
Sbjct: 44  QRKVLDAIKTHLAKQGFAPSFREIGEAAGLKSPSSVKHQLQVLDEKGFIRMNANKGRAIE 103

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +   N+              + +     I   +  P          +    +  + + +P
Sbjct: 104 VVNLNDEEPNGKVAQVIPFPSQDDACGSIMASHDVPLVGRIAAGVPITAEQHVDDVMRLP 163

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E  +               +    SM+      GD +++        GD +       + 
Sbjct: 164 ERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQNSAENGDIVAALLD-DEA 215

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y     + +  E + +++
Sbjct: 216 TVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 251


>gi|332533845|ref|ZP_08409701.1| regulatory protein Cro [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036776|gb|EGI73239.1| regulatory protein Cro [Pseudoalteromonas haloplanktis ANT/505]
          Length = 206

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 78/216 (36%), Gaps = 19/216 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN-E 67
           + E I +      LT + LA  AG+   S  K +    +   R  + +++   L  T   
Sbjct: 3   VGERIKKRRVELGLTQANLAELAGIIQQSLQKIESGSTK-NPR--NLKALADALDCTPEF 59

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
               + +   S+       +  +PL+ +  +G+    +               P   S  
Sbjct: 60  LQFGIAESINSNVSPGPDIKSTVPLISWVQAGAWSEINEIR---ECDAERFMCPVNAS-- 114

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PRTGDIVAKVLI 186
                  ++    + Q  SM P + +GD++ ++   +   G  ++ +         K LI
Sbjct: 115 -------SKTFALRVQGVSMEPKFYEGDLIFVDPEAECIHGSYVVARLDDDNHATFKQLI 167

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARILWA 221
              G    L + N  +P   + ++ +   + ++++A
Sbjct: 168 IESGHKF-LKAANPNWPEQLIPINGNCTLVGKVVFA 202


>gi|254474906|ref|ZP_05088292.1| LexA repressor [Ruegeria sp. R11]
 gi|214029149|gb|EEB69984.1| LexA repressor [Ruegeria sp. R11]
          Length = 226

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 62/221 (28%), Gaps = 3/221 (1%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +     + + I    ++  + PS    K  LD  S +   R       R        +
Sbjct: 1   MLTKKQLDLLDFIHTRLQKDGVPPSFDEMKVALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
             A     +   L     D         +          +      G    G     +  
Sbjct: 61  ARAIEIIRLPDSLGGTVEDVAEAPTPANQGTAPAAATIAAMELPVMGRIAAGVPIEAINQ 120

Query: 121 PEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
              +        + Q Q    + +  SM       GDI+++      + GD ++      
Sbjct: 121 ISHQVAVPASMLSAQGQHFALEVRGDSMIEAGINDGDIVVIRETSVADDGDVVVALVEGQ 180

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K +  + G S+ L + N  Y         ++   R++
Sbjct: 181 EATLKRIYRK-GTSVALEAANPAYETRRYRQDQVKVQGRLV 220


>gi|260599222|ref|YP_003211793.1| 26 kDa repressor protein [Cronobacter turicensis z3032]
 gi|260218399|emb|CBA33475.1| 26 kDa repressor protein [Cronobacter turicensis z3032]
          Length = 245

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 72/231 (31%), Gaps = 17/231 (7%)

Query: 4   FSHKKI----WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
            SH+ +     E + +       T   LA+  G+  +S NK        R    +T ++ 
Sbjct: 13  RSHEDLTMNFSERLAKAMADAGYTQGALAKAVGMAQSSVNKLLNGANGSR----NTVALA 68

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT-- 117
           +IL  + E +     L        +        +Y                  +++    
Sbjct: 69  RILGVSPEWLADGQGLMRPLTTERKSAAASGADVYRVEVFDVRASAGSGVMIRDEFIETI 128

Query: 118 --VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
             +      +                    SM   +   D + ++ ++    GD + I  
Sbjct: 129 KSIEYSSEEARSLFGSRPADHIKMIAVNGDSMSGTFEPRDQIFVDVSVDFFDGDGIYIFT 188

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSD--IEWIARILWASQ 223
               +  K L  +  + + ++S N  Y    + ++ +  +   A++L  SQ
Sbjct: 189 LDNYVYIKRLQLQH-KRLAVISDNKKYETWYITDIDESGLNIRAKVL-VSQ 237


>gi|294478947|gb|ADE87512.1| transcriptional regulator [Deep-sea thermophilic phage D6E]
          Length = 206

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 65/215 (30%), Gaps = 26/215 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           KK+ + I++  +   L+   L  + GL   +  + +    E R       +I + L    
Sbjct: 6   KKVGQNIEKYRKMKGLSAEELGNRVGLTKKTIRRYE--TGEIRIINDRVLAIAEALDVDP 63

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
             + +  D+      T +                      G    GN        E    
Sbjct: 64  ADLYEGTDVVEFTDETEKLPIV------------------GAISCGNGTVAYETIEGYEE 105

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
               +    +    + +  SM+      G +L++     V  GD   +     D V K +
Sbjct: 106 VPKSWIKGGKYFFLRAKGDSMINAHITDGSLLLIRRQDDVENGDIAAVLID-DDAVLKRV 164

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIAR 217
               G +I L S N  Y    +   D   +  I +
Sbjct: 165 YK-SGDTIILQSENPAYKPIILHKDDMKNVRIIGK 198


>gi|320182370|gb|EFW57268.1| putative transcriptional regulator [Shigella boydii ATCC 9905]
 gi|323170913|gb|EFZ56563.1| peptidase S24-like family protein [Escherichia coli LT-68]
          Length = 224

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/222 (13%), Positives = 71/222 (31%), Gaps = 17/222 (7%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
                ++ S LA   G+   +  K       G  +     +  K+      +    +   
Sbjct: 1   MRSAGVSQSQLADMVGISQPAIQKMSSGKTNGSRKMVELANALKVRPEWLSSGIGEMRDG 60

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-----GVFPTGNKWNTVGVPEIRSPHNGIY 131
             +  +  ++     +++     +   F +          G+    +      S     Y
Sbjct: 61  THEEPSNIRESSLKAVVWEDIKKNDDEFVALPLLNVSLSAGSGSCEIEESSEFSLVFRKY 120

Query: 132 AI------QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
            +      ++     +    SM P    GD++ +N+        +     ++  +  K L
Sbjct: 121 YLKKMGVTESSAKLVRVTGQSMEPTLHDGDVVGVNTQDTTIRDGKTYAICQSDLLRVKTL 180

Query: 186 ISRRGRSIDLMSLN-CCYPVDTVEMSD----IEWIARILWAS 222
           I     S+ + S+N   YP + ++  +    +  I R+ W+S
Sbjct: 181 I-ATPTSVIIRSINREEYPDEVMDRDEFHKTVRIIGRVFWSS 221


>gi|312111541|ref|YP_003989857.1| LexA family transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|311216642|gb|ADP75246.1| transcriptional repressor, LexA family [Geobacillus sp. Y4.1MC1]
          Length = 207

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 63/227 (27%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I + I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILDFIKKEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                          E   +   P          +    N
Sbjct: 61  TKPRAIEILD------------------ADFSARNETDDVISVPIIGKVTAGQPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P        + + +      +    SM       GD +I+      + GD ++
Sbjct: 103 IEDYFPLP------KRLISSEDHVFMLEVMGDSMIEAGILDGDYVIVRQQQSADNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEENEATVKRFFKEKD-HIRLQPENSNLEPIIVR--DCTILGKVI 200


>gi|310780644|ref|YP_003968975.1| transcriptional regulator, XRE family [Ilyobacter polytropus DSM
           2926]
 gi|309749967|gb|ADO84627.1| transcriptional regulator, XRE family [Ilyobacter polytropus DSM
           2926]
          Length = 224

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 62/220 (28%), Gaps = 13/220 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           KKI E I +  E  NL+   L+ K  L+ +  ++ +     G  +  + E + KI    +
Sbjct: 4   KKIGEFIRKRRESLNLSQGQLSYKCDLETSVIHRIE----VGERKKINYEHLKKIATGLD 59

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPP------SGSGGFFDSGVFPTGNKWNTVGV 120
               +L  L                            S +                 +  
Sbjct: 60  MNYIELYKLAGIIEEDALSDYYLPDFNDKINQQIELISDTKVDTIPIYESVSAGCGYIPD 119

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                  +   + +           SM P      ++++    ++   D  +     G+ 
Sbjct: 120 SVPLEYISLHLSGKENCIGIIVDGHSMEPTITDKAVIVMKKDTELKSKDIGVFLLN-GEA 178

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEM-SDIEWIARIL 219
             K    +    I L S N  Y    V+   D     +++
Sbjct: 179 YVKRFFKK-NNIIILYSDNSEYSPIIVDEYDDFIICGKVI 217


>gi|302542054|ref|ZP_07294396.1| repressor LexA [Streptomyces hygroscopicus ATCC 53653]
 gi|302459672|gb|EFL22765.1| repressor LexA [Streptomyces himastatinicus ATCC 53653]
          Length = 267

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 66  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 115

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 116 --RDPHRPRAYEVRGSDQPSAQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 173

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 174 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 225

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 226 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 261


>gi|56419863|ref|YP_147181.1| LexA repressor [Geobacillus kaustophilus HTA426]
 gi|261419534|ref|YP_003253216.1| LexA repressor [Geobacillus sp. Y412MC61]
 gi|297530496|ref|YP_003671771.1| transcriptional repressor, LexA family [Geobacillus sp. C56-T3]
 gi|319766350|ref|YP_004131851.1| transcriptional repressor, LexA family [Geobacillus sp. Y412MC52]
 gi|61213225|sp|Q5L0C3|LEXA_GEOKA RecName: Full=LexA repressor
 gi|56379705|dbj|BAD75613.1| transcriptional repressor of SOS regulon [Geobacillus kaustophilus
           HTA426]
 gi|261375991|gb|ACX78734.1| transcriptional repressor, LexA family [Geobacillus sp. Y412MC61]
 gi|297253748|gb|ADI27194.1| transcriptional repressor, LexA family [Geobacillus sp. C56-T3]
 gi|317111216|gb|ADU93708.1| transcriptional repressor, LexA family [Geobacillus sp. Y412MC52]
          Length = 207

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 67/227 (29%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I E I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILEFIKQEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                       KE+E   +   P          +    N
Sbjct: 61  TKPRAIEILDND------------------MAKEREKEEIISVPIIGKVTAGQPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
                 +P+  +      A + Q    +    SM       GD +I+      N GD ++
Sbjct: 103 IEGYFPLPKRLA------AGEEQLFMLEVMGDSMIEAGILDGDYVIVRQQSSANNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEDNEATVKRFFKEKD-HIRLQPENAHLEPIIVR--DCTILGKVI 200


>gi|222085871|ref|YP_002544402.1| LexA repressor [Agrobacterium radiobacter K84]
 gi|254809083|sp|B9JEY4|LEXA_AGRRK RecName: Full=LexA repressor
 gi|221723319|gb|ACM26475.1| LexA repressor [Agrobacterium radiobacter K84]
          Length = 240

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/234 (12%), Positives = 66/234 (28%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR------TTEKKEKEIPLLYFPPSGSGGFFDS 106
                + K+  A + ++        S            +            + +      
Sbjct: 61  ARALEVIKLPEAYSPSLQPRRGFSPSVIEGSLGKPQPVQPPAPAKPANDENNSAVSVPVM 120

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV 165
           G    G   + +                 +    + +  SM+      GD +I+ ++   
Sbjct: 121 GRIAAGVPISAIQNNTHDITVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNSTTA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           N GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 NPGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 233


>gi|138894847|ref|YP_001125300.1| LexA repressor [Geobacillus thermodenitrificans NG80-2]
 gi|166224569|sp|A4IMK1|LEXA_GEOTN RecName: Full=LexA repressor
 gi|134266360|gb|ABO66555.1| Transcriptional regulator [Geobacillus thermodenitrificans NG80-2]
          Length = 207

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 69/227 (30%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I E I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILEFIKQEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                   +   KE+E   +   P          +    N
Sbjct: 61  TKPRAIEILD------------------SDLTKEREKEEVISVPMIGKVTAGQPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P+  +      A + Q    +    SM       GD +I+      N GD ++
Sbjct: 103 IEDYFPLPKRLA------AGEKQLFMLEVMGDSMIEAGILDGDYVIVRQQSSANNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEENEATVKRFFKEKD-HIRLQPENVHLEPIIVR--DCTILGKVI 200


>gi|268610362|ref|ZP_06144089.1| SOS-response transcriptional repressor [Ruminococcus flavefaciens
           FD-1]
          Length = 217

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 62/216 (28%), Gaps = 15/216 (6%)

Query: 10  WEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
            E +  +     +T   LA   G    ++  K +    +         +I K L  T   
Sbjct: 4   GERVLALRTEKGMTQDELALAVGYKSRSTIAKIESGERD--PHQSMIAAIAKALDTTPAY 61

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG--FFDSGVFPTGNKWNTVGVPEIRSP 126
           +    +   S  +     +              G            N    +        
Sbjct: 62  LMGWEESEQSPDKDKNLSKIPYTEEGTVLVPLIGKVAAGYSCHAEDNISEYIRTDGSSLK 121

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
               Y         + +  SM P   + D++++    +++     ++     D + K + 
Sbjct: 122 TGYDY------FWLEVKGDSMEPELHEKDLVLVQEQSELDAECYAVVTVDNEDGLVKQVQ 175

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
                 I L S+N  YP    E  D   I+ + R++
Sbjct: 176 -IDNTKITLKSINPYYPPRVFEKQDMNRIKIVGRVI 210


>gi|66395676|ref|YP_240035.1| ORF020 [Staphylococcus phage 47]
 gi|209363558|ref|YP_002267976.1| probable transcriptional repressor [Staphylococcus phage
           phi2958PVL]
 gi|257428267|ref|ZP_05604665.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|282905891|ref|ZP_06313746.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282919258|ref|ZP_06326993.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           C427]
 gi|284024543|ref|ZP_06378941.1| transcriptional repressor [Staphylococcus aureus subsp. aureus 132]
 gi|62636100|gb|AAX91211.1| ORF020 [Staphylococcus phage 47]
 gi|208973059|dbj|BAG74375.1| probable transcriptional repressor [Staphylococcus phage
           phi2958PVL]
 gi|257275108|gb|EEV06595.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|282317068|gb|EFB47442.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           C427]
 gi|282331183|gb|EFB60697.1| transcriptional repressor [Staphylococcus aureus subsp. aureus
           Btn1260]
          Length = 204

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 73/214 (34%), Gaps = 21/214 (9%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I    +  NLT   +    G+  ++  K +   IE   R    + I K+  A   +   +
Sbjct: 5   IKSRRKELNLTLEQVGDLVGVGKSTVRKWETGDIENMKR----DKIVKLAKALRVSPSYI 60

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           + +     +      K+IP++    +G         +   N  + +              
Sbjct: 61  MGIEDEKPQLETIPVKKIPVVSKISAGMPI------YTEENLIDYIYF------ATKNLN 108

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
              ++   +    SM  L++ GD++++     V  G   ++     +   K +       
Sbjct: 109 SNKEEFGLQVSGDSMDKLFQDGDVVVVEKDSTVENGQLGVVLVNGYNGTVKRIRY-NNDQ 167

Query: 193 IDLMSL--NCCYPVDTVEMSD-IEWIARILWASQ 223
           I L+    N  +        D ++ + R++ ASQ
Sbjct: 168 IILIPESNNPSHYPQVYGKDDEVKIVGRVV-ASQ 200


>gi|145593998|ref|YP_001158295.1| LexA repressor [Salinispora tropica CNB-440]
 gi|145303335|gb|ABP53917.1| SOS-response transcriptional repressor, LexA [Salinispora tropica
           CNB-440]
          Length = 261

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 62/219 (28%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAG-LDPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            ++I E I    E+H   PS   +    G + P+S   + K    +G  R          
Sbjct: 60  QRRILEFIRTWVEQHGYPPSVREIGEAVGLVSPSSVAYQLKELEKKGFLR---------- 109

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                     +   P  D    E    + P   + P          +       +   +P
Sbjct: 110 --RDPNRPRAVDVRPPGDALDDEAALAQRPAPAYVPMLGRIAAGGPILAEQAIEDIFPLP 167

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    + +  SML      GD +++        GD +      G+ 
Sbjct: 168 RELVG-------EGEVFMLQVKGDSMLDAAICDGDWVVVRQQPTAESGDIVAAMLD-GEA 219

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + LM  N  +        D   + R++
Sbjct: 220 TVKTYRRR-DGHVWLMPQNPAFDPI--AGDDATIMGRVV 255


>gi|317129106|ref|YP_004095388.1| transcriptional repressor, LexA family [Bacillus cellulosilyticus
           DSM 2522]
 gi|315474054|gb|ADU30657.1| transcriptional repressor, LexA family [Bacillus cellulosilyticus
           DSM 2522]
          Length = 208

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/226 (13%), Positives = 65/226 (28%), Gaps = 33/226 (14%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           MT  S   + I + I    +     PS   +    GL   ++ +    R   +G  R   
Sbjct: 2   MTKLSKRQQDILDYIKEEVKEKGYPPSVREIGEAVGLASSSTVHGHLSRLEKKGLIRR-- 59

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
                     T     +++ L     R +E     +P++    +G        +    N 
Sbjct: 60  --------DPTKPRAIEVIGLNDEARRVSESPSVYVPVIGKVTAG------DPITAIENV 105

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            + + +P         +         +    SM       GD +++      N GD ++ 
Sbjct: 106 EDYLPLPAS-------FVHDENSFILEISGDSMIEAGIFDGDYVVVRQQQNANNGDIVVA 158

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +     L   N       +    +  + +++
Sbjct: 159 MTEEDEATVKRFFKEKD-YFRLQPENATLEPIILRS--VTILGKVI 201


>gi|144900044|emb|CAM76908.1| transcriptional regulator [Magnetospirillum gryphiswaldense MSR-1]
          Length = 222

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 73/215 (33%), Gaps = 9/215 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +   + +  +T   +A  AG++ +      R    GR+  PS E +  I  A N    
Sbjct: 7   DRLRARSRQLGMTAGRVAELAGVNRSFVYDIMR----GRSENPSLEKLDLISEALNVERN 62

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT-VGVPEIRSP-HN 128
            LL         +   E  + +     S        G     ++          RS   +
Sbjct: 63  WLLHGIGGVDGESPIMEDPMGVFVSISSVQVSASMGGGNLVSDEVENGEPYHFQRSWILH 122

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
            + A          +  SM+P    GD+++++ + ++     + +      +VAK L   
Sbjct: 123 DLKADPNNLRIMHVEGDSMMPTLHSGDVVLVDLSKRLPTPPGIFVLFDGMGLVAKRLEHI 182

Query: 189 RGR---SIDLMSLNCCYPVDTVEMSDIEWIARILW 220
                  + ++S N  Y        ++  I RI W
Sbjct: 183 PNHDPPKVRVISDNTFYTPYERTADEVNIIGRIRW 217


>gi|212715543|ref|ZP_03323671.1| hypothetical protein BIFCAT_00441 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660910|gb|EEB21485.1| hypothetical protein BIFCAT_00441 [Bifidobacterium catenulatum DSM
           16992]
          Length = 237

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 66/219 (30%), Gaps = 16/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +K+  AI +        PS   +   AGL  P+S  ++ +    +G  R  + +     
Sbjct: 24  QRKVLGAIKKHLAEQGFAPSFREIGEAAGLKSPSSVKHQLQVLDEKGFIRMNANKGRAIE 83

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           + + ++T             +       I      P          +    +  + + +P
Sbjct: 84  VVSFDDTSSSSKATQVIPFPSQSDSSGSIMASRDVPLVGRIAAGVPITAEQHVDDVMRLP 143

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E  +               +    SM+      GD +++        GD +       + 
Sbjct: 144 ERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQNTAENGDIVAALLD-DEA 195

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y     + +  E + +++
Sbjct: 196 TVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 231


>gi|16764259|ref|NP_459874.1| transcriptional regulator [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|169257171|ref|YP_001700549.1| putative transcriptional regulator (repressor) [Salmonella phage
           Fels-1]
 gi|16419406|gb|AAL19833.1| predicted Fels-1 prophage transcriptional regulator [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
          Length = 231

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 73/218 (33%), Gaps = 16/218 (7%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           K+ + I  + +   +T + LA     D  + ++ +R          S +SI KI  A   
Sbjct: 4   KVGQKIRELRKARKMTITQLAALTDWDVGNISRLERGMQGY-----SAQSIQKIAEALQV 58

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
            + +L     +D  T  K                          GN  ++    E+ S  
Sbjct: 59  PVSELFS-TETDSDTVNKYSVLSLSHQRRNDVYRVDVMDVSASAGNGNSSRDFIEVISSI 117

Query: 128 NGIYAIQTQDTRHK---------TQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
             +         H+          +  SM      GD++ ++  +    GD + +   +G
Sbjct: 118 EYVTEEAKTLFGHRPANQVKLINVRGDSMQGTIEPGDLIFVDIGVNYFDGDGIYVFDFSG 177

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
           D+  K L   + + + L S N  Y    +   ++E + 
Sbjct: 178 DLYVKRLQKIKSQLLVL-SDNPLYKEWQITKEEMEMLH 214


>gi|192291621|ref|YP_001992226.1| LexA repressor [Rhodopseudomonas palustris TIE-1]
 gi|47605802|sp|P61614|LEXA_RHOPA RecName: Full=LexA repressor
 gi|229621744|sp|B3Q6P2|LEXA_RHOPT RecName: Full=LexA repressor
 gi|192285370|gb|ACF01751.1| transcriptional repressor, LexA family [Rhodopseudomonas palustris
           TIE-1]
          Length = 236

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 58/231 (25%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGI-----------EGR 49
           M +    ++ + I+   +   + PS    K  LD  S +   R                R
Sbjct: 1   MLTRKQFELLKFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 50  NRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVF 109
            R      +         +                +     P       GS      G  
Sbjct: 61  ARAIEVIKLPDTGGMPGNSRRGFTPSVIEGNLGKVRPPSPTPAEDDHDRGSVAVPVMGRI 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +                 +    + +  SM       GD+ ++      + G
Sbjct: 121 AAGTPIEALQSRSHTISVPADMLGSGEHYALEVRGDSMVEAGILDGDMALIQKNDVADTG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 DIVVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 230


>gi|330810754|ref|YP_004355216.1| phage regulatory protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378862|gb|AEA70212.1| Putative phage regulatory protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 232

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 71/231 (30%), Gaps = 23/231 (9%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M++       E I    +   LT   LA K G++    ++ +          P      K
Sbjct: 13  MSTL-----AERIKEARKHAVLTQKALALKVGVEQPVISQLETGKNLQSAHLP------K 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG- 119
           I          L D       +  ++           S             G     V  
Sbjct: 62  IAHVCGVNAIWLSDNIGPMIDSHREESNVSTAPQLKQSFRYPVI--SWVAAGAWSEAVEP 119

Query: 120 VPEIRSPHNGI--YAIQTQDTRHKTQDTSML----PLYRKGDILILNSAIQVNCGDRLL- 172
            P   S       Y  +      + +  SM         +G ++++++ ++   G  ++ 
Sbjct: 120 YPAGFSDRYEFSEYDSKGPAFWLEVKGDSMTSPVGTSIAQGSLILVDTEVEAAPGKLVVA 179

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             P + +   K L+S  G  + L  LN  Y ++     D   +  ++ A+Q
Sbjct: 180 KLPDSNEATFKKLVSD-GGKLFLKPLNPAYRIEEFT-EDCRIVGVVVQATQ 228


>gi|315268697|gb|ADT95550.1| transcriptional regulator, XRE family [Shewanella baltica OS678]
          Length = 235

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 65/223 (29%), Gaps = 33/223 (14%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +    +   +T S LA K G+   +          G  R PS E I  ++         L
Sbjct: 23  VKTRMKEAGVTQSMLAEKMGMSQGAIAHWL-----GGKRKPSIEDIASMMNIVGIRHMTL 77

Query: 73  LDLPFSDGRTT-----------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                 D   +                  P++ +  +G+         P           
Sbjct: 78  GADGLIDYPDSVLGNTEELPAKISYVNSFPVISYVQAGAWTEAVESC-PASALDEWQDTT 136

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPR 176
           E  S               + Q  SM       + +G ++++++      G  ++     
Sbjct: 137 ERTSE---------NCFWLRVQGDSMTTPAGISFPEGTLILIDAEKDYQNGSFVVAKLTD 187

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K L+   G+   L  LN  YP   +  +  + I  ++
Sbjct: 188 INEATFKKLVIDAGQKF-LRPLNTAYPTLPINGN-CKIIGVVV 228


>gi|296116167|ref|ZP_06834785.1| LexA repressor [Gluconacetobacter hansenii ATCC 23769]
 gi|295977273|gb|EFG84033.1| LexA repressor [Gluconacetobacter hansenii ATCC 23769]
          Length = 235

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/229 (12%), Positives = 67/229 (29%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++   IDR  ++   +PS   +    GL   +  ++      +R  +  ++  
Sbjct: 1   MLTRKQHELLLYIDRHLKQTGFSPSFDEMKDALGLRSKSGIHRLISALEERGFVRRKHHR 60

Query: 53  PSTESIFKI--LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
                + +I  + A      + +D+        +       +     + +      G   
Sbjct: 61  ARALEVVQIPQIEAVEPASARGVDMFSPTVIKGDFTPALPAVQVADTANAVQVPFLGRIA 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G+    +                      +    SM       GD +I+    Q   G+
Sbjct: 121 AGHAIEAISDASRLIDVPAGLIGVGTYYALEVCGDSMIEAGILDGDTVIVRQDRQAENGE 180

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            ++      ++  K L  + G +I L   N  Y    +    +     I
Sbjct: 181 IVVALIEGQEVTLKRLRRK-GSTIALEPANARYETRIMPADKVAIQGSI 228


>gi|158313084|ref|YP_001505592.1| LexA repressor [Frankia sp. EAN1pec]
 gi|229621220|sp|A8L6K4|LEXA_FRASN RecName: Full=LexA repressor
 gi|158108489|gb|ABW10686.1| SOS-response transcriptional repressor, LexA [Frankia sp. EAN1pec]
          Length = 250

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 63/222 (28%), Gaps = 19/222 (8%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIFK 60
            KK+ E I    ER    PS   +    GL  TS   ++ K    +G   R P+     +
Sbjct: 34  QKKVLEVIRSAVERRGYPPSVREIGEAVGLTSTSSVAHQLKVLQEKGFLRRDPNRPRAME 93

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEK--EIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
           +L               +       +    E     + P          +       +  
Sbjct: 94  VLPIGGAKTGGRSRAGAAAAAGAPAETTALEAGTPTYVPLVGRIAAGGPILAEQAIEDVY 153

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRT 177
            +P+           +      K    SM+      GD +++      + G+ +      
Sbjct: 154 PLPKEIVG-------EGTLFLLKVVGQSMINAAICDGDFVVVRQQPVADNGEIVAAMID- 205

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           G+   K    +R   + L   N  +        D   + RI+
Sbjct: 206 GEATVKRF-RQRDGRVWLAPENPAFSDI--PAEDATILGRIV 244


>gi|312870855|ref|ZP_07730960.1| peptidase S24-like protein [Lactobacillus iners LEAF 3008A-a]
 gi|312872164|ref|ZP_07732237.1| peptidase S24-like protein [Lactobacillus iners LEAF 2062A-h1]
 gi|311092248|gb|EFQ50619.1| peptidase S24-like protein [Lactobacillus iners LEAF 2062A-h1]
 gi|311093545|gb|EFQ51884.1| peptidase S24-like protein [Lactobacillus iners LEAF 3008A-a]
          Length = 222

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 72/229 (31%), Gaps = 20/229 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             ++++I + ++R+     ++   ++RK  +  +S ++        R R    + + +  
Sbjct: 1   MRNNEEIMQLLERLKADKKMSLREISRKTDIAVSSISRYFN-----RTRDFPLDKLDRFA 55

Query: 63  AATNETICQLLDLPFSDGRTTE----KKEKEIPLLYFPPSGSGGFFDS-------GVFPT 111
            A N +   +L++      TT      ++++  +  +         +        G    
Sbjct: 56  KAFNVSPEYILNVSKPCDITTIYNQLHEKRKAKVYNYAKEQLDEQLNEKRSIYVVGTSAA 115

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G               +        D     +  SM P      I+  +    +  G+  
Sbjct: 116 GEPIEYGDFDSEMIQTD---VPAKADKAIHIKGDSMEPKIANNSIIFYHEQPTLEIGEIG 172

Query: 172 LIKPRTGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + +     +  K        + I L S+N  Y         +  + +++
Sbjct: 173 IFEINGSAVTCKKYYVDYESKKIILKSINPKYEPMYFARDQVRILGKVV 221


>gi|323177107|gb|EFZ62697.1| repressor protein CI [Escherichia coli 1180]
          Length = 217

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 59/214 (27%), Gaps = 15/214 (7%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS + I  +            
Sbjct: 8   RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLDEIGVVFKYLGIDNVSFN 62

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNG 129
                                +P                F  G+    V   +  S    
Sbjct: 63  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAF 122

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
              ++       T      P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 123 WLEVEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   L  LN  YP+          + +++ ASQ
Sbjct: 180 GQVF-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 210


>gi|331669090|ref|ZP_08369938.1| repressor protein CI [Escherichia coli TA271]
 gi|331064284|gb|EGI36195.1| repressor protein CI [Escherichia coli TA271]
          Length = 244

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 59/214 (27%), Gaps = 15/214 (7%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS + I  +            
Sbjct: 35  RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLDEIGVVFKYLGIDNVSFN 89

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNG 129
                                +P                F  G+    V   +  S    
Sbjct: 90  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAF 149

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
              ++       T      P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 150 WLEVEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 206

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   L  LN  YP+          + +++ ASQ
Sbjct: 207 GQVF-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 237


>gi|281599669|gb|ADA72653.1| CI protein [Shigella flexneri 2002017]
          Length = 231

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 59/214 (27%), Gaps = 15/214 (7%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS + I  +            
Sbjct: 22  RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLDEIGVVFKYLGIDNVSFN 76

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNG 129
                                +P                F  G+    V   +  S    
Sbjct: 77  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAF 136

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
              ++       T      P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 137 WLEVEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 193

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   L  LN  YP+          + +++ ASQ
Sbjct: 194 GQVF-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 224


>gi|297191630|ref|ZP_06909028.1| LexA repressor [Streptomyces pristinaespiralis ATCC 25486]
 gi|197719371|gb|EDY63279.1| LexA repressor [Streptomyces pristinaespiralis ATCC 25486]
          Length = 261

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 60  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 109

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               +        P   + P          +    +  +   +P
Sbjct: 110 --RDPHRPRAYEVRGSDQPSSQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 167

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 168 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 219

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 220 TVKRFKR-ENGHVWLLPHNAAYQPI--PGDEATILGKVV 255


>gi|238063472|ref|ZP_04608181.1| lexA family transcriptional repressor [Micromonospora sp. ATCC
           39149]
 gi|237885283|gb|EEP74111.1| lexA family transcriptional repressor [Micromonospora sp. ATCC
           39149]
          Length = 260

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 63/219 (28%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAG-LDPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            ++I E I    ERH   PS   +    G + P+S   + K    +G  R          
Sbjct: 59  QRRILEFIRTWVERHGYPPSVREIGEAVGLVSPSSVAYQLKELEKKGFLR---------- 108

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                     +     ++    E    + P   + P          +       +   +P
Sbjct: 109 --RDPNRPRAVDVRSPNETLDDEASRSQRPAPAYVPMLGRIAAGGPILAEQAVEDVFPLP 166

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    + +  SML      GD +++      + GD +      G+ 
Sbjct: 167 RELVG-------EGEVFMLQVKGDSMLDAAICDGDWVVVRQQPTADAGDIVAAMLD-GEA 218

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + LM  N  +        D   + R++
Sbjct: 219 TVKTYRRR-DGHVWLMPQNPAFDPI--PGDDATIMGRVV 254


>gi|317051151|ref|YP_004112267.1| peptidase S24/S26A/S26B [Desulfurispirillum indicum S5]
 gi|316946235|gb|ADU65711.1| Peptidase S24/S26A/S26B, conserved region [Desulfurispirillum
           indicum S5]
          Length = 218

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 82/228 (35%), Gaps = 19/228 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           M SFS  K+WE I R+       T + LA    +   S + +K+ G      W  T  I 
Sbjct: 1   MDSFS--KVWERIQRV---TGWKTQAELASALDIRQASVSGAKQRGSMP-LEWIYT--IA 52

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +    + + +    D+         ++   +P      + S    D+      +      
Sbjct: 53  RKYNTSMDWLLNGEDVSPGFSGENSQQHISLPKYSVVHAQSPEKCDASKLQASH------ 106

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           +   +     +   +      +    SM P    GDIL+++   Q    D + I    G+
Sbjct: 107 LTFCQDWLQTMGLDKEALILVEVCGDSMEPTIYAGDILLVDQRFQKVGNDGIYILRLHGE 166

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEM---SDIEWIARILW-ASQ 223
           +V K +      S+ +MS N  Y   T+       +  +  ++W ASQ
Sbjct: 167 LVVKRVQRLIDGSLRIMSDNKAYMDQTISAELSEQVCVVGFVVWRASQ 214


>gi|149915248|ref|ZP_01903776.1| putative transcriptional regulator, repressor [Roseobacter sp.
           AzwK-3b]
 gi|149810969|gb|EDM70808.1| putative transcriptional regulator, repressor [Roseobacter sp.
           AzwK-3b]
          Length = 220

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/208 (20%), Positives = 77/208 (37%), Gaps = 8/208 (3%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            ER N++ + +ARKAG+   +    KR    G+ +  S E   KI  A    +  +L   
Sbjct: 14  LERQNVSVAEIARKAGVPYDAVRDIKR----GKVQSTSWERAVKIAQALGIVLEDVLPAT 69

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQ 136
               +  E    ++  +           D  V        ++  P          A    
Sbjct: 70  SKTEQVREAASSDLQAMVSVYDVHASAGDGAVVIHEEPIGSLAFPANYLR-QLTQANWRD 128

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI-VAKVLISRR-GRSID 194
                 +  SMLP     D+++L+ + +    D L +    G+  + K +        + 
Sbjct: 129 LAIISVKGDSMLPTLADDDVVMLDRSKRDLSYDGLFVIRDNGEALLVKRIQRAPTPGHVI 188

Query: 195 LMSLNCC-YPVDTVEMSDIEWIARILWA 221
           ++S N   Y     ++SD+E I R++WA
Sbjct: 189 IISDNRALYDPVEKKLSDMEVIGRVIWA 216


>gi|160875227|ref|YP_001554543.1| putative phage repressor [Shewanella baltica OS195]
 gi|160860749|gb|ABX49283.1| putative phage repressor [Shewanella baltica OS195]
 gi|315267420|gb|ADT94273.1| putative phage repressor [Shewanella baltica OS678]
          Length = 247

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 63/213 (29%), Gaps = 21/213 (9%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           +    A K G+   +     + G       P  ++  +I      +I  L          
Sbjct: 35  SIREFAIKIGVSEGTLRNLIKGG------EPKLDTAIRIAEEAGVSIRWLATGNGPKYPN 88

Query: 83  TEKKEKEIPLLYFPPSGSG------GFFDSGVFPTGNKWNTVG------VPEIRSPHNGI 130
            ++ +     + +                  V  TG+            +P  ++     
Sbjct: 89  RQRDDISQEGIVYVHQDQFNEEYFLIEGYDVVVSTGHGAFNDETGVRRRLPFRKNWLKYR 148

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
                       +  SM P    GD L+++ +        + +     D+ AK L     
Sbjct: 149 SLKPENLKVVYAKGNSMEPAIHSGDSLLVDISKTTLEDGCIFVLRLGDDLYAKRLQKLFD 208

Query: 191 RSIDLMSLNCCYPVDTVEMSD---IEWIARILW 220
             I+++S N  Y    V   +   ++ I +++W
Sbjct: 209 GGIEILSDNKEYKSQIVSAGELPMLQIIGKVVW 241


>gi|308235568|ref|ZP_07666305.1| LexA repressor [Gardnerella vaginalis ATCC 14018]
 gi|311114343|ref|YP_003985564.1| repressor lexA [Gardnerella vaginalis ATCC 14019]
 gi|310945837|gb|ADP38541.1| repressor lexA [Gardnerella vaginalis ATCC 14019]
          Length = 239

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 62/219 (28%), Gaps = 13/219 (5%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            +KI +AI    E H   PS   +    GL  P+S  ++ +   ++G  R     S  K 
Sbjct: 23  QRKIMDAIQNCLEEHGFPPSFREIGEAVGLRSPSSVKHQLRALEMKGLIRI----SANKG 78

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
            A          +   +    T+               S      G    G         
Sbjct: 79  RAIEVIGDFLKKNKEKAHTLITKSAVDVSIYNNDSLIHSHDVPLVGRIAAGTPITAEQHV 138

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           E                  +    SM+      GD +++    +   GD +       + 
Sbjct: 139 EDVMRLPERLTGSGNLFMLEVHGDSMIDAAICDGDYVVVREQNEATNGDIVAALLD-NEA 197

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + LM  N  Y     + S  + + +++
Sbjct: 198 TVKTF-RKDNGHVWLMPHNPAYSPI--DGSHAKIMGKVV 233


>gi|163746569|ref|ZP_02153927.1| LexA repressor [Oceanibulbus indolifex HEL-45]
 gi|161380454|gb|EDQ04865.1| LexA repressor [Oceanibulbus indolifex HEL-45]
          Length = 231

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 64/229 (27%), Gaps = 14/229 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     +   I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLAFIHQRVQRDGVPPSFDEMKLALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  +          +   D   +       P+       +      G    G
Sbjct: 61  ARAIEVVKLPESLGGAPGFAPRVIDGDRPDSPPPHSAQPV---TAQHAFDVPVMGRIAAG 117

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +          G   A Q +    + +  SM       GDI+++      + GD 
Sbjct: 118 VPIEAISQVSHTVTVPGGMIAGQGEHYALEVRGDSMIEAGINDGDIVVIRETSVADNGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    +   S+ L + N  Y    +    ++   R++
Sbjct: 178 VVALVEDQEATLKRFRRQGA-SVALEAANAAYETRVLPSDKVKVQGRLV 225


>gi|307307842|ref|ZP_07587570.1| putative phage repressor [Shewanella baltica BA175]
 gi|306910061|gb|EFN40499.1| putative phage repressor [Shewanella baltica BA175]
          Length = 217

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 72/218 (33%), Gaps = 12/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            K+   I    +   L    +A+   +   + +  +R         PS E + K+     
Sbjct: 5   DKLSNRIKTKRKILGLKQKDVAKLMDVTSQAISSWEREVTN-----PSGELLLKLANVLK 59

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                LL          +   +++  L +  S +      G       ++   VP+    
Sbjct: 60  VNEGWLLYGDTFKNDKIKDCGEKVTFLRYYQSVNASAGH-GCLNENETYSEYPVPKSVVD 118

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                  + +    + +  SM P+ + G IL +N          L +     ++  K+L 
Sbjct: 119 KQF---DKDKLFCIECRGDSMEPVLKSGSILAVNPCQTRIDDGGLYVVKLGSELRVKIL- 174

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE--WIARILWAS 222
           S     I L S N  Y  +TV+  D+      ++ W S
Sbjct: 175 SLSNEGITLKSFNKQYLDETVKQGDVRFSVEGKVFWFS 212


>gi|160873045|ref|YP_001557051.1| putative phage repressor [Shewanella baltica OS195]
 gi|160858567|gb|ABX51791.1| putative phage repressor [Shewanella baltica OS195]
          Length = 214

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 72/218 (33%), Gaps = 12/218 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            K+   I    +   L    +A+   +   + +  +R         PS E + K+     
Sbjct: 2   DKLSNRIKTKRKILGLKQKDVAKLMDVTSQAISSWEREVTN-----PSGELLLKLANVLK 56

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                LL          +   +++  L +  S +      G       ++   VP+    
Sbjct: 57  VNEGWLLYGDTFKNDKIKDCGEKVTFLRYYQSVNASAGH-GCLNENETYSEYPVPKSVVD 115

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
                  + +    + +  SM P+ + G IL +N          L +     ++  K+L 
Sbjct: 116 KQF---DKDKLFCIECRGDSMEPVLKSGSILAVNPCQTRIDDGGLYVVKLGSELRVKIL- 171

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIE--WIARILWAS 222
           S     I L S N  Y  +TV+  D+      ++ W S
Sbjct: 172 SLSNEGITLKSFNKQYLDETVKQGDVRFSVEGKVFWFS 209


>gi|91211688|ref|YP_541674.1| repressor protein [Escherichia coli UTI89]
 gi|117624572|ref|YP_853485.1| putative phage repressor protein [Escherichia coli APEC O1]
 gi|218559304|ref|YP_002392217.1| Repressor protein CII [Escherichia coli S88]
 gi|218695990|ref|YP_002403657.1| Repressor protein CII [Escherichia coli 55989]
 gi|91073262|gb|ABE08143.1| repressor protein [Escherichia coli UTI89]
 gi|115513696|gb|ABJ01771.1| putative phage repressor protein [Escherichia coli APEC O1]
 gi|148566149|gb|ABQ88424.1| prophage repressor [Enterobacteria phage CUS-3]
 gi|218352722|emb|CAU98505.1| Repressor protein CII [Escherichia coli 55989]
 gi|218366073|emb|CAR03818.1| Repressor protein CII [Escherichia coli S88]
 gi|294490247|gb|ADE89003.1| repressor protein C2 [Escherichia coli IHE3034]
 gi|307626074|gb|ADN70378.1| Repressor protein CII [Escherichia coli UM146]
 gi|312945519|gb|ADR26346.1| Repressor protein CII [Escherichia coli O83:H1 str. NRG 857C]
 gi|323948802|gb|EGB44701.1| peptidase S24 [Escherichia coli H252]
 gi|324117735|gb|EGC11634.1| peptidase S24 [Escherichia coli E1167]
          Length = 216

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 67/219 (30%), Gaps = 26/219 (11%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 7   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALANALKCSP 61

Query: 70  CQLLDLPF----SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             L+            +        PL+ +  +G                N        S
Sbjct: 62  DYLMKGEESLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHK-RAIDNWYDTTVDCS 120

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
                            +  SM         +G I++++  ++   G  ++       + 
Sbjct: 121 E---------DSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENEA 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 172 TFKKLVIDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|126726370|ref|ZP_01742211.1| LexA repressor [Rhodobacterales bacterium HTCC2150]
 gi|126704233|gb|EBA03325.1| LexA repressor [Rhodobacterales bacterium HTCC2150]
          Length = 232

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 66/227 (29%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-----ST 55
           M +     +   I++  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLNFINQRMQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 56  ESIFKILAATNETICQ-LLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
               +I+                      ++ E     L   P  +      G    G+ 
Sbjct: 61  ARAIEIVKLPGAIDEDAPKGGFKPRVIEGDRPETPPAALDVEPINARDISILGRIAAGDP 120

Query: 115 WNTVGV-PEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
              +   P+  +    +          + +  SM+      GDI+++      + GD ++
Sbjct: 121 IEALDHGPQNVAVPGHMMEKGGNHYALEVKGDSMIDAGINNGDIVVIREQNTADNGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                     K L+ +    I L + N  Y    +  + +    R++
Sbjct: 181 ALIEGETATLKRLMRK-NGMIALEAANPAYETRFLPDNQVAVQGRLV 226


>gi|238790799|ref|ZP_04634557.1| hypothetical protein yfred0001_12660 [Yersinia frederiksenii ATCC
           33641]
 gi|238721114|gb|EEQ12796.1| hypothetical protein yfred0001_12660 [Yersinia frederiksenii ATCC
           33641]
          Length = 234

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/236 (14%), Positives = 76/236 (32%), Gaps = 31/236 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +  + +I   I R+  + +LT   LA+  G+   S  K +    +     P  E++ +
Sbjct: 15  MKTEMNDRI--RIRRL--QLDLTQVQLAKAIGVSRVSVTKWESGITK-----PDGENLHR 65

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKE----IPLLYFPPSGSGGFFDSGVFPTGNKWN 116
           +    + T   LL       +  + K K        +    S   G +            
Sbjct: 66  LAQVLSCTPEWLLYGTGDLRQVDDTKIKPLTAVPNAIPVISSVQAGTWTDTYSAA----- 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNS---AIQVNCG 168
              + ++         +         +  SM      P   +G  +I+     +I+   G
Sbjct: 121 --RISDVLRWCTTTVKVSENAFALDVRGESMTNPNGSPSIPEGSTVIVEPNYGSIEDLYG 178

Query: 169 DRLLIKPR-TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             ++     + +   K L+        LM LN  +    +  +    + R++  +Q
Sbjct: 179 KIVVAIIDGSSEATIKKLVVDGPNKY-LMPLNPNFRPIEINGN-CRILGRVVQVTQ 232


>gi|239928525|ref|ZP_04685478.1| LexA repressor [Streptomyces ghanaensis ATCC 14672]
 gi|291436850|ref|ZP_06576240.1| LexA repressor [Streptomyces ghanaensis ATCC 14672]
 gi|291339745|gb|EFE66701.1| LexA repressor [Streptomyces ghanaensis ATCC 14672]
          Length = 259

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQAAPVQPADTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-ENGHVWLLPHNAAYEPI--PGDDATILGKVV 253


>gi|288958447|ref|YP_003448788.1| repressor [Azospirillum sp. B510]
 gi|288910755|dbj|BAI72244.1| repressor [Azospirillum sp. B510]
          Length = 240

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/235 (10%), Positives = 58/235 (24%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-FNKS-----KRFGIEGRNRW 52
           M +    ++   I     +  ++PS   +    GL   S  ++      +R  I      
Sbjct: 1   MLTRKQHELLLFIHERLGQGGVSPSFDEMKDALGLKSKSGIHRLITGLEERGFIRRLPHR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG----- 107
                + ++    +    +    P                   PP+ +    +       
Sbjct: 61  ARALEVLRLPEGLDAARSRAAVKPKFQPNVIRGDFAFASRDAAPPAPAPASANETVQLPL 120

Query: 108 --VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQ 164
                 G     +                      +    SM        D +I+     
Sbjct: 121 YGRIAAGTPIEALRDNSAFVDIPASMLSTGDHYALEVSGDSMVEAGILDHDTIIIQRCDS 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              G  ++     G++  K L  + G ++ L   N  Y         +    +++
Sbjct: 181 AENGTIVVALVDEGEVTLKRLRRK-GNTVALEPANAAYETRIFGADRVRVQGKLV 234


>gi|194099008|ref|YP_002002081.1| putative CI protein [Neisseria gonorrhoeae NCCP11945]
 gi|304386577|ref|ZP_07368865.1| S24 family peptidase [Neisseria meningitidis ATCC 13091]
 gi|193934298|gb|ACF30122.1| putative CI protein [Neisseria gonorrhoeae NCCP11945]
 gi|304339406|gb|EFM05478.1| S24 family peptidase [Neisseria meningitidis ATCC 13091]
          Length = 232

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 66/230 (28%), Gaps = 23/230 (10%)

Query: 11  EAIDRM-AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  + A+R N   +  +R     P   N+          R        +I  A     
Sbjct: 5   DRIKNLIADRFNGNQAEFSRAINKAPAQINQWLNGY-----RNIGDGVAAQIETALGLPR 59

Query: 70  CQLLDLPFSDGRTTEKKEKEIPL----------LYFPPSGSGGFFDSGVFPTGNKW-NTV 118
             +      +      K     +                    F+       GN + + +
Sbjct: 60  GWVDGKDEPNIPIDSIKSNATVIGTVDAWDSKTPLSDDDCEVPFYKDVCLSAGNGFSDEI 119

Query: 119 G------VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLL 172
                  +   +S                    SM P++  G  L +N+A ++    ++ 
Sbjct: 120 EDYNGYKLRFSKSTLRRHGISPDDVVCVSADGDSMEPVFPDGATLGINTADKMIKDGKIY 179

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
               +G +  K+L       + + S N  Y  +T  +  +  I R+ W S
Sbjct: 180 AINHSGLLRTKILQKLPDNQVRIKSYNPEYKDETASLDSLTVIGRVFWWS 229


>gi|92118814|ref|YP_578543.1| putative phage repressor [Nitrobacter hamburgensis X14]
 gi|91801708|gb|ABE64083.1| putative phage repressor [Nitrobacter hamburgensis X14]
          Length = 240

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 70/237 (29%), Gaps = 22/237 (9%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFG-IEGRNRWPSTESIF 59
           M     K I   I+   E     P+  +R AGL P +    +R    E + +  S +++ 
Sbjct: 1   MDDL--KTIVARIEARLEEMGTNPAAASRAAGLSPGAIRNLQRGAKGEIKLKGASGKTLS 58

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG--------VFPT 111
            +       +  L+      G+    +           + +                   
Sbjct: 59  ALAEYLQVPLDWLMSGSGEPGKPQVIRPAGPERSTVVDAPNAPRLSEFGDFDVEVRGISV 118

Query: 112 GNKWNTVGVPE---IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
           G   +                                SM+P Y  G+ + +  A  V  G
Sbjct: 119 GGGDDEFYFNGDVIDHLRRPPGILRAKNVFALNVAGDSMMPRYEPGEPIYVQRANPVI-G 177

Query: 169 DRLLIKPRT------GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++++         G    K L+ R GR +    LN        +  +++ I R+L
Sbjct: 178 DYVVVELYPEIEGQAGKSFLKKLVRRTGRRVTCSQLNP-PKELEFDTGEVKEIYRVL 233


>gi|327393407|dbj|BAK10829.1| putative transcriptional regulator from phage origin [Pantoea
           ananatis AJ13355]
          Length = 230

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 70/227 (30%), Gaps = 17/227 (7%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   I  + +   +    LA   G+D  + ++ +     G+ +  + +SI KI  A   
Sbjct: 2   NIGNKIRSLRKARGMKIEELAEAVGVDGANISRLE----TGKQKSFTEQSINKIAKALKV 57

Query: 68  T--------ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
                      +      S     ++      +     S S G          +  +++ 
Sbjct: 58  DVSELFATGTAEPTVYNDSRNVQEQEPNAMYRVEVLDVSASAGPGTYVSGDVIDVIHSIE 117

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
                +         +       +  SM      GD++ ++ +I    GD + +      
Sbjct: 118 YVSEHAKTIFGGRPASSIKMINVRGDSMAGTIEPGDLVFVDVSIHSVDGDGIYVFGFDEK 177

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
           I  K L S   + + L S N  Y    ++           +++  SQ
Sbjct: 178 IHIKRLQSVPDKLLVL-SDNPQYKEWHIDRDNEHRFYVFGKVM-ISQ 222


>gi|288934642|ref|YP_003438701.1| XRE family transcriptional regulator [Klebsiella variicola At-22]
 gi|288889351|gb|ADC57669.1| transcriptional regulator, XRE family [Klebsiella variicola At-22]
          Length = 220

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/214 (14%), Positives = 65/214 (30%), Gaps = 19/214 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
             + +R  ++   LA   GL   + +           R PS + I KI+A       ++ 
Sbjct: 10  KDLMKRRGISQETLAEHLGLTKGAVSHWLNA-----RREPSLQDIAKIMAYLGLQGFEVN 64

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG---VPEIRSPHNGI 130
                  +            + P   +G +        G+    V       I    +  
Sbjct: 65  KDGSIRDK----SPASNISYHGPNVTTGTYPVLSWVSAGDWMEAVEPYHRRSIERWLDTN 120

Query: 131 YAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVAKVL 185
                       +  SM         +G +++++  ++   G  ++       +   K L
Sbjct: 121 VECSDSSFWLDVKGDSMTSPVGLSIPEGMVILVDPEVEPRNGKLVVAKLDNENEATFKKL 180

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   G    L  LN  YP+  +  +  + I  ++
Sbjct: 181 VIDAGSKF-LKPLNPQYPMIPINGN-CQIIGVVV 212


>gi|196248582|ref|ZP_03147283.1| transcriptional repressor, LexA family [Geobacillus sp. G11MC16]
 gi|196212307|gb|EDY07065.1| transcriptional repressor, LexA family [Geobacillus sp. G11MC16]
          Length = 207

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 69/227 (30%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I E I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILEFIKQEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                   +   KE+E   +   P          +    N
Sbjct: 61  TKPRAIEILD------------------SDLTKEREKEEVISVPMIGKVTAGQPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P+  +      A + Q    +    SM       GD +I+      N GD ++
Sbjct: 103 IEDYFPLPKRLA------AGEEQLFMLEVMGDSMIEAGILDGDYVIVRQQSSANNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEENEATVKRFFKEKD-HIRLQPENVHLEPIIVR--DCTILGKVI 200


>gi|148358304|ref|YP_001249511.1| phage repressor [Legionella pneumophila str. Corby]
 gi|296105654|ref|YP_003617354.1| hypothetical protein lpa_00219 [Legionella pneumophila 2300/99
           Alcoy]
 gi|148280077|gb|ABQ54165.1| phage repressor [Legionella pneumophila str. Corby]
 gi|295647555|gb|ADG23402.1| hypothetical protein lpa_00219 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 219

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 77/217 (35%), Gaps = 12/217 (5%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           K+I + I    +   LT   L    G L  T     ++       R P  E I  +  A 
Sbjct: 5   KEIGKRIFEARKEKGLTLKELGELTGGLKQTRLTNWEQGT-----RAPGPEEIKLLAQAL 59

Query: 66  NETI-CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
           + +    +        + T+     IPLL    +     F   +   G+  + V +    
Sbjct: 60  DVSPAFLMCLSDDQQVKRTKSYSHLIPLLDHHQACDAKSFIEAISDQGSAGDVVWISVSA 119

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAK 183
           +    I  + ++    K  D SM+P  R  D+L++  ++    GD  ++      + +  
Sbjct: 120 T---LIQELSSEAFALKMPDESMMPELRLNDVLVVEPSVTPCPGDFVVVKLANKLEAIVC 176

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
                     +L++LN  +P         IE I +I+
Sbjct: 177 QYRETTYTEFELVTLNDNWPNIKNTKEFRIEIIGKII 213


>gi|329889326|ref|ZP_08267669.1| lexA repressor [Brevundimonas diminuta ATCC 11568]
 gi|328844627|gb|EGF94191.1| lexA repressor [Brevundimonas diminuta ATCC 11568]
          Length = 234

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/228 (14%), Positives = 63/228 (27%), Gaps = 10/228 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I        ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQHELLMFIHERIRETGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP------TG 112
            + L             P       +    +   L   P+ +    D    P       G
Sbjct: 61  ARALEVVKLPEQATTAAPAKGRAPFKPDVIQGGGLNPRPAVAEAANDVRDLPLLGKIAAG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
                +     R P         +    + +  SM       GD +I+      + G+ +
Sbjct: 121 TPIAAIQHERERLPVPEAMLGAGEHYLLEIEGDSMIEAGILDGDTVIIKRVENASSGEIV 180

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K L  ++G+SI L   N  Y         +E   +++
Sbjct: 181 VALVEGEEATLKRL-RKKGQSIALEPANSAYETRIFGPDQVEVQGKLV 227


>gi|317050991|ref|YP_004112107.1| CI repressor [Desulfurispirillum indicum S5]
 gi|316946075|gb|ADU65551.1| CI repressor [Desulfurispirillum indicum S5]
          Length = 224

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 76/221 (34%), Gaps = 19/221 (8%)

Query: 10  WEAIDRMAERHNLT-PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           W  I ++     L+  + LA   G++P S + +K+ G      +   E + KI      +
Sbjct: 8   WSRIQQL---TGLSTQAELADALGINPASVSGAKKRG------FFPLEWMLKIALDYQVS 58

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +  L+ +            +           S    +       +  +   +  + SPH+
Sbjct: 59  MDALIGISEHGQMVGVSAFQAKTAAILSGKPSREENELLYEYEHSPIDDRTLETVVSPHS 118

Query: 129 GIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
               +Q            +    SM P  RKGD+++++ +      + + +     +++ 
Sbjct: 119 KDQLLQAIGFSTETMAIVRAHCDSMEPTIRKGDLMVVDRSCTAIETNGIYVFQAKQNLII 178

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDI---EWIARILW 220
           K +       +   S N  YP + V    +   +    ++W
Sbjct: 179 KRVELLLNGFLRFFSDNPAYPSERVHPEQLSAEDIFGLVVW 219


>gi|331648293|ref|ZP_08349382.1| transciptional regulator [Escherichia coli M605]
 gi|331042842|gb|EGI14983.1| transciptional regulator [Escherichia coli M605]
          Length = 230

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 74/232 (31%), Gaps = 24/232 (10%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I + I       +LT   LA++ GL   + ++ +          P+ +++  +  A N +
Sbjct: 2   INDRIREARRNVHLTQDALAKRIGLTKATISQWESGNTT-----PNGKNLINLAEALNVS 56

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN-------TVGVP 121
              LL    SD +      +         S +    D    P   +          V + 
Sbjct: 57  PEWLLSGKTSDTKEIHSNAQVEGGFSVWDSSTPLEDDEVEIPFYQEIELSAGNGTYVDID 116

Query: 122 EIRSPHNGIYAIQTQ-------DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
            +        +   +                SM P+   G ++ ++++       ++   
Sbjct: 117 RMGCKLRFARSTLRKAGVDVNCAACVSIHGNSMEPVLPDGAVVGIDTSKTGVKDGQMYAI 176

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTV---EMSDIEWIARILWAS 222
            + G +  K+L       + + S N   Y  +     E + I  I ++ W S
Sbjct: 177 DQDGLLRVKLLYRLPSG-LRIRSFNRDEYADEEYFNQEANKIRIIGQVFWYS 227


>gi|258654104|ref|YP_003203260.1| SOS-response transcriptional repressor, LexA [Nakamurella
           multipartita DSM 44233]
 gi|258557329|gb|ACV80271.1| SOS-response transcriptional repressor, LexA [Nakamurella
           multipartita DSM 44233]
          Length = 252

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 62/221 (28%), Gaps = 25/221 (11%)

Query: 2   TSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF 59
           T   HK I + I    ER    PS   +   AGL   S    +   +E R          
Sbjct: 48  TMRQHK-ILQVIRDSVERRGYPPSVREIGDAAGLKSPSSVAHQLKVLEKRG--------- 97

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            +L         +   P  D     +    +P   + P          +       +   
Sbjct: 98  -LLRRDPNRPRAVDIRPLDDAMPDTEATHPLPSPSYVPVVGRIAAGGPILAEQAIEDVFP 156

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P+           +      K    SM+      GD +++      + GD +      G
Sbjct: 157 LPKEIVG-------EGTLFLLKVVGDSMIDAAITDGDWVVVRQQPVADNGDIVAAMID-G 208

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K    +    + LM  N  Y        +   + R++
Sbjct: 209 EATVKTFKRK-DGHVWLMPHNAAYEPI--PGDEAVVLGRVV 246


>gi|188025838|ref|ZP_02959981.2| hypothetical protein PROSTU_01881 [Providencia stuartii ATCC 25827]
 gi|188020664|gb|EDU58704.1| hypothetical protein PROSTU_01881 [Providencia stuartii ATCC 25827]
          Length = 250

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 64/225 (28%), Gaps = 20/225 (8%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA-ATNETI 69
           + ++   +    T   LA+  G+  +S N+        R     T  I K+L        
Sbjct: 23  DRLNIAMQNAGYTQGALAKAVGMAQSSINQLLNKASGSR----KTVEIAKVLGVRAEWLA 78

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR----S 125
                +  S+  + +                        +  G        P+I      
Sbjct: 79  SGEGSMLPSEQYSVKHLTDSNENELATNDSYTVDLMDIEYSCGPGSYNSDFPDIIRSISL 138

Query: 126 PHNGIYAIQT-----QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                 +I              Q  SM       D++ ++  ++   GD +      G  
Sbjct: 139 EPEFALSIFGGRPASSMKAINAQGDSMQGTIDPEDLVFIDITVKRFEGDGVYAFTFGGSS 198

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI---ARIL--W 220
             K L   +   I L S N  Y    ++ S+ E +    +++  W
Sbjct: 199 HIKRLQKIKNHLIVL-SDNPAYKEWKIDESEEEQLFIDGKVIVSW 242


>gi|153000378|ref|YP_001366059.1| putative prophage repressor [Shewanella baltica OS185]
 gi|160876505|ref|YP_001555821.1| XRE family transcriptional regulator [Shewanella baltica OS195]
 gi|151364996|gb|ABS07996.1| putative prophage repressor [Shewanella baltica OS185]
 gi|160862027|gb|ABX50561.1| transcriptional regulator, XRE family [Shewanella baltica OS195]
          Length = 221

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 65/223 (29%), Gaps = 33/223 (14%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +    +   +T S LA K G+   +          G  R PS E I  ++         L
Sbjct: 9   VKTRMKEAGVTQSMLAEKMGMSQGAIAHWL-----GGKRKPSIEDIASMMNIVGIRHMTL 63

Query: 73  LDLPFSDGRTT-----------EKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                 D   +                  P++ +  +G+         P           
Sbjct: 64  GADGLIDYPDSVLGNTEELPAKISYVNSFPVISYVQAGAWTEAVESC-PASALDEWQDTT 122

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPR 176
           E  S               + Q  SM       + +G ++++++      G  ++     
Sbjct: 123 ERTSE---------NCFWLRVQGDSMTTPAGISFPEGTLILIDAEKDYQNGSFVVAKLTD 173

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K L+   G+   L  LN  YP   +  +  + I  ++
Sbjct: 174 INEATFKKLVIDAGQKF-LRPLNTAYPTLPINGN-CKIIGVVV 214


>gi|15832244|ref|NP_311017.1| prophage repressor CI [Escherichia coli O157:H7 str. Sakai]
 gi|168764190|ref|ZP_02789197.1| repressor protein CI [Escherichia coli O157:H7 str. EC4501]
 gi|11875129|dbj|BAB19608.1| CI protein [Enterobacteria phage VT1-Sakai]
 gi|13362459|dbj|BAB36413.1| putative prophage repressor CI [Escherichia coli O157:H7 str.
           Sakai]
 gi|189365770|gb|EDU84186.1| repressor protein CI [Escherichia coli O157:H7 str. EC4501]
 gi|326343910|gb|EGD67671.1| Putative prophage repressor CI [Escherichia coli O157:H7 str. 1044]
          Length = 212

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 75/221 (33%), Gaps = 27/221 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           H+ I E I  + E   L+ + LA+  G    S    +    E   R  S +    + AA 
Sbjct: 2   HEIIGERIKSLREAKGLSQAQLAKLCGWAAPS----RLGNYELGTRKVSADDALVLGAAL 57

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             +  +++         ++   ++     F    +G F + G +   +    V      S
Sbjct: 58  GVSPAKIMFGED-----SDAVFRQYEYPLFSSVQAGPFSEVGSYTASDAKAWVPTTTKAS 112

Query: 126 PHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTG- 178
                     +    + +  SM       P + +G +++++ A  V  GD  +       
Sbjct: 113 E---------KAFWLEVKGHSMTAPQGVRPSFPEGMLILVDPAEPVESGDFCVASANGDS 163

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K      G S  L+ LN  Y     + S    I +++
Sbjct: 164 EATFKKYEKDAGVSY-LVPLNPAYRTLDCDHS-CRIIGKVV 202


>gi|257467069|ref|ZP_05631380.1| LexA repressor [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918203|ref|ZP_07914443.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313692078|gb|EFS28913.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 252

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 57/212 (26%), Gaps = 7/212 (3%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI--FKILAATNE 67
            + I     R  LT   L  K G+     +  +        +   T  +   +       
Sbjct: 5   GDIIRAFRAREGLTGQELGDKIGVSQAFIHLMESDKRRVPQKTMETLKLMLSREDYLDIL 64

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
              +    P       ++                 +        G        P      
Sbjct: 65  KYEEYATTPDFIKNELKRISNFSKEDIISEFEMREYPIYDSVSAGFGIIPDAAPIEYISL 124

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKVLI 186
                ++ +         SM P    GDI+++   I+V  G+  + +   TG+   K L 
Sbjct: 125 P---ILRGEIVGIYVVGNSMEPSISDGDIILVKKDIEVQVGEIGVFVNQVTGEGFVKRLK 181

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
            +      L S N  Y    ++  DI    ++
Sbjct: 182 YK-NGCYILKSDNPMYTDVEIQSDDIICCGKV 212


>gi|94496455|ref|ZP_01303032.1| SOS-response transcriptional repressor [Sphingomonas sp. SKA58]
 gi|94424201|gb|EAT09225.1| SOS-response transcriptional repressor [Sphingomonas sp. SKA58]
          Length = 223

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 22/220 (10%), Positives = 43/220 (19%), Gaps = 9/220 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   +++   I    E   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTPKQQELLSFIHDRLEEGGVSPSFEEMKDALDLRSKSGIHRLINALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + L                     +                     +   P        
Sbjct: 61  ARALEVLKLPDAMHRAPVPPVALAAKAAAPIPIAANDVLEIPLHGRIAAGVPIEAMEGQ- 119

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                                 +    SM       GD  ++        G  ++     
Sbjct: 120 ----AMLSVPAALLGSGDHYALEVSGDSMVEAGILDGDFALIQRTDVAREGQIVVALIDD 175

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
            +   K         + L   N  Y     +   +    +
Sbjct: 176 NEATLKYFRRDGA-RVRLDPANPAYEPQVYDPRQVRIQGK 214


>gi|16078848|ref|NP_389668.1| LexA repressor [Bacillus subtilis subsp. subtilis str. 168]
 gi|221309672|ref|ZP_03591519.1| LexA repressor [Bacillus subtilis subsp. subtilis str. 168]
 gi|221313994|ref|ZP_03595799.1| LexA repressor [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221318916|ref|ZP_03600210.1| LexA repressor [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221323190|ref|ZP_03604484.1| LexA repressor [Bacillus subtilis subsp. subtilis str. SMY]
 gi|321311427|ref|YP_004203714.1| LexA repressor [Bacillus subtilis BSn5]
 gi|399378|sp|P31080|LEXA_BACSU RecName: Full=LexA repressor; AltName: Full=SOS regulatory protein
           dinR
 gi|289288|gb|AAA22573.1| lexA [Bacillus subtilis]
 gi|2634169|emb|CAB13669.1| transcriptional repressor of the SOS regulon [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291484394|dbj|BAI85469.1| LexA repressor [Bacillus subtilis subsp. natto BEST195]
 gi|320017701|gb|ADV92687.1| LexA repressor [Bacillus subtilis BSn5]
          Length = 205

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 61/227 (26%), Gaps = 37/227 (16%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                      + +     +   P        S +    N
Sbjct: 61  TKPRAIEILDE--------------------EVDIPQSQVVNVPVIGKVTAGSPITAVEN 100

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +P+   P              +    SM+       D +I+      N G+ ++
Sbjct: 101 IEEYFPLPDRMVPP------DEHVFMLEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVV 154

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K         I L   N       ++   +  + +++
Sbjct: 155 AMTEDDEATVKRFYK-EDTHIRLQPENPTMEPIILQN--VSILGKVI 198


>gi|295399936|ref|ZP_06809917.1| transcriptional repressor, LexA family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978339|gb|EFG53936.1| transcriptional repressor, LexA family [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 207

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 63/227 (27%), Gaps = 35/227 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S   ++I + I +  +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQQQILDFIKKEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLESKGYIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                          E   +   P          +    N
Sbjct: 61  TKPRAIEILD------------------ADFSARNETDDVISVPIIGKVTAGQPITAVEN 102

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
             +   +P        + + +      +    SM       GD +I+      + GD ++
Sbjct: 103 IEDYFPLP------KRLISSEDHVFMLEVMGDSMIEAGILDGDYVIVRQQQSADNGDIVV 156

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K     +   I L   N       V   D   + +++
Sbjct: 157 AMTEENEATVKRFFKEKD-HIRLQPENSSLEPIIVR--DCTILGKVI 200


>gi|307329249|ref|ZP_07608414.1| transcriptional repressor, LexA family [Streptomyces violaceusniger
           Tu 4113]
 gi|306885148|gb|EFN16169.1| transcriptional repressor, LexA family [Streptomyces violaceusniger
           Tu 4113]
          Length = 267

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 66  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 115

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 116 --RDPHRPRAYEVRGSDQPSAQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 173

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 174 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 225

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 226 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 261


>gi|290956952|ref|YP_003488134.1| SOS repressor LexA [Streptomyces scabiei 87.22]
 gi|260646478|emb|CBG69575.1| SOS repressor LexA [Streptomyces scabiei 87.22]
          Length = 258

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 107 --RDPHRPRAYEVRGSDQASAQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 164

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 165 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 216

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 217 TVKRFKR-EDGHVWLLPHNAAYEPI--PGDDATILGKVV 252


>gi|326791322|ref|YP_004309143.1| SOS-response transcriptional repressor, LexA [Clostridium
           lentocellum DSM 5427]
 gi|326542086|gb|ADZ83945.1| SOS-response transcriptional repressor, LexA [Clostridium
           lentocellum DSM 5427]
          Length = 203

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 63/221 (28%), Gaps = 37/221 (16%)

Query: 5   SHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIF 59
             ++I   I +  +     PS   L    GL  TS   S    +E +    R PS     
Sbjct: 8   KQQQILSCIKQNLKEKGYPPSVRELCIAVGLSSTSTVHSHLNTLEKKGFIKRDPSKPRTI 67

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
           +IL      +                       +   P        + +    N      
Sbjct: 68  EILDEEMNWLEDH--------------------VSAVPIVGKVTAGAPILAVENIEEYFP 107

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
           +P+  + H        +      + TSM+      GD +I+        G+ ++      
Sbjct: 108 LPKHLTRHE-------ETFMLNVKGTSMINAGILDGDQIIVRHQDSARNGEIVVALI-ED 159

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++  K     +     L   N        +  D++ + +++
Sbjct: 160 EVTVKRFFKEKD-CFRLQPENDTMDPIYCQ--DVKILGKVI 197


>gi|119718039|ref|YP_925004.1| LexA repressor [Nocardioides sp. JS614]
 gi|171704656|sp|A1SND2|LEXA_NOCSJ RecName: Full=LexA repressor
 gi|119538700|gb|ABL83317.1| SOS-response transcriptional repressor, LexA [Nocardioides sp.
           JS614]
          Length = 246

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 59/219 (26%), Gaps = 17/219 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPSTESIFK 60
            +++   I    E+    PS   +    GL  +S   ++ K    +G   R P      +
Sbjct: 32  QQRVLAHIKDSIEKRGYPPSMREIGEAVGLTSSSSVAHQLKTLEEKGFLKRDPHRPRALE 91

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +         + +                +P   + P          +       +   +
Sbjct: 92  VFLPEVMAARRSMSAAEESSFDETGVGDALPAAQYVPVVGRIAAGGPILAEERVEDVFPL 151

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P              Q    + +  SM       GD + +        G+ +      G+
Sbjct: 152 PRQLVG-------DGQLFLLEVRGDSMIEAAICDGDYVAIRQQPTAENGEIVAAMID-GE 203

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              K    + G  + L+  N  Y     + +    + ++
Sbjct: 204 ATVKTFQRKDGN-VWLLPHNPAYDPI--DGTHATILGKV 239


>gi|254492240|ref|ZP_05105414.1| Peptidase S24-like domain protein [Methylophaga thiooxidans DMS010]
 gi|224462565|gb|EEF78840.1| Peptidase S24-like domain protein [Methylophaga thiooxydans DMS010]
          Length = 209

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/135 (14%), Positives = 44/135 (32%), Gaps = 12/135 (8%)

Query: 99  GSGGFFDSGVFPTGNKW---NTVGVPEIRSPHNGIY----AIQTQDTRHKTQDTSMLPLY 151
            +           GN +          +      IY    +          +  SM P  
Sbjct: 71  FAHIPLFDVKASAGNGYVIHEEEETDALIFKKEWIYNELHSSPANLYLIYVEGESMEPAL 130

Query: 152 RKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS- 210
           R GD+++++    V   D + +      ++ K L     + + + S N  Y    + +  
Sbjct: 131 RPGDVILVDHTDNVAKRDGIYVIRMGESLLVKRLQRLPSQRLKVTSDNPAYEPFEISLDF 190

Query: 211 ----DIEWIARILWA 221
               ++  I R++W+
Sbjct: 191 DLQNELSIIGRVVWS 205


>gi|157737469|ref|YP_001490152.1| S24 family peptidase [Arcobacter butzleri RM4018]
 gi|157699323|gb|ABV67483.1| peptidase, S24 family [Arcobacter butzleri RM4018]
          Length = 218

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 66/221 (29%), Gaps = 14/221 (6%)

Query: 3   SFSHKKIWEAIDRMAERHNLT----PSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI 58
            F   +I E +  +              +A+   L   +F   K  G           +I
Sbjct: 1   MFIVDEIIEKLKDIISADGKNGKVFDKDVAKSLELSQANFATMKNRGKIPFT------NI 54

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
               A    +I  LL     D       +  I         +GG        + + + ++
Sbjct: 55  LNFCAKKKISINWLLYNQNPDSLIDATDKYWIKYYPSVSVSAGGGAYE----SEDNFESL 110

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
            +P       G                SM P     +I+ ++        D +       
Sbjct: 111 ELPRYFVNMLGGNENLKNIDAINVIGDSMEPTLNSDNIIFIDKTKNDVSRDGIYAFTTIH 170

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +  K +  R    +D++S N  YP   +  +D+E + +++
Sbjct: 171 GLFVKRIQRRVDGKLDIISDNKDYPSQVLNKNDLEILGKVI 211


>gi|27379937|ref|NP_771466.1| LexA repressor [Bradyrhizobium japonicum USDA 110]
 gi|44888103|sp|Q89KS7|LEXA_BRAJA RecName: Full=LexA repressor
 gi|27353090|dbj|BAC50091.1| LexA repressor [Bradyrhizobium japonicum USDA 110]
          Length = 231

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/226 (11%), Positives = 58/226 (25%), Gaps = 8/226 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLRFISERLKESGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS----GGFFDSGVFPTGNK 114
            + +        Q           +  +     +     +            G    G  
Sbjct: 61  ARAIEVIKLPELQAAAGNRRGFTPSVIEGNLGKVRASSSADEGERPVAVPVMGRIAAGTP 120

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
              +                 +    + +  SM       GD+ ++      + GD ++ 
Sbjct: 121 IEALQTRSHTISVPPDMLGSGEHYALEVRGDSMVEAGILDGDMALIQRNESADTGDIVVA 180

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K    R   SI L   N  Y V  +  + ++   +++
Sbjct: 181 LIDDEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVKIQGKLI 225


>gi|85716978|ref|ZP_01047941.1| LexA repressor [Nitrobacter sp. Nb-311A]
 gi|85696180|gb|EAQ34075.1| LexA repressor [Nitrobacter sp. Nb-311A]
          Length = 233

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/228 (11%), Positives = 59/228 (25%), Gaps = 10/228 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++   I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQYELLRFINERLKESGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+         +    P        K  +                  G    G
Sbjct: 61  ARAIEVIKLPELAASGGGRRGFTPSVIEGNLGKVRRNSGGSVEDGERPVAVPVMGRIAAG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRL 171
                +                 +    + +  SM       GD+ ++      + GD +
Sbjct: 121 TPIEALQTCSHTISLPPDMLGTGEHYALEVRGDSMVEAGILDGDLALIQRNQTADTGDIV 180

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +      +   K    R   SI L   N  Y V  +  + ++   R++
Sbjct: 181 VALIDDEEATLKRFRRRGA-SIALEPANTAYEVRILPPNRVQIQGRLI 227


>gi|330829454|ref|YP_004392406.1| Prophage MuSo1, transcriptional regulator, Cro/CI family [Aeromonas
           veronii B565]
 gi|328804590|gb|AEB49789.1| Prophage MuSo1, transcriptional regulator, Cro/CI family [Aeromonas
           veronii B565]
          Length = 248

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 70/230 (30%), Gaps = 20/230 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M + S     + +D +     L+    A   G+  +   K         N  P+ +   +
Sbjct: 25  MDTLS-----DRLDELRGS--LSYKAFAELVGMSESGMRKYF----PPFNSLPTIDKALR 73

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP-SGSGGFFDSGVFPTGNKWNTVG 119
           I    N  +  L             ++      +    +   G+  +     G   +   
Sbjct: 74  IARTFNVNLEWLATGQGPKHPDGTAEQMVQREEFDEEYALIDGYHVTVSTGHGAFNDDHE 133

Query: 120 VPEIRSPHNGIYA----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           V    +                     +  SM P    GD ++++ +        + +  
Sbjct: 134 VKRKLAFRRKWLTFRKLNPDNLVVVFAKGDSMEPTIHSGDSILVDISKNQIEDGSIFVLR 193

Query: 176 RTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIE---WIARILWA 221
              ++ AK L       I ++S N   YP+  V  + +E    I +++WA
Sbjct: 194 LGEELYAKRLQKNFDGGITIISDNRDDYPLQVVPANQLENLAVIGKVVWA 243


>gi|300784298|ref|YP_003764589.1| LexA family transcriptional regulator [Amycolatopsis mediterranei
           U32]
 gi|299793812|gb|ADJ44187.1| LexA family transcriptional regulator [Amycolatopsis mediterranei
           U32]
          Length = 241

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 63/219 (28%), Gaps = 25/219 (11%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSF--NKSKRFGIEGRNRWPSTESIFKI 61
            +++ + I     R    PS   +    GL  TS   ++ +    +G  R          
Sbjct: 37  QQQVLDVIRSWVSRFGYPPSVREIGEAVGLTSTSSVSHQLRALQRKGYLRR--------- 87

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
            A     +  L     +       ++  +P   + P          V       +   +P
Sbjct: 88  DANRPRAVGVLSATDDNPMGIEMDQQPVMPKAAYVPLVGRIAAGGPVLAEQAIEDVFPLP 147

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    K    SM+      GD +++      + G+ +      G+ 
Sbjct: 148 REIVG-------EGELFLLKVTGDSMIDAAITDGDWVVVRQQPDADNGEIVAAMID-GEA 199

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    + G  I LM  N  Y        D   + +++
Sbjct: 200 TVKTFKRK-GGHIWLMPHNEAYEPI--PGDDATVLGKVV 235


>gi|294815512|ref|ZP_06774155.1| LexA repressor [Streptomyces clavuligerus ATCC 27064]
 gi|326443863|ref|ZP_08218597.1| LexA repressor [Streptomyces clavuligerus ATCC 27064]
 gi|3402269|emb|CAA12169.1| LexA protein [Streptomyces clavuligerus]
 gi|294328111|gb|EFG09754.1| LexA repressor [Streptomyces clavuligerus ATCC 27064]
          Length = 264

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 63  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 112

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 113 --RDPHRPRAYEVRGSDQPSAQPADTSGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 170

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 171 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 222

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 223 TVKRFKR-ENGHVWLLPHNAAYQPI--PGDDATILGKVV 258


>gi|256784772|ref|ZP_05523203.1| LexA repressor [Streptomyces lividans TK24]
 gi|289768659|ref|ZP_06528037.1| LexA repressor [Streptomyces lividans TK24]
 gi|68449792|emb|CAJ01780.1| SOS regulatory protein LexA [Streptomyces coelicolor A3(2)]
 gi|289698858|gb|EFD66287.1| LexA repressor [Streptomyces lividans TK24]
          Length = 259

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQAASVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNSAYEPI--PGDDATILGKVV 253


>gi|86749926|ref|YP_486422.1| LexA repressor [Rhodopseudomonas palustris HaA2]
 gi|123292537|sp|Q2IW99|LEXA_RHOP2 RecName: Full=LexA repressor
 gi|86572954|gb|ABD07511.1| SOS-response transcriptional repressor, LexA [Rhodopseudomonas
           palustris HaA2]
          Length = 234

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/229 (10%), Positives = 62/229 (27%), Gaps = 11/229 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++ + I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQFELLKFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRT-TEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
                + K+      +  +    P        + +             +      G    
Sbjct: 61  ARAIEVIKLPDLGGNSGARRGFTPSVIEGNLGKVRPPSPQHAEDDSDRNVAVPVMGRIAA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
           G     +                 +    + +  SM+      GD+ ++      + GD 
Sbjct: 121 GTPIEALQTRSHTISVPPDMLGSGEHYALEVRGDSMMDAGILDGDMALIQRNESADTGDI 180

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 VVALIDEEEATLKRFRRRGA-SIALEPANSAYEVRILPPNRVRIQGKLI 228


>gi|297202845|ref|ZP_06920242.1| LexA repressor [Streptomyces sviceus ATCC 29083]
 gi|197717329|gb|EDY61363.1| LexA repressor [Streptomyces sviceus ATCC 29083]
          Length = 259

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQGASVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIV-AAMLEGEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNSAYEPI--PGDDATILGKVV 253


>gi|29829005|ref|NP_823639.1| LexA repressor [Streptomyces avermitilis MA-4680]
 gi|29606111|dbj|BAC70174.1| putative SOS regulatory protein LexA [Streptomyces avermitilis
           MA-4680]
          Length = 259

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQSSSVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNSAYQPI--PGDEATILGKVV 253


>gi|296534190|ref|ZP_06896677.1| prophage MuMc02 [Roseomonas cervicalis ATCC 49957]
 gi|296265462|gb|EFH11600.1| prophage MuMc02 [Roseomonas cervicalis ATCC 49957]
          Length = 266

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 63/226 (27%), Gaps = 14/226 (6%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE-----SIFKILA 63
           I E +    E   L    +A KAG+   +     R G                S+  +L 
Sbjct: 36  IIERLKAAIEASGLKAPEVAEKAGIPLKTLANYMRGGGMKVLGAVRLAQACGVSVEWLLT 95

Query: 64  ATNETICQLL-DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT----V 118
                I             +    + E                +               +
Sbjct: 96  GVGPGIGTPTGATSEPCQISKHHPKNEHDFPDLIRLPRYDVRAAAGDGAEVVSEHVAEFI 155

Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTG 178
              E       +          +    SM P    GD LI+++ +     D + +     
Sbjct: 156 AFSESWIK-QTLRRKPDGLAIIEAVGNSMSPTINDGDTLIIDTKVVEANSDGIYVLSVRN 214

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARILWA 221
            ++ K +  +    I ++S N  +    ++ SD   +  + ++LWA
Sbjct: 215 GLMVKRIQLQIDGDILVISDNPSFEPKRIQASDFDAMRIVGQVLWA 260


>gi|126461478|ref|YP_001042592.1| LexA repressor [Rhodobacter sphaeroides ATCC 17029]
 gi|171855217|sp|A3PHK4|LEXA_RHOS1 RecName: Full=LexA repressor
 gi|126103142|gb|ABN75820.1| SOS-response transcriptional repressor, LexA [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 227

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 64/221 (28%), Gaps = 5/221 (2%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESIFK 60
           +    ++ + I    +R  + PS    K  LD  S +   R       R          +
Sbjct: 2   TRKQMELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHRAR 61

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-G 119
            +               +              +    +G+      G    G     + G
Sbjct: 62  AIEIVKLPEAMERAGFSARAAKAAAAPLPKGAVTVETAGALDLPLMGRIAAGLPIEAING 121

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTG 178
            P+  +    + + + Q    + +  SM+      GDI+++      + GD ++      
Sbjct: 122 GPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTADNGDIVVALVADH 181

Query: 179 DIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +   K    R G  I L   N  Y         ++   R++
Sbjct: 182 EATLKRYRRR-GGMIALEPANDSYETQVYPEQMVKVQGRLV 221


>gi|163742788|ref|ZP_02150173.1| LexA repressor [Phaeobacter gallaeciensis 2.10]
 gi|161384043|gb|EDQ08427.1| LexA repressor [Phaeobacter gallaeciensis 2.10]
          Length = 224

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/223 (13%), Positives = 64/223 (28%), Gaps = 9/223 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +     + + I+   ++  + PS    K  LD  S +   R       R      I +
Sbjct: 1   MLTKKQLDLLDFINTRLQQDGVPPSFDEMKVALDLRSKSGIHRLITALEERGF----IRR 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG--SGGFFDSGVFPTGNKWNTV 118
           +           L     +                 P+   +      G    G     +
Sbjct: 57  LAHRARAIEIIRLPDSLGNTAEAAPAAPGPANEVSAPAMIAAMELPVMGRIAAGVPIEAI 116

Query: 119 GVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                +        + Q Q    + +  SM       GDI+++      + GD ++    
Sbjct: 117 NQVSHQVAVPASMLSAQGQHFALEVRGDSMIEAGINDGDIVVIRETAVADNGDVVVALVE 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K +  + G +I L + N  Y         ++   R++
Sbjct: 177 GQEATLKRIYRK-GSTIALEAANPAYETRRYRQDQVKVQGRLV 218


>gi|296129413|ref|YP_003636663.1| transcriptional repressor, LexA family [Cellulomonas flavigena DSM
           20109]
 gi|296021228|gb|ADG74464.1| transcriptional repressor, LexA family [Cellulomonas flavigena DSM
           20109]
          Length = 252

 Score = 98.3 bits (243), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 58/219 (26%), Gaps = 19/219 (8%)

Query: 9   IWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFKIL- 62
           + E +    E+    PS   +    GL   S  K +   +E +    R P      +++ 
Sbjct: 39  VLETVRASVEQRGYPPSMREIGDAVGLTSPSSVKHQLTALERKGYLRRDPHRPRAIEVVQ 98

Query: 63  -AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                   +    P   + P          +       +   +P
Sbjct: 99  PDDARTVAPWTSRPDGPAVDPDTPERDGAPAPSYVPVVGRIAAGGPILAEQVVEDVFPLP 158

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    K    SM       GD +++        G+ +      G+ 
Sbjct: 159 RQLVG-------EGELFLLKVAGDSMIEAAICDGDWVVVRRQPVAENGEIVAAMID-GEA 210

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L       + L+  N  Y     + +D   + R++
Sbjct: 211 TVKTLKRV-DGRVWLLPHNPAYTPI--DGTDATVLGRVV 246


>gi|91977309|ref|YP_569968.1| LexA repressor [Rhodopseudomonas palustris BisB5]
 gi|123735363|sp|Q136C2|LEXA_RHOPS RecName: Full=LexA repressor
 gi|91683765|gb|ABE40067.1| SOS-response transcriptional repressor, LexA [Rhodopseudomonas
           palustris BisB5]
          Length = 235

 Score = 98.3 bits (243), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/230 (11%), Positives = 60/230 (26%), Gaps = 12/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKS-----KRFGIEGRNRW 52
           M +    ++ + I+   +   + PS   +     L   +  ++      +R  I      
Sbjct: 1   MLTRKQFELLKFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV--FP 110
                + K+      T         S    T  K +     +             +    
Sbjct: 61  ARAIEVIKLPDLGGNTGGGRRGFTPSVIEGTLGKVRPPSHSHAEDESDRNVAVPVMGRIA 120

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G     +                 +    + +  SM       GD+ ++        GD
Sbjct: 121 AGTPIEALQTRSHTISVPPDMLGSGEHYALEVRGDSMVEAGILDGDMALIQRNESAETGD 180

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 IVVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 229


>gi|319648635|ref|ZP_08002847.1| transcriptional regulator [Bacillus sp. BT1B_CT2]
 gi|317389283|gb|EFV70098.1| transcriptional regulator [Bacillus sp. BT1B_CT2]
          Length = 210

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 69/220 (31%), Gaps = 22/220 (10%)

Query: 7   KKIWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           K+I    + +  +R  ++ + +AR   +   + +   +     R      + I  +    
Sbjct: 8   KEIMANNLKKQLKRKGISQTMMARDLNIPEMTVSNWVKGKTYPRP-----DKIQLMADYF 62

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             T  QL +   S+      +   IP+L              +    N    +     + 
Sbjct: 63  GITRTQLTEEAPSNLTPLAPQTIPIPVL------GTIACGEPILAEENVTEYMYESPDQL 116

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR-LLIKPRTGDIVAKV 184
           P              K + TSM P    G  +++    +V  G    ++     +   K 
Sbjct: 117 PS-------GNLFYLKAKGTSMEPTIPDGSYVLVREQPEVENGAIAAVLVNGDTEATLKR 169

Query: 185 LISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARILWASQ 223
           +  + G  + LM  N  Y    +   +    I + +  +Q
Sbjct: 170 IKRQ-GDMVILMPDNPNYSPFIITPDNPARVIGQAIQFTQ 208


>gi|302557999|ref|ZP_07310341.1| LexA repressor [Streptomyces griseoflavus Tu4000]
 gi|302475617|gb|EFL38710.1| LexA repressor [Streptomyces griseoflavus Tu4000]
          Length = 259

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQAASVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNAAYEPI--PGDDATILGKVV 253


>gi|302554607|ref|ZP_07306949.1| LexA repressor [Streptomyces viridochromogenes DSM 40736]
 gi|302472225|gb|EFL35318.1| LexA repressor [Streptomyces viridochromogenes DSM 40736]
          Length = 259

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQAASVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNAAYEPI--PGDDATILGKVV 253


>gi|323137198|ref|ZP_08072277.1| transcriptional repressor, LexA family [Methylocystis sp. ATCC
           49242]
 gi|322397556|gb|EFY00079.1| transcriptional repressor, LexA family [Methylocystis sp. ATCC
           49242]
          Length = 237

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/232 (12%), Positives = 54/232 (23%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     +   I    +   + PS    K  LD  S +   R  +    R       + 
Sbjct: 1   MLTKKQSDLLRFIHERLKESGVPPSFDEMKDALDLRSKSGIHRLILALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP----------SGSGGFFDSGV 108
            + L                              L                +      G 
Sbjct: 61  ARALEVLRLPESATPRGGGGSRGGKFSPAVIEGNLGRVRPLHERREEETGQNVAIPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNC 167
              G   + +                 +    + +  SM       GD +++      + 
Sbjct: 121 IAAGTPISAIQSRSHTISLPPDLLTSGEHYALEVRGDSMIEAGILDGDTVVIKKQDNADT 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K L  R   SI L + N  Y         +    +++
Sbjct: 181 GDIVVALIDDEEATLKRLRKRGA-SIALEAANPAYETRIFGPDRVRIQGKLV 231


>gi|330888348|gb|EGH21009.1| peptidase [Pseudomonas syringae pv. mori str. 301020]
          Length = 233

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 66/219 (30%), Gaps = 19/219 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           ++ + + +  +   LT + LA ++G+   S ++ +R          ++  + K       
Sbjct: 22  ELKDRLKQARKHARLTQAELAERSGIKQASVSEIERGLTR------TSGYLVKFATICRV 75

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
               L +   S           +            +        G     V         
Sbjct: 76  DPVWLSEGVGSMISIGAPSNVAMIDQPVA---MYRYPVVSTVAAGAWAEAVEPDFSDRYE 132

Query: 128 NGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVA 182
              Y  + +    +    SM         +G +++++  ++   G  ++   P + +   
Sbjct: 133 TSDYKAKGRAFWLEVSGDSMTAPSGMSVPEGMLILVDPGVEARPGKLVVAKLPSSNEATF 192

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA---RI 218
           K LI      + L  LN  Y +      D + I    R+
Sbjct: 193 KKLI-DDAGQLYLKPLNPGYSMIKCT-DDCKIIGVAVRV 229


>gi|325288497|ref|YP_004264678.1| phage repressor like transcriptional regulator, XRE family
           [Syntrophobotulus glycolicus DSM 8271]
 gi|324963898|gb|ADY54677.1| phage repressor like transcriptional regulator, XRE family
           [Syntrophobotulus glycolicus DSM 8271]
          Length = 201

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 68/209 (32%), Gaps = 26/209 (12%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           I ++  +  LT   L    G+   + NK +   +E   R     +I K+ A    +  QL
Sbjct: 7   IKQLRLKKGLTQEELGNLIGVKRAAVNKWETGSVENLKRS----TIEKLSAIFGVSPIQL 62

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           L            + +   +L   P        +GV            PE          
Sbjct: 63  L---------GLTEAEPRDVLVSLPIVGRISCGNGVLAYEEIEGYEPTPETWLNG----- 108

Query: 133 IQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGR 191
              +    + +  SM     + GD+L++     V+ G+   +       V K +    G 
Sbjct: 109 --GEYFYLRAKGDSMKNARIQDGDLLLIRQQPDVDDGEIAAVLIN-DQAVLKKVYK-TGD 164

Query: 192 SIDLMSLNCCYPVDTVEMSD---IEWIAR 217
           ++ L S N  YP    +  +   +  I +
Sbjct: 165 TLVLQSENPDYPPIVCDGKEDYSVRIIGK 193


>gi|167034439|ref|YP_001669670.1| XRE family transcriptional regulator [Pseudomonas putida GB-1]
 gi|166860927|gb|ABY99334.1| transcriptional regulator, XRE family [Pseudomonas putida GB-1]
          Length = 228

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 66/207 (31%), Gaps = 15/207 (7%)

Query: 22  LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGR 81
           +T + LAR  G+   S N        G+ +    +++         T   L     +  +
Sbjct: 18  ITQASLARACGITAPSVNDWL----SGKTKTIEGQNLLLAAEHLGVTPKWLATGRGAMKK 73

Query: 82  TTEKKEKEIPLLYFPPS-GSGGFFDSGVFPTGNKWNTVGV--PEIRSPHNGIYAIQTQDT 138
           +   + +   +        S  + +      G     V +    +   H           
Sbjct: 74  SPSGEVESSNVEAALQPTRSFSYPEISWVQAGIAREAVEMGNIALCPQHTSDVWAGEDAF 133

Query: 139 RHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPR-TGDIVAKVLISRRGRS 192
             +    SM      P + +G ++++   I+   G  ++ +   T +   K L+      
Sbjct: 134 WLRVIGDSMTLSSGSPSFPEGFLILIAPDIEPRPGQFVVARMTSTNEATFKQLVRD-AGE 192

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + L  LN  YP   V+    E +  ++
Sbjct: 193 LYLKPLNSAYPTRAVD-DAWEIVGTVV 218


>gi|323967257|gb|EGB62681.1| peptidase S24 [Escherichia coli M863]
          Length = 217

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 58/214 (27%), Gaps = 15/214 (7%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R       R PS + I  +            
Sbjct: 8   RSRMKELGITQEKLAEELGMTQGGIGHWLRGY-----RHPSLDEIGVVFKYLGIDNVSFN 62

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNG 129
                                +P                F  G+    V   +  S    
Sbjct: 63  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAF 122

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
              ++       T      P +  G +++++    V  GD  + +    +   K LI   
Sbjct: 123 WLEVEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDS 179

Query: 190 GRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           G+   L  LN  YP+          + +++ ASQ
Sbjct: 180 GQVF-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 210


>gi|258454473|ref|ZP_05702440.1| peptidase S24 S26A and S26B [Staphylococcus aureus A5937]
 gi|257863330|gb|EEV86091.1| peptidase S24 S26A and S26B [Staphylococcus aureus A5937]
          Length = 238

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/236 (11%), Positives = 65/236 (27%), Gaps = 31/236 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + + ++     ++ S L+R+ G+   S +       E +        + K L      + 
Sbjct: 6   DRLKQIMSERKISQSELSRRTGIGRNSISDYLNGKYEAK--QDKVFELAKALNVNEAWLM 63

Query: 71  QLLDLPFSDGRTTE--------KKEKEIPLLYFPPSGSGGFFDSGVFP------------ 110
                        +           ++  +L +  +      +                 
Sbjct: 64  GFDISKNRKVENNDITSIYSKLTPPRQSNVLKYATNQLEEQNNDSDNLVDFNSYIQEKSE 123

Query: 111 ------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
                            E  S       +   D   K    SM PL++ G I+ +  +  
Sbjct: 124 VDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNGQIIFIEKSHT 183

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
           +  G   +     GD   K +       + L+SLN  Y      +   +  + +++
Sbjct: 184 IKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLYFYDNESVRLVGKVI 237


>gi|332686955|ref|YP_004456729.1| SOS-response repressor and protease LexA [Melissococcus plutonius
           ATCC 35311]
 gi|332370964|dbj|BAK21920.1| SOS-response repressor and protease LexA [Melissococcus plutonius
           ATCC 35311]
          Length = 236

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/236 (12%), Positives = 65/236 (27%), Gaps = 28/236 (11%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I E I    +   L+   +A K G+  ++  + ++  IE        E+I  IL  +   
Sbjct: 3   IGERIKARRKELKLSADIVAEKLGVSRSTIFRYEKGDIEKLPTNI-LENIAIILHTSPAY 61

Query: 69  ICQL---------------------LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
           +                                   + +   + L               
Sbjct: 62  LMGWEENGPNITILYNKLNAKNQKLTYNFAERRLEEQSQVNSLSLHQKTHQKDHFRLFDW 121

Query: 108 VFPTGNKWNTV---GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
                                        +T D        SM P+++  + + +     
Sbjct: 122 CGYVSAGTGEYLDGEDIRETIQLLEEDIPETADFALTVNGDSMKPVFKNHETIFIEKTTD 181

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
           +  G   ++     +   K +       I L+SLN  Y    ++ +D I+ + R++
Sbjct: 182 LPSGSIGIVI-VENEAYLKKIYIH-DDCITLVSLNPAYKNIIIKETDAIKVVGRVV 235


>gi|328885526|emb|CCA58765.1| SOS-response repressor and protease LexA [Streptomyces venezuelae
           ATCC 10712]
          Length = 262

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 61  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 110

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 111 --RDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 168

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 169 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 220

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 221 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 256


>gi|296270391|ref|YP_003653023.1| SOS-response transcriptional repressor LexA [Thermobispora bispora
           DSM 43833]
 gi|296093178|gb|ADG89130.1| SOS-response transcriptional repressor, LexA [Thermobispora bispora
           DSM 43833]
          Length = 238

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 58/219 (26%), Gaps = 20/219 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSF--NKSKRFGIEGRNRWPSTESIFKI 61
            +KI E I    +R    PS   +     L  TS   ++      +G  R          
Sbjct: 29  QRKILEVIRDSVQRRGYPPSMREIGEAVQLTSTSSVSHQLSALQRKGYLRRDPHRPRALE 88

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           +    E    +          T  + +   +       +GG          +  +   +P
Sbjct: 89  VRLPGEPAFWVDPDASQGEEGTVSRPQTAYVPVVGRIAAGGPI----LAEQSIEDVFPLP 144

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       +      +    SM       GD +++        GD +      G+ 
Sbjct: 145 RQLVG-------EGTLFLLRVTGDSMIEAAIADGDWVVVRQQPVAENGDIVAAMID-GEA 196

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    +    + L+  N  Y        +   + +++
Sbjct: 197 TVKRFKRK-DGRVWLVPHNPNYEPI--PGDEATILGKVV 232


>gi|254719207|ref|ZP_05181018.1| LexA repressor [Brucella sp. 83/13]
 gi|265984203|ref|ZP_06096938.1| LexA repressor [Brucella sp. 83/13]
 gi|306837955|ref|ZP_07470813.1| LexA repressor [Brucella sp. NF 2653]
 gi|264662795|gb|EEZ33056.1| LexA repressor [Brucella sp. 83/13]
 gi|306406879|gb|EFM63100.1| LexA repressor [Brucella sp. NF 2653]
          Length = 240

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/235 (11%), Positives = 55/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDG-------------RTTEKKEKEIPLLYFPPSGSGGFFD 105
            + L            L                     +               +     
Sbjct: 61  ARALEVLCLPDSIAPGLSPQKKFAPSVIEGSLGKVAPVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K    +   SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|118589993|ref|ZP_01547397.1| LexA repressor [Stappia aggregata IAM 12614]
 gi|118437490|gb|EAV44127.1| LexA repressor [Stappia aggregata IAM 12614]
          Length = 236

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 58/231 (25%), Gaps = 13/231 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLMFIHERLKETGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS---------GGFFDSGVF 109
            + +            L     R +   E     L  P                   G  
Sbjct: 61  ARAMEVVRLPDSIAPGLGTPRPRGSFSPEVIEGSLGKPEPAKAAPEPVIGVTEVPVMGRI 120

Query: 110 PTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCG 168
             G     +               + +    + +  SM       GD +++      + G
Sbjct: 121 AAGVPIEAIQTHSHSITVPQDLIGRGEHYALEVRGDSMIEAGILDGDTVLIRRTDSADSG 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           D ++      +   K L  +   SI L + N  Y         +    R++
Sbjct: 181 DIVVALVDDEEATLKRLRKKGA-SIALEAANPAYETRIFGPGRVRVQGRLV 230


>gi|260868710|ref|YP_003235112.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
 gi|257765066|dbj|BAI36561.1| putative phage repressor protein CI [Escherichia coli O111:H- str.
           11128]
          Length = 207

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 59/211 (27%), Gaps = 15/211 (7%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            +   +T   LA + G+         R      +R PS + I  +               
Sbjct: 1   MKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLDEIGVVFKYLGIDNVSFNHDG 55

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV----FPTGNKWNTVGVPEIRSPHNGIYA 132
                             +P                F  G+    V   +  S       
Sbjct: 56  TFSPVGEYSSAPVKKQYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDCAFWLE 115

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
           ++       T      P +  G +++++    V  GD  + +    +   K LI   G+ 
Sbjct: 116 VEGNSMTAPT---GSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQV 172

Query: 193 IDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             L  LN  YP+          + +++ ASQ
Sbjct: 173 F-LQPLNPQYPMIPCN-DSCSVVGKVI-ASQ 200


>gi|148268470|ref|YP_001247413.1| phage repressor [Staphylococcus aureus subsp. aureus JH9]
 gi|150394533|ref|YP_001317208.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           JH1]
 gi|257136362|ref|YP_003169636.1| cI repressor-like protein [Staphylococcus phage P954]
 gi|257793283|ref|ZP_05642262.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258419779|ref|ZP_05682742.1| peptidase S24 S26A and S26B [Staphylococcus aureus A9719]
 gi|282904658|ref|ZP_06312533.1| putative prophage L54a, repressor protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|295407324|ref|ZP_06817122.1| phage repressor [Staphylococcus aureus A8819]
 gi|297246908|ref|ZP_06930688.1| conserved hypothetical protein [Staphylococcus aureus A8796]
 gi|147741539|gb|ABQ49837.1| putative phage repressor [Staphylococcus aureus subsp. aureus JH9]
 gi|149946985|gb|ABR52921.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           JH1]
 gi|256681204|gb|ACV04947.1| cI repressor-like protein [Staphylococcus phage P954]
 gi|257787255|gb|EEV25595.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257844190|gb|EEV68576.1| peptidase S24 S26A and S26B [Staphylococcus aureus A9719]
 gi|282594907|gb|EFB99883.1| putative prophage L54a, repressor protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|294967769|gb|EFG43800.1| phage repressor [Staphylococcus aureus A8819]
 gi|297176260|gb|EFH35547.1| conserved hypothetical protein [Staphylococcus aureus A8796]
 gi|315128291|gb|EFT84315.1| peptidase S24 S26A and S26B [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|329728105|gb|EGG64548.1| peptidase S24-like protein [Staphylococcus aureus subsp. aureus
           21172]
          Length = 238

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/236 (11%), Positives = 65/236 (27%), Gaps = 31/236 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + + ++     ++ S L+R+ G+   S +       E +        + K L      + 
Sbjct: 6   DRLKQIMSERKISQSELSRRTGIGRNSISDYLNGKYEAK--QDKVFELAKALNVNEAWLM 63

Query: 71  QLLDLPFSDGRTTE--------KKEKEIPLLYFPPSGSGGFFDSGVFP------------ 110
                        +           ++  +L +  +      +                 
Sbjct: 64  GFDISKNRKIENNDITSIYSKLTPPRQSNVLKYATNQLEEQNNDSDNLVDFNSYIQEKSE 123

Query: 111 ------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
                            E  S       +   D   K    SM PL++ G I+ +  +  
Sbjct: 124 VDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNGQIIFIEKSHT 183

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
           +  G   +     GD   K +       + L+SLN  Y      +   +  + +++
Sbjct: 184 IKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLYFYDNESVRLVGKVI 237


>gi|330828944|ref|YP_004391896.1| Prophage MuSo1, transcriptional regulator, Cro/CI family [Aeromonas
           veronii B565]
 gi|328804080|gb|AEB49279.1| Prophage MuSo1, transcriptional regulator, Cro/CI family [Aeromonas
           veronii B565]
          Length = 248

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 70/230 (30%), Gaps = 20/230 (8%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M + S     + +D +     L+    A   G+  +   K         N  P+ +   +
Sbjct: 25  MDTLS-----DRLDELRGS--LSYKAFAELVGMSESGMRKYF----PPFNSLPTIDKALR 73

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPP-SGSGGFFDSGVFPTGNKWNTVG 119
           I    N  +  L             ++      +    +   G+  +     G   +   
Sbjct: 74  IARTFNVNLEWLATGQGPKHPDGAAEQMVQREEFDEEYALIDGYHVTVSTGHGAFNDDHE 133

Query: 120 VPEIRSPHNGIYA----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           V    +                     +  SM P    GD ++++ +        + +  
Sbjct: 134 VKRKLAFRRKWLTFRKLNPDNLVVVFAKGDSMEPTIHSGDSILVDISKNQIEDGSIFVLR 193

Query: 176 RTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIE---WIARILWA 221
              ++ AK L       I ++S N   YP+  V  + +E    I +++WA
Sbjct: 194 LGEELYAKRLQKNFDGGITIISDNRDDYPLQVVPANQLENLAVIGKVVWA 243


>gi|253577142|ref|ZP_04854463.1| LexA repressor [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843524|gb|EES71551.1| LexA repressor [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 208

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/226 (14%), Positives = 62/226 (27%), Gaps = 32/226 (14%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M+  S   + I E I          PS   +    GL   ++ +    R   +G  R   
Sbjct: 1   MSKVSSRQQAILEFIRNEVRAKGYPPSVREIGEAVGLASSSTVHGHLDRLEKKGFIRRDP 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+   + +    +   +  +L                 +   P          +  T N 
Sbjct: 61  TK--PRAIELLGQEESENYNLF-------------AHSVTRVPIVGKVTAGVPITATENI 105

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            +   +PE        YA             SM       GD +I+      N GD ++ 
Sbjct: 106 EDYFPLPEH-------YAADGDIFMLSVVGDSMIEAGIHNGDYVIVRQQQTANNGDIVVA 158

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K         I L   N       ++   +  + +++
Sbjct: 159 MTEDDEATVKTFYKESD-HIRLQPENSTMEPLRLKH--VTILGKVI 201


>gi|71275563|ref|ZP_00651848.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Dixon]
 gi|71900792|ref|ZP_00682912.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Ann-1]
 gi|71163454|gb|EAO13171.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Dixon]
 gi|71729469|gb|EAO31580.1| Helix-turn-helix motif:Peptidase S24, S26A and S26B [Xylella
           fastidiosa Ann-1]
          Length = 256

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/248 (13%), Positives = 66/248 (26%), Gaps = 43/248 (17%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        +T   LA    + P S +         + ++   E++ K   A N +  
Sbjct: 5   ERLRFAMLEAGMTQKQLADAVRVKPPSVHGWL----SSKAKFLRGENLLKAAQALNVSEK 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPP---------------------SGSGGFFDSGVF 109
            L          T    +E P    P                      +         + 
Sbjct: 61  WLATGTGPMRAVTANSNQENPSTQGPERTKLDACELRIIDGDEDLDREADVLIDEVDVLL 120

Query: 110 PTGNKWNTVGV-------PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
             G+              P   S    ++         +    SM       D +++N A
Sbjct: 121 AAGSGVVIPEFIETKFRMPFPLSWLRDVHISSKDVKLMRVYGDSMERTLFDKDRVLVNLA 180

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC--------YPVDTVEMSD--- 211
                  ++      G+   K L + R  S+ ++S N          Y  + V   +   
Sbjct: 181 DTRIRDGKVYAIAIGGEAKVKRLYTLRNSSLRIVSDNQNKDSEGHRIYKDEIVPSKEMDT 240

Query: 212 IEWIARIL 219
           +  I R++
Sbjct: 241 VHIIGRVI 248


>gi|304379184|ref|ZP_07361927.1| helix-turn-helix domain protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|304342230|gb|EFM08126.1| helix-turn-helix domain protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
          Length = 238

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/236 (11%), Positives = 65/236 (27%), Gaps = 31/236 (13%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + + ++     ++ S L+R+ G+   S +       E +        + K L      + 
Sbjct: 6   DRLKQIMSERKISQSELSRRTGIGRNSISDYLNGKYEAK--QDKIFELAKALNVNEAWLM 63

Query: 71  QLLDLPFSDGRTTE--------KKEKEIPLLYFPPSGSGGFFDSGVFP------------ 110
                        +           ++  +L +  +      +                 
Sbjct: 64  GFDISKNRKIENNDITSIYSKLTPPRQSNVLKYATNQLEEQNNDSDNLVDFNSYIQEKSE 123

Query: 111 ------TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
                            E  S       +   D   K    SM PL++ G I+ +  +  
Sbjct: 124 VDIYGCASAGIGERLYNEPISKEFVRGYVPAHDIALKVNGDSMEPLFKNGQIIFIEKSHT 183

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
           +  G   +     GD   K +       + L+SLN  Y      +   +  + +++
Sbjct: 184 IKDGQIGVFIIN-GDAYVKKVY-VEDNRLTLVSLNKKYKDLYFYDNESVRLVGKVI 237


>gi|309803435|ref|ZP_07697529.1| peptidase S24-like protein [Lactobacillus iners LactinV 11V1-d]
 gi|325913398|ref|ZP_08175765.1| peptidase S24-like protein [Lactobacillus iners UPII 60-B]
 gi|308164444|gb|EFO66697.1| peptidase S24-like protein [Lactobacillus iners LactinV 11V1-d]
 gi|325477324|gb|EGC80469.1| peptidase S24-like protein [Lactobacillus iners UPII 60-B]
          Length = 222

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/229 (11%), Positives = 72/229 (31%), Gaps = 20/229 (8%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             ++++I + ++R+     ++   ++RK  +  +S ++        R R    + + +  
Sbjct: 1   MRNNEEIMQLLERLKADKKMSLREISRKTDIAVSSISRYFN-----RTRDFPLDKLDRFA 55

Query: 63  AATNETICQLLDLPFSDGRTTE----KKEKEIPLLYFPPSGSGGFFDS-------GVFPT 111
            A N +   +L++      TT      ++++  +  +         +        G    
Sbjct: 56  KAFNVSPEYILNVSKPCDITTIYNQLHEKRQAKVYNYAREQLDEQLNEKRSIYVVGTSAA 115

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
           G               +        D     +  SM P      I+  +    +  G+  
Sbjct: 116 GEPIEYGDFDSEMIQTD---VPAKADKAIHIKGDSMEPKIASNSIIFYHEQPTLEIGEIG 172

Query: 172 LIKPRTGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           + +     +  K        + I L S+N  Y         +  + +++
Sbjct: 173 IFEINGSAVTCKKYYVDYESKKIVLKSINPKYEPMYFARDQVRILGKVV 221


>gi|15839101|ref|NP_299789.1| hypothetical protein XF2511 [Xylella fastidiosa 9a5c]
 gi|9107714|gb|AAF85309.1|AE004058_10 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 256

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 32/248 (12%), Positives = 64/248 (25%), Gaps = 43/248 (17%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        +T   LA    + P S +         + ++   E++ K   A N +  
Sbjct: 5   ERLRFAMLEAGMTQKQLADAVRVKPPSVHGWL----SAKAKFLRGENLLKAAQALNVSEK 60

Query: 71  QLLDLPFSDGRTTEKKEKEIP---------------------LLYFPPSGSGGFFDSGVF 109
            L          T    +E P                         P +         + 
Sbjct: 61  WLATGTGPMRAVTANSNQETPSKQDSKRIKLDACELRVIESDDELDPEADVLLDEIDVML 120

Query: 110 PTGNKWNTVGV-------PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA 162
             GN              P   S    ++         +    SM       D +++N A
Sbjct: 121 AAGNGILIPEFVETQFKMPFPISWLRDVHINSKDVKLMRVHGDSMERTLFNKDRVMVNFA 180

Query: 163 IQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC--------YPVDTVEMSD--- 211
                  ++      G+   K L +     + + S N          +   T+   +   
Sbjct: 181 DTHVRDGKVYAIAIDGEAKVKRLYTLHNNGLRIASDNHARDSEGHRIHEDRTISPKEIGI 240

Query: 212 IEWIARIL 219
           ++ I R++
Sbjct: 241 VQVIGRVI 248


>gi|294631831|ref|ZP_06710391.1| LexA repressor [Streptomyces sp. e14]
 gi|292835164|gb|EFF93513.1| LexA repressor [Streptomyces sp. e14]
          Length = 259

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 57  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 106

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 107 -RDPHRPRAYEVRGSDQAATLQPTDTVGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 165

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 166 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQQVAENGDIVAAMID-GEA 217

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 218 TVKRFKR-EDGHVWLLPHNAAYEPI--PGDDATILGKVV 253


>gi|21224148|ref|NP_629927.1| LexA repressor [Streptomyces coelicolor A3(2)]
 gi|13431608|sp|O69979|LEXA_STRCO RecName: Full=LexA repressor
 gi|2995311|emb|CAA18339.1| SOS regulatory protein [Streptomyces coelicolor A3(2)]
          Length = 234

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 32  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 81

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 82  -RDPHRPRAYEVRGSDQAASVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 140

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 141 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 192

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 193 TVKRFKR-EDGHVWLLPHNSAYEPI--PGDDATILGKVV 228


>gi|239991243|ref|ZP_04711907.1| LexA repressor [Streptomyces roseosporus NRRL 11379]
          Length = 265

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 54/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 64  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 113

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 114 --RDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 171

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 172 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 223

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + L+  N  Y        +   + +++
Sbjct: 224 TVKRF-RREDGHVWLLPHNAAYQPI--PGDEATILGKVV 259


>gi|182435510|ref|YP_001823229.1| LexA repressor [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326776147|ref|ZP_08235412.1| SOS-response transcriptional repressor, LexA [Streptomyces cf.
           griseus XylebKG-1]
 gi|178464026|dbj|BAG18546.1| putative SOS regulatory protein [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326656480|gb|EGE41326.1| SOS-response transcriptional repressor, LexA [Streptomyces cf.
           griseus XylebKG-1]
          Length = 265

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 54/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 64  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 113

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 114 --RDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 171

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 172 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 223

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + L+  N  Y        +   + +++
Sbjct: 224 TVKRF-RREDGHVWLLPHNAAYQPI--PGDEATILGKVV 259


>gi|172045704|sp|Q2K8X2|LEXA_RHIEC RecName: Full=LexA repressor
          Length = 239

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 64/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A N ++        S                 P        S      G
Sbjct: 61  ARALEVIKLPEAYNPSLQPRRGFSPSVIEGSLGKPQPVAAPAAPKPVADNGNSISVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|329769730|ref|ZP_08261131.1| hypothetical protein HMPREF0433_00895 [Gemella sanguinis M325]
 gi|328838092|gb|EGF87710.1| hypothetical protein HMPREF0433_00895 [Gemella sanguinis M325]
          Length = 218

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/216 (12%), Positives = 63/216 (29%), Gaps = 20/216 (9%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           + +  + ++HN++ + +A   G+  +++N  ++         P+ +++ ++    N    
Sbjct: 5   DRLQALRKKHNISQTAIAEHLGVTRSAYNGWEKGKFI-----PNKKNLEELADYFNVETS 59

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPP-----SGSGGFFDSGVFPTGNK---WNTVGVPE 122
                     R  +  +     L         S    +        G             
Sbjct: 60  YFESEYEIVNRYLQLNDINKQKLLKVANELYFSQLYKYRVHAKLSAGLGNYYDENYEFDT 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
           +       Y     D        SM P Y  GD+ ++        G  +       +   
Sbjct: 120 VYFNSEYDY-----DIASWVDGDSMEPKYHNGDVALIKKTGFDYDG-LIYAVVYNEETYI 173

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           K         + L+SLN  Y      + ++  +  +
Sbjct: 174 KK-AYIEEDKVRLVSLNDKYDDIIAPIDEVRIVGLV 208


>gi|296535264|ref|ZP_06897472.1| repressor lexA [Roseomonas cervicalis ATCC 49957]
 gi|296264404|gb|EFH10821.1| repressor lexA [Roseomonas cervicalis ATCC 49957]
          Length = 245

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 58/240 (24%), Gaps = 22/240 (9%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST----- 55
           M +    ++   IDR       +PS    K  L   S +   R       R         
Sbjct: 1   MLTRKQHELLTFIDRHLRDTGFSPSFEEMKDALKLRSKSGIHRLITALEERGFLRRRAHR 60

Query: 56  ----------ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD 105
                     ES+ +  A            P         +      L      +     
Sbjct: 61  ARALEVIRLPESLAQSGALPATAEAPAAAEPPPGFAPNVIRGNFAQNLPGVAHAAAEAGA 120

Query: 106 SG-----VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILIL 159
                      G     +               Q      +    SM+ +    GD +I+
Sbjct: 121 VQLPLYGRIAAGLPIEALRDQGASVEVPMALLGQGDHYALEVAGDSMIGMGILDGDTVII 180

Query: 160 NSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                   G  ++      ++  K L  + G SI L + N  Y         ++   R++
Sbjct: 181 RRGDTAENGSVVVALVDENEVTLKRLRRK-GNSIALEAANPQYETRIFGPDRVKVQGRLV 239


>gi|254386106|ref|ZP_05001420.1| LexA repressor [Streptomyces sp. Mg1]
 gi|194344965|gb|EDX25931.1| LexA repressor [Streptomyces sp. Mg1]
          Length = 264

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 63  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 112

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               +        P   + P          +    +  +   +P
Sbjct: 113 --RDPHRPRAYEVRGSDQPSSQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 170

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 171 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 222

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 223 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 258


>gi|297156722|gb|ADI06434.1| LexA repressor [Streptomyces bingchenggensis BCW-1]
          Length = 267

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 66  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 115

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 116 --RDPHRPRAYEVRGSDQPSTQPADTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 173

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 174 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 225

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 226 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 261


>gi|157159743|ref|YP_001457061.1| P22 repressor protein c2 [Escherichia coli HS]
 gi|253774261|ref|YP_003037092.1| XRE family transcriptional regulator [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260856262|ref|YP_003230153.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|291283947|ref|YP_003500765.1| P22 repressor protein c2 [Escherichia coli O55:H7 str. CB9615]
 gi|157065423|gb|ABV04678.1| P22 repressor protein c2 [Escherichia coli HS]
 gi|194021560|gb|ACF32369.1| repressor protein C2 [Enterobacteria phage DE3]
 gi|253325305|gb|ACT29907.1| transcriptional regulator, XRE family [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253976933|gb|ACT42603.1| Repressor protein C2 [Escherichia coli BL21(DE3)]
 gi|257754911|dbj|BAI26413.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|290763820|gb|ADD57781.1| P22 repressor protein c2 [Escherichia coli O55:H7 str. CB9615]
 gi|313848585|emb|CBY77813.1| P22 repressor protein c2 [Escherichia coli BL21(DE3)]
 gi|324114861|gb|EGC08828.1| peptidase S24 [Escherichia fergusonii B253]
          Length = 216

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/220 (11%), Positives = 67/220 (30%), Gaps = 28/220 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 7   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALAKALQCSP 61

Query: 70  C-----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                 +      +     + +     + +          +       + W         
Sbjct: 62  DYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHRRAIDNW--------- 112

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGD 179
             ++              +  SM         +G I++++  ++   G  ++       +
Sbjct: 113 --YDTTVDCSEDSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENE 170

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 171 ATFKKLVIDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|152996492|ref|YP_001341327.1| putative prophage repressor [Marinomonas sp. MWYL1]
 gi|150837416|gb|ABR71392.1| putative prophage repressor [Marinomonas sp. MWYL1]
          Length = 216

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 73/222 (32%), Gaps = 27/222 (12%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-STESIFKILAA--- 64
           I E + +      LT + LA++ G+   S  K +    +GR + P    ++ K L     
Sbjct: 3   IAERVKQKRTDLRLTQAELAKRVGISQQSLQKIE----DGRTQNPRKLLNLAKALDCDAE 58

Query: 65  ---TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                +     E  L     +     + +       K++ +  P
Sbjct: 59  WLLLGTACEVRESASSYTNNNSASTSLETNLRPIITTLQAAQWPNITDLDERKFDWIETP 118

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSML----PLYRKGDILILNSAIQVNCGDRLL-IKPR 176
           E  S                    SM+        +G +++++ ++    GD ++     
Sbjct: 119 ESTS---------KSAFWLNVVGDSMMSPSGTSVPEGYLILVDPSLTAKNGDLIITKVAD 169

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           + D+  K L+   GR+  L  LN  Y    V  +D+  I  +
Sbjct: 170 SKDVTFKKLVIDAGRTY-LTPLNPNYRPIEVP-NDLTVIGVV 209


>gi|85703699|ref|ZP_01034803.1| phage-related protein [Roseovarius sp. 217]
 gi|85672627|gb|EAQ27484.1| phage-related protein [Roseovarius sp. 217]
          Length = 219

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 64/226 (28%), Gaps = 25/226 (11%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNR--WPSTESIFKILAATN 66
           I   ID   ++   + +  +R A +   S  K+ R   +G  R  W S E + ++L    
Sbjct: 4   ILNQIDEALKKKGYSDAKASRLA-VGHPSLIKNFRMKRDGDKRYNWASLERLAEVLD--- 59

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN--TVGVPEIR 124
                             +                          G       V      
Sbjct: 60  ---------LELYFGPPREAGTVYTTQLGHDDFDVILRLDARLAAGAGVENGEVSYEGAL 110

Query: 125 SPHNGIY----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
           +             +Q    +    SM P+ R  D+++++          +         
Sbjct: 111 AFCRKWLNEHNISPSQACLMRVSGDSMCPMLRDDDVVMIDQRKTTIRNRHVYALVDVDGS 170

Query: 181 -VAKVLISRRGRSIDLMSLNCCYPVDTV---EMSDIEWIARILWAS 222
              K +       I L S N  YP +T    +M+ I  +  I+W+S
Sbjct: 171 SRVKRVELVENEMIILSSDNPNYPTETRRGPDMNRIRILGEIVWSS 216


>gi|222032723|emb|CAP75462.1| Repressor protein [Escherichia coli LF82]
          Length = 216

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 67/219 (30%), Gaps = 26/219 (11%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 7   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALANALKCSP 61

Query: 70  CQLLDLPF----SDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
             L+            +        PL+ +  +G                N        S
Sbjct: 62  DYLIKGEESLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHK-RAIDNWYDTTVDCS 120

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
                            +  SM         +G I++++  ++   G  ++       + 
Sbjct: 121 E---------DSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENEA 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 172 TFKKLVIDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|329939980|ref|ZP_08289262.1| SOS-response repressor and protease LexA [Streptomyces
           griseoaurantiacus M045]
 gi|329300806|gb|EGG44702.1| SOS-response repressor and protease LexA [Streptomyces
           griseoaurantiacus M045]
          Length = 234

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 32  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 81

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 82  -RDPHRPRAYEVRGSDQAAPVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 140

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 141 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIV-AAMLEGEA 192

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 193 TVKRFKR-EDGHVWLLPHNSAYEPI--PGDDATILGKVV 228


>gi|158334468|ref|YP_001515640.1| S24 family peptidase [Acaryochloris marina MBIC11017]
 gi|158304709|gb|ABW26326.1| peptidase, S24 family [Acaryochloris marina MBIC11017]
          Length = 227

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 64/202 (31%), Gaps = 10/202 (4%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
             + LA+  G++  +  K        RN     E + + L    E +             
Sbjct: 27  NATHLAKVVGVNDRTIRKWMAGTEPARN---YLELLAEKLEVNIEWLVLGRGPIRRVDGG 83

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
                     LY   +G+G    +           +           +       +    
Sbjct: 84  IGDGTYVQIPLYDVRAGAGEGMIAEDK--EQIEELMAFSRSWIRSE-LRTSPAHLSLIHV 140

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P  R GD+++++        D + +  R G +  K L    G+ + ++S N  Y
Sbjct: 141 SGDSMEPTLRPGDVVLVDQHQAEGGTDGVYVLRRDGHLQIKRLHWLSGKVLKIISDNPIY 200

Query: 203 PVDTVEM----SDIEWIARILW 220
               V++     + + I R++W
Sbjct: 201 QPIEVDLSQLTEEFQIIGRVIW 222


>gi|312873589|ref|ZP_07733636.1| DNA-binding helix-turn-helix protein [Lactobacillus iners LEAF
           2052A-d]
 gi|311090842|gb|EFQ49239.1| DNA-binding helix-turn-helix protein [Lactobacillus iners LEAF
           2052A-d]
          Length = 228

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/224 (12%), Positives = 58/224 (25%), Gaps = 25/224 (11%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT------- 65
           ID    ++NLT   L +K G   +S ++          R+P  E I +I           
Sbjct: 12  IDYFRRQNNLTMEELGQKLGKAKSSISRWVSGE-----RYPKIEEIEQIANFFNTDIYTL 66

Query: 66  --NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDS-------GVFPTGNKWN 116
                  +                ++  +  +         +        G    G    
Sbjct: 67  IFGFNYNEDSKSDLLTVYNQLTDIRKHKVYSYAQQQLDEQLNDKSSIYVVGTSAAGEPIE 126

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
                      +        D     +  SM P      I+  +    +  G+  + +  
Sbjct: 127 YGDFDSEMIQTD---VPAKADKAIHIKGDSMEPKIASNSIIFYHEQPTLEIGEIGIFEIN 183

Query: 177 TGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              +  K        + I L S+N  Y         +  + +++
Sbjct: 184 GSAVTCKKYYVDYESKKIILKSINPKYEPMYFARDQVRILGKVV 227


>gi|239944779|ref|ZP_04696716.1| LexA repressor [Streptomyces roseosporus NRRL 15998]
 gi|291448242|ref|ZP_06587632.1| LexA repressor [Streptomyces roseosporus NRRL 15998]
 gi|291351189|gb|EFE78093.1| LexA repressor [Streptomyces roseosporus NRRL 15998]
          Length = 265

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 54/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 64  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMVLERKGFLR---------- 113

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 114 --RDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 171

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 172 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 223

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + L+  N  Y        +   + +++
Sbjct: 224 TVKRF-RREDGHVWLLPHNAAYQPI--PGDEATILGKVV 259


>gi|241204519|ref|YP_002975615.1| LexA repressor [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858409|gb|ACS56076.1| SOS-response transcriptional repressor, LexA [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 239

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/233 (12%), Positives = 63/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A + +I        S                          S      G
Sbjct: 61  ARALEVIKLPEAYSPSIQPRRGFSPSVIEGSLGKPQPVAAPAPAKPVADNGNSVSVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIAVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|282862307|ref|ZP_06271369.1| SOS-response transcriptional repressor, LexA [Streptomyces sp.
           ACTE]
 gi|282562646|gb|EFB68186.1| SOS-response transcriptional repressor, LexA [Streptomyces sp.
           ACTE]
          Length = 265

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 64  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 113

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T        P   + P          +    +  +   +P
Sbjct: 114 --RDPHRPRAYEVRGSDQPSTQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 171

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 172 RQLVG-------DGELFVLKVVGDSMIEAAIMDGDWVTVRRQPVAENGDIVAAMLD-GEA 223

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 224 TVKRFKR-EDGHVWLLPHNSAYQPI--PGDEATILGKVV 259


>gi|103485728|ref|YP_615289.1| putative phage repressor [Sphingopyxis alaskensis RB2256]
 gi|98975805|gb|ABF51956.1| putative phage repressor [Sphingopyxis alaskensis RB2256]
          Length = 222

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 68/213 (31%), Gaps = 9/213 (4%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
            A+DR+     +  + L++  G +P    +  +    G  R  + +   +I A    +  
Sbjct: 10  AALDRLLSEKGVDYARLSQVIGRNPAYIQQYIKR---GSPRRLAEQDRARIAAYLGVSEA 66

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L             +   + L+    +                   V          G 
Sbjct: 67  MLGGPVARVATPARSRGAGMILVPK-LAIGASAGAGASVDGEPVEGEVAFNPKWLRDLG- 124

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILN-SAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
            A     +  + +  SM P    GD ++++ S       D + +      ++ K +    
Sbjct: 125 -ADPRALSIIRVEGDSMAPTLDDGDDILVDGSDAAARLRDGIYVLRMDDVLMVKRIARAP 183

Query: 190 G-RSIDLMSLNCCYPVD-TVEMSDIEWIARILW 220
           G   + ++S N  Y     + +S I  + R++W
Sbjct: 184 GPGRVSVISDNPHYRSWDDLPLSAIRLVGRVVW 216


>gi|302537349|ref|ZP_07289691.1| LexA repressor [Streptomyces sp. C]
 gi|302446244|gb|EFL18060.1| LexA repressor [Streptomyces sp. C]
          Length = 263

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 53/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 62  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 111

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               +        P   + P          +    +  +   +P
Sbjct: 112 --RDPHRPRAYEVRGSDQPSSQPTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 169

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 170 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 221

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 222 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 257


>gi|83942599|ref|ZP_00955060.1| LexA repressor [Sulfitobacter sp. EE-36]
 gi|83953840|ref|ZP_00962561.1| LexA repressor [Sulfitobacter sp. NAS-14.1]
 gi|83841785|gb|EAP80954.1| LexA repressor [Sulfitobacter sp. NAS-14.1]
 gi|83846692|gb|EAP84568.1| LexA repressor [Sulfitobacter sp. EE-36]
          Length = 232

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 66/229 (28%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     +   I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLAFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  +              DG   +             + S      G    G
Sbjct: 61  ARAIEVVKLPDSLGSLSGAGFTPRVIDGDRPDGPPPSAAQP--VSASSFDVPMMGRIAAG 118

Query: 113 NKWNTVGV-PEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +    +  +   G+ +   +    + Q  SM+      GD++I+      + GD 
Sbjct: 119 VPIEAISTMTQSVAVPGGMISGSGEHYALEVQGDSMIDAGINDGDVVIIRETSVADDGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K      G S+ L + N  Y    +    ++   R++
Sbjct: 179 VVALVEDHEATLKKFRRH-GSSVALEAANPAYETRVLPSDKVKVQGRLV 226


>gi|288556885|ref|YP_003428820.1| LexA repressor [Bacillus pseudofirmus OF4]
 gi|288548045|gb|ADC51928.1| LexA repressor [Bacillus pseudofirmus OF4]
          Length = 207

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 69/229 (30%), Gaps = 39/229 (17%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRNR 51
           M+  S   ++I + I    ++    PS   +    GL  +S      ++ ++ G+    R
Sbjct: 1   MSKLSKRQQEILDYIKIEVKKKGYPPSVREIGEAVGLASSSTVHGHLSRLEKKGLI--RR 58

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            P+     ++L                                + P          +   
Sbjct: 59  DPTKPRAIEVLEM-----------------DELDPVVHEKKTAYVPIVGKVTAGMPITAI 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
            N    + +P+    ++ +Y           Q  SM       GD++I+      N GD 
Sbjct: 102 ENVEEYLPLPDHLVTNDSVY-------VLVIQGDSMIEAGIYDGDMVIVRQQQTANNGDI 154

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K     +   I L   N       ++  D+  + +++
Sbjct: 155 IVAMTEENEATVKRFFREKD-YIRLQPENSTMEPILLK--DVTVLGKVI 200


>gi|261492598|ref|ZP_05989151.1| CI repressor [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261494900|ref|ZP_05991372.1| CI repressor [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261309436|gb|EEY10667.1| CI repressor [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311757|gb|EEY12907.1| CI repressor [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 228

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/231 (14%), Positives = 64/231 (27%), Gaps = 26/231 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M+  S       +  +  + NL+ +  A+  G+   +  K          R P   +I +
Sbjct: 1   MSDLS-----SRLSGLLAQKNLSMNEFAKMVGVTQPAIAKIVNGET----RSPK--NIVE 49

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN---- 116
           I  A +  +  L            K  K         S             GN       
Sbjct: 50  IADALDVDVNWLKTGKGEA-PDFAKIGKNPTAYEEESSMLRLEVLDVYASAGNGSFVTGD 108

Query: 117 ------TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                  V             A     +       SM P    GD+L +++      GD 
Sbjct: 109 LTAYTHAVEFENAYFAQVFQRANAKGLSIINVDGDSMEPTIGNGDLLFVDTTKSAYQGDG 168

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARI 218
           + +     ++  K L    G  + ++S N  Y    +       ++   ++
Sbjct: 169 VYVFSYGENLYVKRLQF-AGDELLVISDNPLYKEWRITSENEHKLQIHGKV 218


>gi|44888100|sp|Q82KE0|LEXA_STRAW RecName: Full=LexA repressor
          Length = 234

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 54/219 (24%), Gaps = 27/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 32  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 81

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +      +                 P   + P          +    +  +   +P
Sbjct: 82  -RDPHRPRAYEVRGSDQSSSVQPTDTAGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 140

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 141 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 192

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 193 TVKRFKR-EDGHVWLLPHNSAYQPI--PGDEATILGKVV 228


>gi|15614919|ref|NP_243222.1| LexA repressor [Bacillus halodurans C-125]
 gi|13431641|sp|Q9KAD3|LEXA_BACHD RecName: Full=LexA repressor
 gi|10174976|dbj|BAB06075.1| transcriptional repressor of the SOS regulon [Bacillus halodurans
           C-125]
          Length = 207

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/229 (13%), Positives = 63/229 (27%), Gaps = 39/229 (17%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRNR 51
           M+  S   ++I + I          PS   +    GL  +S      ++ ++ G     R
Sbjct: 1   MSKLSRRQQEILDYIKEEVRAKGYPPSVREIGEAVGLASSSTVHGHLSRLEKKGYI--RR 58

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
            P+     ++L                        E       + P          +   
Sbjct: 59  DPTKPRAIEVLD-----------------LENLASETTEAKATYIPVVGKVTAGLPITAV 101

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
            N      +PE  + ++            + Q  SM       GD++I+      + GD 
Sbjct: 102 ENVEEYFPLPEQLTAND-------NTYALRIQGDSMIEAGIFDGDLVIVRQQQTADNGDI 154

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K     +   I L   N       +       + +++
Sbjct: 155 IVAMTEEDEATVKRFFREKD-YIRLQPENSTMEPIILTT--CTILGKVI 200


>gi|254391042|ref|ZP_05006250.1| LexA repressor [Streptomyces clavuligerus ATCC 27064]
 gi|13431612|sp|O86847|LEXA_STRCL RecName: Full=LexA repressor
 gi|197704737|gb|EDY50549.1| LexA repressor [Streptomyces clavuligerus ATCC 27064]
          Length = 239

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 38  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 87

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 88  --RDPHRPRAYEVRGSDQPSAQPADTSGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 145

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 146 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 197

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        D   + +++
Sbjct: 198 TVKRFKR-ENGHVWLLPHNAAYQPI--PGDDATILGKVV 233


>gi|303248682|ref|ZP_07334936.1| putative phage repressor [Desulfovibrio fructosovorans JJ]
 gi|302489938|gb|EFL49864.1| putative phage repressor [Desulfovibrio fructosovorans JJ]
          Length = 226

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 64/202 (31%), Gaps = 12/202 (5%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           + + LA   G+  ++  ++K+     +        +  +   T      L     +    
Sbjct: 30  SQAELAALLGVHRSAVTQAKKKDAVPKA------WVLAVSRRTGADADWLEYGRPAKSAA 83

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
                ++ P +  P   +      G F T  +  +V VP           +         
Sbjct: 84  KNDTAEDGPYIGVPKVRARLSAGGGSFETRGEVESV-VPFRGDWLRRKGNVSG-MVLMDV 141

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P  R GD ++++          +        ++ K +  R   S+ L+S N  Y
Sbjct: 142 VGNSMEPEIRHGDTVLIDQGQTAIVAHGVYAMGVEDTVLVKRVEKRP-GSLVLLSDNRDY 200

Query: 203 PVDTVEMSDI---EWIARILWA 221
               +   +I     I R+LW 
Sbjct: 201 APIVLSGDEIDALRVIGRVLWV 222


>gi|110680397|ref|YP_683404.1| LexA repressor [Roseobacter denitrificans OCh 114]
 gi|123065396|sp|Q163X5|LEXA_ROSDO RecName: Full=LexA repressor
 gi|109456513|gb|ABG32718.1| LexA repressor [Roseobacter denitrificans OCh 114]
          Length = 233

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 64/229 (27%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+                 +G   +             + +      G    G
Sbjct: 61  ARAIEIVKLPETLGGAARGGFTPRVIEGDKPDAPLPAGAQA-VSSADAVALPLVGRIAAG 119

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +          G   + +      + +  SM+      GD++++      + GD 
Sbjct: 120 LPIEAINQNSASVAVPGQMLSGKGDHYALEVKGDSMIDAGINDGDVVVIRETSVADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K  + + G SI L + N  Y         ++   +++
Sbjct: 180 VVALIEDHEATLKRYMRK-GSSIALEAANPAYETRVFTEDKVKVQGKLV 227


>gi|307580165|gb|ADN64134.1| hypothetical protein XFLM_11395 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 246

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 64/240 (26%), Gaps = 43/240 (17%)

Query: 19  RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFS 78
              +T   LA    + P S +         + ++   E++ K   A N +   L      
Sbjct: 3   EAGMTQKQLADAVRVKPPSVHGWL----SSKAKFLRGENLLKAAQALNVSEKWLATGTGP 58

Query: 79  DGRTTEKKEKEIPLLY---------------------FPPSGSGGFFDSGVFPTGNKWNT 117
               T    +E P                         P +         +   GN    
Sbjct: 59  MRAVTANSNQENPSTQGPERTKLDACELRVVESDDDLDPETDVLIDEVDVLLAAGNGVVI 118

Query: 118 VGV-------PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
                     P   S    ++         +    SM       D +++N A       +
Sbjct: 119 PEFIETKFRMPFPLSWLRDVHISSKDMKLMRVYGDSMERTLFDKDRVLVNLADTRIRDGK 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCC--------YPVDTVEMSD---IEWIARIL 219
           +      G+   K L + R   + ++S N          Y  +TV   +   +  I R++
Sbjct: 179 VYAIAIGGEAKIKRLYTLRNNGLRIVSDNQNKDSEGHRIYKDETVPPKEMDTVHIIGRVI 238


>gi|239908033|ref|YP_002954774.1| hypothetical protein DMR_33970 [Desulfovibrio magneticus RS-1]
 gi|239797899|dbj|BAH76888.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 235

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 67/216 (31%), Gaps = 11/216 (5%)

Query: 14  DRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGR----NRWPSTESIFKILAATNET 68
           +R A+   L + + LA   G+  ++  ++KR     +         T +    L      
Sbjct: 19  ERAAKAAGLASQAELAALLGVHRSAVTQAKRKEAVPKAWVLTVSRRTGADPDWLEYGRRR 78

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
                                      P   +      G F TG +   V  P  +    
Sbjct: 79  SGAGRGDGRGSAADDGAAVAAEIFAAVPKVRARLSAGGGSFETGGEVERV-YPFRQDWLR 137

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
                 ++         SM P  R GD+++++          +        ++ K +  R
Sbjct: 138 -AKGQPSRMVLMDVVGNSMEPEIRHGDMVLIDQGQTAVVAHGVYAVGLEDTVLVKRVEKR 196

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEW---IARILWA 221
            G+ + L+S N  Y    +   +++    I R+LW 
Sbjct: 197 PGQ-LVLLSDNRDYAPIVLAGDELDALRFIGRVLWV 231


>gi|146279124|ref|YP_001169283.1| LexA repressor [Rhodobacter sphaeroides ATCC 17025]
 gi|166224643|sp|A4WX64|LEXA_RHOS5 RecName: Full=LexA repressor
 gi|145557365|gb|ABP71978.1| SOS-response transcriptional repressor, LexA [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 228

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/223 (13%), Positives = 63/223 (28%), Gaps = 5/223 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++ + I    +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQMELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV 118
            + +                     ++ E          + +      G    G     +
Sbjct: 61  ARAIEIVKLPEAMERAGFAPRVIEGDRTEPPRGARPVETANALDLPLMGRIAAGLPIEAI 120

Query: 119 -GVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
               +  +  + + + + Q    + +  SM       GDI+++      + GD ++    
Sbjct: 121 TDGAQSVTVPSMMLSGRGQHYALEVRGDSMIEAGINDGDIVVIREQQTADNGDIVVALVA 180

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +   K    R G  I L   N  Y         ++   R++
Sbjct: 181 DHEATLKRFRRR-GGMIALEPANASYETQVYPDHMVKVQGRLV 222


>gi|239982724|ref|ZP_04705248.1| LexA repressor [Streptomyces albus J1074]
 gi|291454573|ref|ZP_06593963.1| LexA repressor [Streptomyces albus J1074]
 gi|291357522|gb|EFE84424.1| LexA repressor [Streptomyces albus J1074]
          Length = 261

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 52/219 (23%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 60  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 109

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                                        P   + P          +    +  +   +P
Sbjct: 110 --RDPHRPRAYEVRGSDQPSAQPADTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 167

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 168 RQLVG-------DGELFVLKVVGDSMIEAAICDGDWVTVRRQPVAENGDIVAAMLD-GEA 219

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         I L+  N  Y        +   + +++
Sbjct: 220 TVKRFKR-EDNHIWLLPHNAAYQPI--PGDEATILGKVV 255


>gi|196233812|ref|ZP_03132651.1| putative phage repressor [Chthoniobacter flavus Ellin428]
 gi|196222174|gb|EDY16705.1| putative phage repressor [Chthoniobacter flavus Ellin428]
          Length = 311

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 63/207 (30%), Gaps = 4/207 (1%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           +     R  L+   LA+  G               GR      E I ++L     T  +L
Sbjct: 100 LREALRRRELSAGQLAKLIGYKAPIVENVVHGT--GRISESMAEKIEEVLDH-EITKEEL 156

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           +    +         +    +     G            G+  N     E          
Sbjct: 157 MAGSETPITLDPTGFRGTMGMKPSTPGMRKVPLISWAAAGSLHNASAFDEDYDGEAIETN 216

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI-SRRGR 191
           +  +    K +  SM P    GDI ++ S I+   G  +L++   GD+  K        R
Sbjct: 217 VPGRVFSVKIEGDSMYPEINPGDIAVVRSDIEPRPGQVVLVRTLDGDVWCKRYSTRDGNR 276

Query: 192 SIDLMSLNCCYPVDTVEMSDIEWIARI 218
            + L S+N  Y    +    I WI  +
Sbjct: 277 FVVLSSINDTYRPFEISAESIAWIYPV 303


>gi|116251992|ref|YP_767830.1| LexA repressor [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988547|sp|Q1MH39|LEXA_RHIL3 RecName: Full=LexA repressor
 gi|115256640|emb|CAK07728.1| putative LexA repressor (SOS regulatory protein) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 239

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/233 (14%), Positives = 73/233 (31%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                + K+  A + +I        S    +  K + +       S +       V   G
Sbjct: 61  ARALEVIKLPEAYSPSIQPRRGFSPSVIEGSLGKPQPVATPAPAKSVADNGNSVSVPVMG 120

Query: 113 NKWNTVGVPEIRSPHNGIYAI-----QTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
                V +  I++  + I          +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|15965363|ref|NP_385716.1| LexA repressor [Sinorhizobium meliloti 1021]
 gi|307312740|ref|ZP_07592371.1| transcriptional repressor, LexA family [Sinorhizobium meliloti
           BL225C]
 gi|307317224|ref|ZP_07596665.1| transcriptional repressor, LexA family [Sinorhizobium meliloti
           AK83]
 gi|25453100|sp|Q92PW3|LEXA_RHIME RecName: Full=LexA repressor
 gi|15074543|emb|CAC46189.1| Putative LexA repressor transcription regulator [Sinorhizobium
           meliloti 1021]
 gi|306897312|gb|EFN28057.1| transcriptional repressor, LexA family [Sinorhizobium meliloti
           AK83]
 gi|306899465|gb|EFN30097.1| transcriptional repressor, LexA family [Sinorhizobium meliloti
           BL225C]
          Length = 238

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/232 (12%), Positives = 61/232 (26%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKI----LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
                + K+      A+         +                      + S      G 
Sbjct: 61  ARALEVIKLPEAYAGASQVRRGFSPSVIEGSLGKPAAPPPAPKPAPPAEAASVAVPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNC 167
              G   + +                 +    + +  SM       GD +I+ +    + 
Sbjct: 121 IAAGVPISAIQNNMHDISVPVEMIGSGEHYALEIKGDSMIEAGILDGDTVIIRNGSTASP 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K    +   SI L + N  Y         ++   R++
Sbjct: 181 GDIVVALIDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKIQGRLV 231


>gi|226366183|ref|YP_002783966.1| LexA repressor [Rhodococcus opacus B4]
 gi|226244673|dbj|BAH55021.1| LexA repressor [Rhodococcus opacus B4]
          Length = 243

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/223 (13%), Positives = 58/223 (26%), Gaps = 20/223 (8%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRW----PSTES 57
            +++ E I          PS   +    GL  TS   ++ +    +G  R     P    
Sbjct: 26  QRRVLEVIRTSVNERGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGFLRRDPNRPRAVD 85

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           +  +                     +      +P   F P          +       + 
Sbjct: 86  VRGLDEVAAGAAANAGAAVGLAAVKSGTDSAPLPEPTFVPVLGRIAAGGPILAEEAVEDV 145

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
             +P            Q      K    SM+      GD +++      + GD +     
Sbjct: 146 FPLPRELVG-------QGSLFLLKVVGESMIDAAICDGDWVVVRQQNVADNGDIVAAMID 198

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   K         + LM  N  +       +D   + +++
Sbjct: 199 -GEATVKTFKR-TDSEVWLMPHNPLFDPI--PGNDAAILGKVV 237


>gi|323156532|gb|EFZ42685.1| repressor protein C2 [Escherichia coli EPECa14]
          Length = 211

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/220 (11%), Positives = 67/220 (30%), Gaps = 28/220 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 2   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALAKALQCSP 56

Query: 70  C-----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                 +      +     + +     + +          +       + W         
Sbjct: 57  DYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHRRAIDNW--------- 107

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGD 179
             ++              +  SM         +G I++++  ++   G  ++       +
Sbjct: 108 --YDTTVDCSEDSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENE 165

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 166 ATFKKLVIDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 203


>gi|255264421|ref|ZP_05343763.1| LexA repressor [Thalassiobium sp. R2A62]
 gi|255106756|gb|EET49430.1| LexA repressor [Thalassiobium sp. R2A62]
          Length = 232

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 58/227 (25%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------S 54
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
             +I  +                                    + +      G    G  
Sbjct: 61  ARAIEIVKLPDAMADNGPRGFTPQVIEGDRPDSTPHDARPVETTHAIELPVMGKIAAGVP 120

Query: 115 WNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
              +          G   A   +    + +  SM+      GD++++      + GD ++
Sbjct: 121 IEAISHAAHSVAVPGGMVAGTCEHYALEVKGDSMIDAGINDGDVVVIKETSTADNGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K        SI L + N  Y         ++   R++
Sbjct: 181 ALVEDQEATLKRFRRNGA-SIALEAANPAYETRVFNDDQVKVQGRLV 226


>gi|227822058|ref|YP_002826029.1| LexA repressor [Sinorhizobium fredii NGR234]
 gi|227341058|gb|ACP25276.1| LexA repressor [Sinorhizobium fredii NGR234]
          Length = 254

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/230 (13%), Positives = 66/230 (28%), Gaps = 12/230 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 19  MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 78

Query: 53  PSTESIFKI--LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
                + K+    +      +       +G   +      P+     + S      G   
Sbjct: 79  ARALEVIKLPEAYSAPSQPRRGFSPSVIEGSLGKPPAAPKPVPAPAENTSMTVPVMGRIA 138

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGD 169
            G   + +                 +    + +  SM       GD +I+ +A   + GD
Sbjct: 139 AGVPISAIQNNTHEISVPVEMIGNGEHYALEIKGDSMIEAGILDGDTVIIRNANTASPGD 198

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 199 IVVALIDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKIQGKLV 247


>gi|237750719|ref|ZP_04581199.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229373809|gb|EEO24200.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 243

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/244 (11%), Positives = 65/244 (26%), Gaps = 41/244 (16%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           K+   I    E   LT + L + +G+   S    +           + +++ KI  A + 
Sbjct: 2   KLGLKIKTAREEKGLTQNDLVKISGVSRASLQLYEADKGN-----ITLDNLEKIANALDY 56

Query: 68  TICQL-----LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF------------------- 103
            +        +              ++        +    F                   
Sbjct: 57  EVVHFLSSNVVPQSKKTCPPICPSIEKNMSPNMSLNNICEFIENDSPLPPTQSNNSVRIP 116

Query: 104 -FDSGVFPTGNKWN-------TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGD 155
            +D      G  +         + + +               +    +  SMLP   +  
Sbjct: 117 VYDEVYASAGQGFINDEHITQHIELDKGFLRSYFGLTSFLDLSIITARGDSMLPAVPENC 176

Query: 156 ILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWI 215
            +I+        G   + +    ++  K L  R      L+S N  Y    +E  + E +
Sbjct: 177 QIIVQKG-TPREGQICVTRID-DELYVKRLQKRP--KYKLISDNKSYDDIELEGENYEIL 232

Query: 216 ARIL 219
             ++
Sbjct: 233 GIVV 236


>gi|111023746|ref|YP_706718.1| LexA repressor [Rhodococcus jostii RHA1]
 gi|110823276|gb|ABG98560.1| repressor LexA [Rhodococcus jostii RHA1]
          Length = 243

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/223 (13%), Positives = 57/223 (25%), Gaps = 20/223 (8%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRW----PSTES 57
            +++ E I          PS   +    GL  TS   ++ +    +G  R     P    
Sbjct: 26  QRRVLEVIRTSVNERGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGFLRRDPNRPRAVD 85

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           +  +                     +      +P   F P          +       + 
Sbjct: 86  VRGLDEVAAGAAANASAAVGLAAVKSGADGAPLPEPTFVPVLGRIAAGGPILAEEAVEDV 145

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
             +P            Q      K    SM+      GD +++        GD +     
Sbjct: 146 FPLPRELVG-------QGSLFLLKVVGESMIDAAICDGDWVVVRQQNVAENGDIVAAMID 198

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   K         + LM  N  +       +D   + +++
Sbjct: 199 -GEATVKTFKRTENE-VWLMPHNPLFDPI--PGNDAVILGKVV 237


>gi|260853764|ref|YP_003227655.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|293403667|ref|ZP_06647758.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298379279|ref|ZP_06989160.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|300903179|ref|ZP_07121111.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|300929088|ref|ZP_07144582.1| peptidase S24-like domain protein [Escherichia coli MS 187-1]
 gi|301019699|ref|ZP_07183852.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
 gi|301301704|ref|ZP_07207839.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|257752413|dbj|BAI23915.1| putative phage repressor protein CI [Escherichia coli O26:H11 str.
           11368]
 gi|291429520|gb|EFF02540.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298280392|gb|EFI21896.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|299882087|gb|EFI90298.1| peptidase S24-like domain protein [Escherichia coli MS 196-1]
 gi|300404794|gb|EFJ88332.1| peptidase S24-like domain protein [Escherichia coli MS 84-1]
 gi|300462961|gb|EFK26454.1| peptidase S24-like domain protein [Escherichia coli MS 187-1]
 gi|300843201|gb|EFK70961.1| peptidase S24-like domain protein [Escherichia coli MS 124-1]
 gi|315252878|gb|EFU32846.1| peptidase S24-like domain protein [Escherichia coli MS 85-1]
 gi|323965045|gb|EGB60506.1| peptidase S24 [Escherichia coli M863]
          Length = 229

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 7   ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 61  WLSSGVGNMSDSTVQPIQSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 117

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 118 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 177

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 178 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 218


>gi|88706898|ref|ZP_01104597.1| Peptidase S24-like protein [Congregibacter litoralis KT71]
 gi|88698820|gb|EAQ95940.1| Peptidase S24-like protein [Congregibacter litoralis KT71]
          Length = 222

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 80/224 (35%), Gaps = 13/224 (5%)

Query: 1   MTSFSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF--GIEGRNRWPSTES 57
           MT   H  I  + ++ +      +   LAR AG + +  ++ +      +G  R    + 
Sbjct: 1   MT-RKHIPIRLKNLEALIREAG-SAVRLARAAGTNSSYLSQVRNQLPTKKGTPRAIGDDL 58

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
             K+ AA N+    + +        T              S         V    +    
Sbjct: 59  ASKLEAAMNKPPGWMDEEH-----PTGPDLTAERDESNTGSQHRLIPWDQVGKGHDISED 113

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK-PR 176
           +  P   +          +    + +  SM P +R+G+++ ++    V  G  ++++   
Sbjct: 114 LPPPYGTTLLRCPVECSPETFVLRVRGASMEPKFREGELIFVDPQAPVEHGKFVVVRLEE 173

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL 219
           + ++  K LI   G+   L +LN  +P   +E++ D      I+
Sbjct: 174 SNEVTFKQLILEEGKKY-LKTLNPDWPNRIIEVNPDTPICGVII 216


>gi|85708726|ref|ZP_01039792.1| LexA repressor [Erythrobacter sp. NAP1]
 gi|85690260|gb|EAQ30263.1| LexA repressor [Erythrobacter sp. NAP1]
          Length = 234

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 57/227 (25%), Gaps = 12/227 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS-----FNKSKRFGIEGRN--R 51
           M +    ++   I +  E   ++PS   +     L   S      +  +  G   R   R
Sbjct: 1   MLTAKQHELIRFIQQRLEETGISPSFEEMKEALDLKSKSGVHRLISALEERGFIRRLPNR 60

Query: 52  WPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT 111
             + E I     A      Q      +           +     P +        G    
Sbjct: 61  ARALEVIKVPEDAVTSPRSQAAPAALAANEAVASASSVMARAPEPANDVIEIPLHGRIAA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           G     +   +   P         +    +    SM       GD  ++        G+ 
Sbjct: 121 GAPIEALE-GQNSLPVPAALLGPGEHYALEVSGDSMIEAGIFDGDFALVRRTNTARDGEI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
           ++   R  +   K L       + L   N  Y        ++E   +
Sbjct: 180 VVALVRGEEATLKYLHKEGA-MVRLDPANATYDAQVYGPDEVEVQGK 225


>gi|256375571|ref|YP_003099231.1| SOS-response transcriptional repressor, LexA [Actinosynnema mirum
           DSM 43827]
 gi|255919874|gb|ACU35385.1| SOS-response transcriptional repressor, LexA [Actinosynnema mirum
           DSM 43827]
          Length = 235

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/223 (12%), Positives = 63/223 (28%), Gaps = 31/223 (13%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTES 57
           +   +K+ + I    +R    PS   +    GL  TS    +   +E +    R P+   
Sbjct: 32  TLRQRKVLDVIRDWVDRFGYPPSVREIGEAVGLTSTSSVAHQLRALERKGFLRRDPNRPR 91

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
              +L                    T       P   + P          +    +  + 
Sbjct: 92  AVGVL---------------PAEIVTGLDPAAKPTPAYVPMLGRIAAGGPILAEQSIEDV 136

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
             +P            + +    K    SM+      GD +++      + G+ ++    
Sbjct: 137 FPLPREIVG-------EGEVFLLKVVGDSMVDAAITDGDWVVVRQQPTADNGE-VVAAMI 188

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   K    +    + L+  N  Y        +   + +++
Sbjct: 189 EGEATVKTFKRKDDGHVWLLPQNPAYQPIF--GDEATILGKVV 229


>gi|218289122|ref|ZP_03493358.1| transcriptional repressor, LexA family [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240705|gb|EED07884.1| transcriptional repressor, LexA family [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 202

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/226 (13%), Positives = 62/226 (27%), Gaps = 38/226 (16%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M+  + ++  I E I +        PS   +    GL   ++ +   +R   +G  R   
Sbjct: 1   MSGLTARQRAILEFIRKNIREKGYPPSVREIGEAVGLASSSTVHGHLERLQQKGYLR--- 57

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
                                       T+ +  E+ +    P         G    G  
Sbjct: 58  -------------------------RDPTKPRALELLVDDEEPGDVVLAPIVGRVTAGLP 92

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLI 173
            + +   E   P     A   +    +    SM+      GD+ I+      + GD ++ 
Sbjct: 93  ISALEDIEGYLPLPRDVAKGDEVFALRVVGESMINAGILDGDLAIVRRQTSADNGDIVVA 152

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K         + L   N   P        +  + +++
Sbjct: 153 MTDEDEATIKRFYR-EDGRVRLQPENDDMPPLYFPN--VTILGKVI 195


>gi|154248291|ref|YP_001419249.1| LexA repressor [Xanthobacter autotrophicus Py2]
 gi|229470196|sp|A7INJ8|LEXA_XANP2 RecName: Full=LexA repressor
 gi|154162376|gb|ABS69592.1| SOS-response transcriptional repressor, LexA [Xanthobacter
           autotrophicus Py2]
          Length = 237

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/232 (12%), Positives = 56/232 (24%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     +   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYDLLRFIHERLKETGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAA----------TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGV 108
            + L                         S    +  K +                  G 
Sbjct: 61  ARALEVVRLPDSVAPGLATPRSASRGFSPSVIEGSLGKVRPAADDDEGAGQVVTVPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNC 167
              G+  + +                 +    + +  SM       GD +++      + 
Sbjct: 121 IAAGSPISAIQTRSHTLNIPPEMLGSGEHFALEVRGDSMIEAGILDGDTVLIRKCDTADT 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K L  +   SI L + N  Y         +    R++
Sbjct: 181 GDIIVALVDDEEATLKRLRKKGA-SIALEAANPAYETRIFGPDRVRIQGRLI 231


>gi|331657741|ref|ZP_08358703.1| repressor protein C2 [Escherichia coli TA206]
 gi|315299798|gb|EFU59038.1| peptidase S24-like domain protein [Escherichia coli MS 16-3]
 gi|331055989|gb|EGI27998.1| repressor protein C2 [Escherichia coli TA206]
          Length = 216

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 66/219 (30%), Gaps = 26/219 (11%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 7   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALAKALQCSP 61

Query: 70  C----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
                    L      +        PL+ +  +G                N        S
Sbjct: 62  DYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHK-RAIDNWYDTTVDCS 120

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
                            +  SM         +G I++++  ++   G  ++       + 
Sbjct: 121 E---------DSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENEA 171

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 172 TFKKLVIDAGRRF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|319957707|ref|YP_004168970.1| phage repressor [Nitratifractor salsuginis DSM 16511]
 gi|319420111|gb|ADV47221.1| putative phage repressor [Nitratifractor salsuginis DSM 16511]
          Length = 218

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 57/195 (29%), Gaps = 9/195 (4%)

Query: 25  SGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTE 84
             +A + G+   +F   K+ G       P  E +               D P        
Sbjct: 27  KDVAAELGIGQATFATMKKRGSI-----PYKEIMEFCARRKISINWLFFDQPAEMLVEET 81

Query: 85  KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQD 144
            K   +       + +GG  D         +  + V      +               + 
Sbjct: 82  GKFFRVRYFADIRASAGGGADVFN----ENYEYIDVDRTLMENLVGAYPSKGIEAIHVEG 137

Query: 145 TSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPV 204
            SM P    G I+ ++        D + +      +  K +  R    ++L+S N  Y  
Sbjct: 138 ESMEPTLPDGSIVFIDREQTDPSKDGIFVAATGNGLFIKRIRRRADGMVELISDNPLYTP 197

Query: 205 DTVEMSDIEWIARIL 219
           + +    +E + R++
Sbjct: 198 EVLSPDQVEIVGRVV 212


>gi|262372962|ref|ZP_06066241.1| LexA repressor [Acinetobacter junii SH205]
 gi|262312987|gb|EEY94072.1| LexA repressor [Acinetobacter junii SH205]
          Length = 224

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/223 (13%), Positives = 70/223 (31%), Gaps = 24/223 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +       + +  + +   +T   LA+K+G+  +  +  +    +      ST SI +
Sbjct: 5   MATL-----GDNLKSIRKAKKMTQKELAQKSGVKQSVISDLETGNAK------STGSILE 53

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +  A   T  +L     S             +       +G           N    +  
Sbjct: 54  LANALGVTAEELKKGVISTLDNNVAPVSSKLIPVLSWVQAGTMTSVEAIDPKNINEWLP- 112

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSA---IQVNCGDRLLIKPRT 177
                               +    S  P Y  GD +++N +     +   D ++++  +
Sbjct: 113 -------PLSVDDPDGCFYLRVVGVSNYPTYADGDYILVNPSYQVCDLISEDLVVVRSNS 165

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
                K L+        L +LN  +  + +E  + +E +  ++
Sbjct: 166 D-ATFKKLVIESDERKYLQALNPNFQPNIIEFEEGMELVGLVI 207


>gi|146329855|ref|YP_001209677.1| regulatory protein RegA2 [Dichelobacter nodosus VCS1703A]
 gi|146233325|gb|ABQ14303.1| regulatory protein RegA2 [Dichelobacter nodosus VCS1703A]
          Length = 305

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 66/227 (29%), Gaps = 19/227 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   +  + E +NL+   LA K G    +  K +        R    + +   L  ++  
Sbjct: 76  LASNVKILRELNNLSQDQLAEKIGKSQAAIQKIEAGLT---LRPRFLQDLANALGVSSID 132

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG---------GFFDSGVFPTGNK----- 114
           +           +  E     +       S             FF    F  G       
Sbjct: 133 LEYKDFEKELKKQAIESDIGTMGKFRLWSSNDPLPEDEYAYLPFFKDVEFQGGTGCCEMQ 192

Query: 115 -WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            +N   +P  +S  +       Q         SM P+  KG  L +N A  V     +  
Sbjct: 193 DYNGFRLPFAKSTLHRYGVPLDQAFCVTLTGNSMEPVIPKGSTLGINKADTVLKEGDIYA 252

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIEWIARIL 219
             +      K L       I + S N   Y  + V   +IE I R+ 
Sbjct: 253 IRQDDLFRVKRLYHAPNGMIRISSFNQEEYKDELVRPENIEIIGRVF 299


>gi|146328782|ref|YP_001209185.1| regulatory protein RegA1 [Dichelobacter nodosus VCS1703A]
 gi|1628367|emb|CAA67160.1| regulatory protein [Dichelobacter nodosus]
 gi|146232252|gb|ABQ13230.1| regulatory protein RegA1 [Dichelobacter nodosus VCS1703A]
          Length = 232

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 66/227 (29%), Gaps = 19/227 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   +  + E +NL+   LA K G    +  K +        R    + +   L  ++  
Sbjct: 3   LASNVKILRELNNLSQDQLAEKIGKSQAAIQKIEAGLT---LRPRFLQDLANALGVSSID 59

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG---------GFFDSGVFPTGNK----- 114
           +           +  E     +       S             FF    F  G       
Sbjct: 60  LEYKDFEKELKKQAIESDIGTMGKFRLWSSNDPLPEDEYAYLPFFKDVEFQGGTGCCEMQ 119

Query: 115 -WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
            +N   +P  +S  +       Q         SM P+  KG  L +N A  V     +  
Sbjct: 120 DYNGFRLPFAKSTLHRYGVPLDQAFCVTLTGNSMEPVIPKGSTLGINKADTVLKEGDIYA 179

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIEWIARIL 219
             +      K L       I + S N   Y  + V   +IE I R+ 
Sbjct: 180 IRQDDLFRVKRLYHAPNGMIRISSFNQEEYKDELVRPENIEIIGRVF 226


>gi|320008142|gb|ADW02992.1| transcriptional repressor, LexA family [Streptomyces flavogriseus
           ATCC 33331]
          Length = 265

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 54/219 (24%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 64  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 113

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                               T +      P   + P          +    +  +   +P
Sbjct: 114 --RDPHRPRAYEVRGSDQPSTQQTDTTGKPAASYVPLVGRIAAGGPILAEESVEDVFPLP 171

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                         +    K    SM       GD + +        GD +      G+ 
Sbjct: 172 RQLVG-------DGELFVLKVVGDSMIEAAIMDGDWVTVRRQPVAENGDIVAAMLD-GEA 223

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K         + L+  N  Y        +   + +++
Sbjct: 224 TVKRFKR-EDGHVWLLPHNAAYQPI--PGDEATILGKVV 259


>gi|315929228|gb|EFV08447.1| helix-turn-helix family protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 236

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 73/231 (31%), Gaps = 31/231 (13%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    E    T + L+ K+G+  ++  K +   ++      +  ++ KI +A N +   
Sbjct: 6   RMKEYREYFGWTQTDLSEKSGVSISTIKKYEAGSVD----NFTYGNLKKIASAFNLSPAS 61

Query: 72  LLDLPFSDGRTTEKKEKEIPLLYFP----------------PSGSGGFFDSGVFPTGNKW 115
            +    SD   T   +     +                      +  FF++     G+  
Sbjct: 62  FISENMSDNSPTISNKICPTNVKNCPTSNVILENFTQTLNDDMINIPFFENVRASAGSGA 121

Query: 116 NTVGVPEIRSPHNGIYAIQT-------QDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG 168
                       +  +  +          +    Q  SM P   +   L++        G
Sbjct: 122 YNDEESTQALGLSKSFLRECFGLYSFINLSVILGQGDSMTPTLPENCYLLIQQGEVAE-G 180

Query: 169 DRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +  + +    ++  K L  R    + L+S N  Y    +E  + E + R++
Sbjct: 181 EICVTRI-EDELYVKRLQKRP--KLKLLSDNKAYEPINLEGENFEILGRVV 228


>gi|311105237|ref|YP_003978090.1| hypothetical protein AXYL_02046 [Achromobacter xylosoxidans A8]
 gi|310759926|gb|ADP15375.1| helix-turn-helix family protein 5 [Achromobacter xylosoxidans A8]
          Length = 245

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 72/221 (32%), Gaps = 25/221 (11%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + + I +  +    T   LA + G D  + ++ +R       +  S E + KI AA    
Sbjct: 31  LGDNIRQRRKALGWTILDLANRIGSDVGNVSRLERG-----KQGYSDEILAKIAAALGCP 85

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           + +L      +            +       +G              + V          
Sbjct: 86  VGELFLGVEKESNVELTALGSRRIPVLSYVQAGALT----------ESVVPYTNPDDWLL 135

Query: 129 GIYAIQTQDTRHKTQDTSM-----LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
               +       + +  SM        + +GD+++++ +++   GD ++ K    +   K
Sbjct: 136 TDLDLSRSAFALRIKGLSMYSPQSEESFNEGDLVVIDPSVEPLPGDFVVAKNGDHEATFK 195

Query: 184 VLISRRGRS-----IDLMSLNCCYPVDTVEMSDIEWIARIL 219
               R          +L+ LN  YP    + + ++ I  ++
Sbjct: 196 KYRPRGVNEKGVVVFELVPLNPDYPSVRSDYTQVQIIGTMV 236


>gi|330836793|ref|YP_004411434.1| putative phage repressor [Spirochaeta coccoides DSM 17374]
 gi|329748696|gb|AEC02052.1| putative phage repressor [Spirochaeta coccoides DSM 17374]
          Length = 232

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/226 (12%), Positives = 69/226 (30%), Gaps = 15/226 (6%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRN-------RWPSTESIFKI 61
           + + + +      L+   LA++ GL  +++ K +  G            R  +   +   
Sbjct: 2   VGDRLKQARNEMRLSQMQLAKELGLAQSTYAKYELGGAIPEPVMQFLAQRQFNLHWLITG 61

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-- 119
             +          L      T    + +   +            +     G     +   
Sbjct: 62  QGSMYLDGSGTDTLEPIAASTFITPKGKTYAVTIAEGVVSVPILTQRVSAGPGQEFLPAD 121

Query: 120 VPEIRSPHNGIYAI---QTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
           + E R P    +     +      + +  SM    +  D  ++    +   GD + +   
Sbjct: 122 ITEERLPVLERFVRMYPKESLFAAEVRGDSMT-GIQLFDADLVIFVREQVEGDGIYVLSV 180

Query: 177 TGDIVAKVLISRR-GRSIDLMSLNCCYPVDTVEMSDIEWIARIL-W 220
            G++  K +      + + + S N  Y    VE   +E + +++ W
Sbjct: 181 DGEVFVKRVEFDPFDKKLTIRSENERYAPREVEADRVELLGKVVGW 226


>gi|306844008|ref|ZP_07476603.1| LexA repressor [Brucella sp. BO1]
 gi|306275763|gb|EFM57487.1| LexA repressor [Brucella sp. BO1]
          Length = 240

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/235 (11%), Positives = 55/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDG-------------RTTEKKEKEIPLLYFPPSGSGGFFD 105
            + L            L                     +               +     
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVAPVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K    +   SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|222148888|ref|YP_002549845.1| LexA repressor [Agrobacterium vitis S4]
 gi|254809084|sp|B9JX59|LEXA_AGRVS RecName: Full=LexA repressor
 gi|221735874|gb|ACM36837.1| LexA repressor [Agrobacterium vitis S4]
          Length = 239

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/233 (13%), Positives = 65/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +   +++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILA--ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG---------GFFDSG 107
            + L      E +   +    +    +  +     L   P + +               G
Sbjct: 61  ARALEVIKLPEAMTSSIPPRRTGFSPSVIEGSRGKLQAVPSAPAKQVEEVRNSSSIPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM       GD +I+ +A   N
Sbjct: 121 RIAAGVPISAIQNNTHDISVPMEMLGSGEHYALEVKGDSMIEAGILDGDTVIIRNATTAN 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    R   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRRGA-SIALEAANPAYETRIFGPDRVKIQGKLV 232


>gi|145641568|ref|ZP_01797145.1| predicted transcriptional regulator [Haemophilus influenzae R3021]
 gi|145273615|gb|EDK13484.1| predicted transcriptional regulator [Haemophilus influenzae
           22.4-21]
          Length = 231

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 62/227 (27%), Gaps = 11/227 (4%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAA-- 64
             + E +  + ++       LA  AG    + +       +            KI     
Sbjct: 2   NTLAERLQLVMDKMGKNQVELAALAGTSQVTISNILNGVTKSPRNGLQIAKALKISPEWL 61

Query: 65  -TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK-------WN 116
                      +  +   T      +             F+       GN        +N
Sbjct: 62  LNGTGEMAQTQIESNVAETGSFDLWDRNTPLNDDEVEVPFYKDIRLAAGNGFADDIADYN 121

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPR 176
              +   +S                    SM P+   G  + ++   +     ++     
Sbjct: 122 NFKLRFSKSTLRKQGVQYENAVCVTADGNSMEPVIPDGTTVGIDLGNKTIRDGKIYAINH 181

Query: 177 TGDIVAKVLISRRGRSIDLMSLN-CCYPVDTVEMSDIEWIARILWAS 222
            G +  K+L +     + + S N   +P +T ++ DI  + ++ W S
Sbjct: 182 GGLLRIKLLYNMPNEQVKIRSYNSEEHPDETADLKDISVLGKVFWYS 228


>gi|159044352|ref|YP_001533146.1| LexA repressor [Dinoroseobacter shibae DFL 12]
 gi|189046535|sp|A8LMK0|LEXA_DINSH RecName: Full=LexA repressor
 gi|157912112|gb|ABV93545.1| lexA repressor [Dinoroseobacter shibae DFL 12]
          Length = 231

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/229 (16%), Positives = 69/229 (30%), Gaps = 14/229 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNR--------W 52
           M +    ++ E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTRKQIELLEFIHKRLQRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHK 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  A   ++         DG   +     +P+       +      G    G
Sbjct: 61  ARAIEIVKLPEALMGSMQGGFAPQVIDGDRLDPPVGAMPV---SGIHAVELPVMGKIAAG 117

Query: 113 NKWNTVGVPEIRSPHNGIYAIQT-QDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +          G    Q  +    + +  SM+      GDI+++        GD 
Sbjct: 118 TPIEAISEVSHTVAVPGQMMRQDAEHYALEVKGDSMINAGINNGDIVVIRETSVAESGDI 177

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K L  +RG +I L + N  Y         +    +++
Sbjct: 178 VVALVDGHEATLKTL-RKRGNAIALEAANPAYETRVYPAEMVRVQGKLV 225


>gi|312195032|ref|YP_004015093.1| LexA family transcriptional regulator [Frankia sp. EuI1c]
 gi|311226368|gb|ADP79223.1| transcriptional repressor, LexA family [Frankia sp. EuI1c]
          Length = 278

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 60/234 (25%), Gaps = 23/234 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
            +K+ E I    ER    PS   +    GL  TS    +   +E +    R P+     +
Sbjct: 42  QRKVLEVIRDAVERRGYPPSVREIGEAVGLTSTSSVAHQLKMLEDKGFLRRDPNRPRAIE 101

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG------------- 107
           ++ +  E   + L     D    + +                  D               
Sbjct: 102 VVTSEGEAPIRPLPKTRPDLAAGKGRTPLRVHTLGSDDDVRADDDENAQLTAATAYLPLV 161

Query: 108 -VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV 165
                G         E   P       +      +    SM+      GD++ +      
Sbjct: 162 GRIAAGGPILAEQAVEDVLPLPREIVGEGTLFLLRVVGESMINAAICDGDLVAVRQQPVA 221

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             G+ +      G+   K         + L   N  +        D   + R++
Sbjct: 222 ENGEIVAAMID-GEATVKRFRRHDDGHVWLQPENPAFHDI--AGDDATILGRVV 272


>gi|78357023|ref|YP_388472.1| transcriptional regulator [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219428|gb|ABB38777.1| transcriptional regulator, putative [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 219

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 64/230 (27%), Gaps = 23/230 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   S    +  +    E +  T   LAR  G++ ++ +++K+              + K
Sbjct: 1   MEKLSFDTFFRRVKESTEIN--TQQALARALGVNRSAVSQAKQREKVPEK------WVLK 52

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           I      +   L     S         +                       G     VG 
Sbjct: 53  IARMFALSPDWLESGSGSH------ALRTAASDMADGIFIPVPKVEAKLSAGGGSLEVGA 106

Query: 121 PEI-----RSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
                    S                    SM P    GD ++++   Q      +    
Sbjct: 107 TATGEHLFHSTWLRRKGNPADMVLMDVVGDSMEPEIFAGDTVLVDQGNQTLRNGAIFAMG 166

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARILWAS 222
               ++ K + S     + L+S N  Y    ++  +IE    I +++W S
Sbjct: 167 VDDSVLVKRVQSAPEG-LVLLSENPSYSPVLLQGDEIETVRVIGKVIWIS 215


>gi|91224299|ref|ZP_01259561.1| putative cI prophage repressor protein [Vibrio alginolyticus 12G01]
 gi|91190641|gb|EAS76908.1| putative cI prophage repressor protein [Vibrio alginolyticus 12G01]
          Length = 209

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/211 (14%), Positives = 68/211 (32%), Gaps = 17/211 (8%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            +   +T + LA   G+  ++           +NR PS E++  I+     T        
Sbjct: 1   MKEVGITQNALAEMMGVSQSAIAHWLS-----KNREPSIENVAAIMKCVGLTHMT--LDS 53

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG---VPEIRSPHNGIYAI 133
                  +     +  L   P+    F        G     +    + EI   +      
Sbjct: 54  EGFIDYPDDSIANVTKLDIQPTYQKSFPVLSSVQAGQWHEAIEPYSIEEISEWYPTTERC 113

Query: 134 QTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDIVAKVLISR 188
             +      Q  SM       + +G ++++++ +    G  ++       +   K  I  
Sbjct: 114 SERCFWLTVQGDSMTSPTGVSFPEGTMVLVDTEVDAENGKLVVAKLTDVNEATFKKFIVD 173

Query: 189 RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   L +LN  +P+  +  +  + I  ++
Sbjct: 174 SGQKY-LKALNPAFPILPINGN-CKIIGVVI 202


>gi|220904093|ref|YP_002479405.1| putative phage repressor [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868392|gb|ACL48727.1| putative phage repressor [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 229

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 67/223 (30%), Gaps = 19/223 (8%)

Query: 11  EAIDRMAERHNLTP-SGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + + R+ +  N +  + LAR  G+ P S + +++ G            +    AAT    
Sbjct: 9   KTLHRLMQAMNASNDAELARALGITPQSISGARKRGEVPPA------WVQASAAATGVNA 62

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGS-GGFFDSGVFPTGNKWNTV-GVPEIRSPH 127
             L             + +   +     +              G     V    E     
Sbjct: 63  HWLFFGSGPMRLPEAAEGELPSMHGDCEADLIHVPLAEARLSAGTGSLEVSERSEDSYAF 122

Query: 128 NGIYA----IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
            G +        +    +    SM+P     D+++L+         RL        I  K
Sbjct: 123 RGDFLRRKGNPRRMVLMRVSGDSMVPEIFDNDLVLLDKGQTEISPGRLYAVGFEDAIYIK 182

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
            +       I L S+N  YP  +++           I R+LW+
Sbjct: 183 RIDKVP-GKIILHSVNPAYPPVSLDLRGDLADQFRVIGRVLWS 224


>gi|158338892|ref|YP_001520069.1| S24 family peptidase [Acaryochloris marina MBIC11017]
 gi|158309133|gb|ABW30750.1| peptidase, S24 family [Acaryochloris marina MBIC11017]
          Length = 227

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 64/202 (31%), Gaps = 10/202 (4%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
             + LA+  G++  +  K        RN     E + + L    E +             
Sbjct: 27  NATHLAKVVGVNDRTIRKWMAGTEPARN---YLELLAEKLEVNIEWLVLGRGPIRRADGG 83

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKT 142
                     LY   +G+G    +           +           +       +    
Sbjct: 84  IGDGTYVQIPLYDVRAGAGEGMIAEDK--EQIEELMAFSRSWIRSE-LRTSPAHLSLIHV 140

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCY 202
              SM P  R GD+++++        D + +  R G +  K L    G+ + ++S N  Y
Sbjct: 141 SGDSMEPTLRPGDVVLVDQHQAEGGTDGVYVLRRDGHLQIKRLHWLSGKVLKIISDNPIY 200

Query: 203 PVDTVEM----SDIEWIARILW 220
               V++     + + I R++W
Sbjct: 201 QPIEVDLSQLTEEFQIIGRVIW 222


>gi|331701909|ref|YP_004398868.1| phage repressor like XRE family transcriptional regulator
           [Lactobacillus buchneri NRRL B-30929]
 gi|329129252|gb|AEB73805.1| phage repressor like transcriptional regulator, XRE family
           [Lactobacillus buchneri NRRL B-30929]
          Length = 237

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 70/234 (29%), Gaps = 27/234 (11%)

Query: 12  AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ 71
            +    +  NLT   + +  G+  ++  K +   IE   R     ++ K L  +   I  
Sbjct: 4   NLRNRRKELNLTLEEVGKMVGVGKSTIRKWETGYIENMKRD-KIIALSKALKVSPMDIID 62

Query: 72  LLDLPFSDGRTTE-------KKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                 +                ++  +  +         +  V    N    V +P  R
Sbjct: 63  PNKEISNPMIDKIEEISIQLHPSRQEKVYNYASDQLDEQNNEKVTSMFNHKPLVDIPYGR 122

Query: 125 SPHNGIYAIQTQ-------------------DTRHKTQDTSMLPLYRKGDILILNSAIQV 165
           S   G                          D        SM PL +KG  + ++   +V
Sbjct: 123 STAAGSPINGEDQDTQLIHKLIAGEKVPAGADELITVDGDSMEPLLKKGSQVFIHYQPEV 182

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             G+  ++  R   +  K        ++ L S+N  Y     +  ++  I +++
Sbjct: 183 ENGEIAIVHIRDVGVTCKKFYVNEDNTVTLKSINEAYDDMVFDCDEVNVIGKVI 236


>gi|327189236|gb|EGE56415.1| transcriptional regulator repressor protein LexA protein [Rhizobium
           etli CNPAF512]
          Length = 239

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/233 (12%), Positives = 63/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A + ++        S                          S      G
Sbjct: 61  ARALEVIKLPEAYSPSLQPRRGFSPSVIEGSLGKPQPVAAPAAAKPIADNGNSVSVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|320659907|gb|EFX27453.1| repressor protein CI [Escherichia coli O55:H7 str. USDA 5905]
          Length = 217

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 57/216 (26%), Gaps = 19/216 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS   I  +            
Sbjct: 8   RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLSDIGVVFKYLGIDNISFN 62

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                                +P             P    +       + S        
Sbjct: 63  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGM--FSPELRTFTKGDAERLVSTTQKA--- 117

Query: 134 QTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  + +  SM       P +  G +++++    V  GD  + +    +   K LI 
Sbjct: 118 SDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIR 177

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             G+   L  LN  YP+          + +++ ASQ
Sbjct: 178 DSGQVF-LQPLNPQYPMIPCN-ESCSVVGKVI-ASQ 210


>gi|190891622|ref|YP_001978164.1| transcriptional regulator repressor protein LexA protein [Rhizobium
           etli CIAT 652]
 gi|229621743|sp|B3PYQ7|LEXA_RHIE6 RecName: Full=LexA repressor
 gi|190696901|gb|ACE90986.1| transcriptional regulator repressor protein LexA protein [Rhizobium
           etli CIAT 652]
          Length = 239

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/233 (12%), Positives = 63/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A + ++        S                          S      G
Sbjct: 61  ARALEVIKLPEAYSPSLQPRRGFSPSVIEGSLGKPPAVAAPAAAKPIADNGNSVSVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|182678402|ref|YP_001832548.1| LexA repressor [Beijerinckia indica subsp. indica ATCC 9039]
 gi|229621196|sp|B2IKM0|LEXA_BEII9 RecName: Full=LexA repressor
 gi|182634285|gb|ACB95059.1| transcriptional repressor, LexA family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 237

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/232 (11%), Positives = 58/232 (25%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++   I    +   + PS    K  LD  S +   R  +    R      P+ 
Sbjct: 1   MLTKKQSELLRFIHERLKETGVPPSFDEMKEALDLRSKSGIHRLVMALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTE-------KKEKEIPLLYFPPSGSGGFFDSGV 108
               +++   +     +         +         +              +      G 
Sbjct: 61  ARALEVVRLPDAATPPVPPHGRKFSPSVIEGDLGRVRPHTPHTDDEDSELTTVAIPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNC 167
              G   + +                 +    + +  SM+       D +I+        
Sbjct: 121 IAAGTPISALQHRSHTIGLPMDMLPAGEHYALEVRGDSMIDAGILDADTVIIRRQDNAEN 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K L  R   SI L   N  Y         +    +++
Sbjct: 181 GDIVVALIDDEEATLKRLRRRGA-SIALEPANSAYETRIFGPDRVRIQGKLV 231


>gi|163731991|ref|ZP_02139437.1| LexA repressor [Roseobacter litoralis Och 149]
 gi|161394289|gb|EDQ18612.1| LexA repressor [Roseobacter litoralis Och 149]
          Length = 233

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 65/229 (28%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  A              +G   +             + +      G    G
Sbjct: 61  ARAIEIVKLPEALGGAAQGRFTPRVIEGDKPDAPLPAGAQA-VSSADAVSLPLVGRIAAG 119

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDR 170
                +          G   + +      + +  SM+      GD++++      + GD 
Sbjct: 120 LPIEAINQNSASVAVPGQMLSGKGDHYALEVKGDSMIDAGINDGDVVVIRETSAADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K  + R G SI L + N  Y         ++   +++
Sbjct: 180 VVALIEDHEATLKRYMRR-GSSIALEAANPAYETRVFTEDKVKVQGKLV 227


>gi|152978883|ref|YP_001344512.1| putative phage repressor [Actinobacillus succinogenes 130Z]
 gi|150840606|gb|ABR74577.1| putative phage repressor [Actinobacillus succinogenes 130Z]
          Length = 228

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/233 (14%), Positives = 71/233 (30%), Gaps = 34/233 (14%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +   +++  A     ++  L  + LA  +G    + +       +   +        +
Sbjct: 1   MKTL-PERLLFA----MQQKGLNQAELASMSGTSQVTISNILNGVTDVPRKGL------E 49

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           I  A + ++  LL         + K  K   ++                  G+    +  
Sbjct: 50  IANALDVSLNWLLTGVEDSVTVSTKSGKNDSIIMT--------LLDNRLAAGDGVINLDY 101

Query: 121 PEIRSPHNGIYAIQTQDTRHK---------TQDTSMLP------LYRKGDILILNSAIQV 165
           P+             +  R K             SM          + GD++ ++++IQ 
Sbjct: 102 PDTIRSIEFSAEKFMELFRRKTANNLSMAIIDGNSMYDPNNEEISLKHGDVVFIDTSIQE 161

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              D +      G    K L    G  + ++S N  Y  + +E   +E I  I
Sbjct: 162 FKNDGIYAFVFEGQARIKRLQYMSGYRLKVISDNPTYETEILEKEQVEQIHFI 214


>gi|329726858|gb|EGG63318.1| peptidase S24-like protein [Staphylococcus epidermidis VCU144]
          Length = 208

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/225 (12%), Positives = 72/225 (32%), Gaps = 24/225 (10%)

Query: 3   SFSHKKIWE-AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              +K++    I R+ + +N+    L+    +  T+ +       +   R    E +   
Sbjct: 1   MLGNKQVMAKNISRLMKENNIDRKKLSNDLKVKYTTLSDWIN--AKTYPRIDKIELLADY 58

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
              T   + +  +    +             +   P  S       ++   N  + +   
Sbjct: 59  FNVTKADLVEDKEKQVLETLP----------VKKIPVVSKISAGLPIYSEENLIDYIYF- 107

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                         ++   K    +M  +++ GDI+++     V  G   ++     +  
Sbjct: 108 -----ATNKLNSDKEEFGLKVSGDNMDKIFQDGDIVVVEKDSIVENGQLGVVMINGYNAT 162

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDTV-EMSDIEWIARILWASQ 223
            K +    G  + L+    N  +      +  +++ I R++ ASQ
Sbjct: 163 VKRI-RYNGDQVILIPESNNTNHYPQVYGKNDEVKIIGRVV-ASQ 205


>gi|302866051|ref|YP_003834688.1| LexA repressor [Micromonospora aurantiaca ATCC 27029]
 gi|315502610|ref|YP_004081497.1| transcriptional repressor, lexa family [Micromonospora sp. L5]
 gi|302568910|gb|ADL45112.1| LexA repressor [Micromonospora aurantiaca ATCC 27029]
 gi|315409229|gb|ADU07346.1| transcriptional repressor, LexA family [Micromonospora sp. L5]
          Length = 260

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 64/219 (29%), Gaps = 29/219 (13%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAG-LDPTSF-NKSKRFGIEGRNRWPSTESIFKI 61
            ++I E I    ERH   PS   +    G + P+S   + K    +G  R          
Sbjct: 60  QRRILEFIRNWVERHGYPPSVREIGEAVGLVSPSSVAYQLKELEKKGFLRR--------- 110

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
               +    + +D+        E    + P   + P          +       +   +P
Sbjct: 111 ----DPNRPRAVDVRAPGEADDEAARAQRPAPAYVPMLGRIAAGGPILAEQAVEDIFPLP 166

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +    + +  SML      GD +++        GD +      G+ 
Sbjct: 167 RELVG-------EGEVFMLQVKGDSMLDAAICDGDWVVVRQQPNAEVGDIVAAMLD-GEA 218

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K    R    + LM  N  +        D   + R++
Sbjct: 219 TVKTYRRR-DGHVWLMPQNPAFDPI--PGDDATIMGRVV 254


>gi|239906085|ref|YP_002952824.1| hypothetical protein DMR_14470 [Desulfovibrio magneticus RS-1]
 gi|239795949|dbj|BAH74938.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 269

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 65/239 (27%), Gaps = 31/239 (12%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEG--------RNRWPSTESI 58
           ++I+  +  +A     T + LA+  G+   + + +KR             +    S + +
Sbjct: 32  QEIFTRLK-LATGAG-TDTELAKALGIKQGAVSAAKRSLQIPPVWIAKVSKGFSVSADWL 89

Query: 59  -----------FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSG 107
                        + +   +T   +                   L+    +       S 
Sbjct: 90  FYGTGPMERGGAAVASGPGQTTGAIPADAPPWMAPEAAPSMGYTLVPKVQARLAAGSGSL 149

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC 167
               G                G      +         SM P+    D ++++ +     
Sbjct: 150 ET-EGEVIGYYAFKTDFLRRKGR---PQKMVLMDVAGDSMEPILLDRDTVLIDESQNAII 205

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
              L       ++  K L       + L S N  Y    V+      + +  I R++W+
Sbjct: 206 SGGLFAVGVEQEVFVKYLDRIP-GKLVLRSKNSDYQPIEVDMNGDLAASVRIIGRVVWS 263


>gi|302525524|ref|ZP_07277866.1| LexA repressor [Streptomyces sp. AA4]
 gi|302434419|gb|EFL06235.1| LexA repressor [Streptomyces sp. AA4]
          Length = 254

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/217 (13%), Positives = 61/217 (28%), Gaps = 21/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            +++ + I     R    PS   +    GL  TS + S +     R  +   ++      
Sbjct: 50  QQQVLDVIRTWVSRFGYPPSVREIGEAVGLTSTS-SVSHQLRALQRKGYLRRDANRPRAV 108

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
               +          D + +  K   +PL+    +G                +   +P  
Sbjct: 109 GVLASTDDNPMGIEMDQQPSVPKAAYVPLVGRIAAGGPV------LAEQAVEDVFPLPRE 162

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     + +         SM+      GD +++        GD +      G+   
Sbjct: 163 IVG-------EGELFLLSVTGDSMVDAAITDGDWVVVRQQPAAENGDIVAAMID-GEATV 214

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K    +    + LM  N  Y        D   + +++
Sbjct: 215 KTFKRK-DGHVWLMPHNEAYEPI--PGDDASILGKVV 248


>gi|256825541|ref|YP_003149501.1| SOS-response transcriptional repressor, LexA [Kytococcus
           sedentarius DSM 20547]
 gi|256688934|gb|ACV06736.1| SOS-response transcriptional repressor, LexA [Kytococcus
           sedentarius DSM 20547]
          Length = 233

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 65/219 (29%), Gaps = 18/219 (8%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGR---NRWPSTESIFK 60
             ++ E I R  +     PS   +A +  L   S  + +   ++ +    R P+     +
Sbjct: 20  QTRVLEVIRRSIDERGYPPSMREIAEQVELASASSVQHQLNALQRKGYIRRDPNRPRALE 79

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL A          L       +E  +   P   + P          +    +  +   +
Sbjct: 80  ILDAAWPGDRGYRKLDEETWDPSEAADNHPP-ASYVPVVGQIAAGGPILAEEHIEDVFPL 138

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           P              +    + +  SM+      GD +++        GD +       +
Sbjct: 139 PRQIVG-------DGELFLLRVKGDSMVDAAICDGDWVVVRRQQAAINGDIVAAMLD-DE 190

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
              K     + + I L   N  +     + +D   + ++
Sbjct: 191 ATVKTYKKVKNQ-IWLQPHNPLFDPI--DGNDATILGKV 226


>gi|209885431|ref|YP_002289288.1| LexA repressor [Oligotropha carboxidovorans OM5]
 gi|226694236|sp|B6JG34|LEXA_OLICO RecName: Full=LexA repressor
 gi|209873627|gb|ACI93423.1| LexA repressor [Oligotropha carboxidovorans OM5]
          Length = 232

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/227 (11%), Positives = 58/227 (25%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I+   +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLRFINERLKESGIPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLANR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKK-----EKEIPLLYFPPSGSGGFFDSGVFPTGN 113
            + +         L          +  +      +                  G    G 
Sbjct: 61  ARAIEVIKLPEPALGSGGRRGFTPSVIEGNLGKARGPASFDESGEQPVAVPVMGRIAAGT 120

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLL 172
               +                 +    + +  SM       GD+ ++  +   + GD ++
Sbjct: 121 PIEALQTRSHTISVPPDMLGAGEHYALEVRGDSMVEAGILDGDMALIQRSENADTGDIVV 180

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 ALIDEEEATLKRFRRRGA-SIALEPANTAYEVRILPPNRVRIQGKLI 226


>gi|168750476|ref|ZP_02775498.1| putative repressor protein [Escherichia coli O157:H7 str. EC4113]
 gi|168757678|ref|ZP_02782685.1| putative repressor protein [Escherichia coli O157:H7 str. EC4401]
 gi|168783674|ref|ZP_02808681.1| putative repressor protein [Escherichia coli O157:H7 str. EC4076]
 gi|168802673|ref|ZP_02827680.1| putative repressor protein [Escherichia coli O157:H7 str. EC508]
 gi|195937964|ref|ZP_03083346.1| phage-related repressor protein [Escherichia coli O157:H7 str.
           EC4024]
 gi|208819582|ref|ZP_03259902.1| putative repressor protein [Escherichia coli O157:H7 str. EC4042]
 gi|188015290|gb|EDU53412.1| putative repressor protein [Escherichia coli O157:H7 str. EC4113]
 gi|188999040|gb|EDU68026.1| putative repressor protein [Escherichia coli O157:H7 str. EC4076]
 gi|189355373|gb|EDU73792.1| putative repressor protein [Escherichia coli O157:H7 str. EC4401]
 gi|189375389|gb|EDU93805.1| putative repressor protein [Escherichia coli O157:H7 str. EC508]
 gi|208739705|gb|EDZ87387.1| putative repressor protein [Escherichia coli O157:H7 str. EC4042]
          Length = 229

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 7   ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 61  WLSSGVGNMSDSTVQPIQPTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 117

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 118 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 177

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 178 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 218


>gi|113461549|ref|YP_719618.1| repressor protein [Haemophilus somnus 129PT]
 gi|112823592|gb|ABI25681.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 211

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 67/208 (32%), Gaps = 17/208 (8%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +       NL    +A        +             R P+   + K+L AT     
Sbjct: 7   EFVRDRMSEKNLKQEDIAEAIERTQGAVGHWLTG-----RRSPNFMEVAKMLNATGTDQV 61

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
                           +  I  + F      G        T     +V + EI   +  I
Sbjct: 62  ------------ILNSDGTIEDIEFIGIPKKGLVKVIGEATMGTDGSVDIEEIHVGYIDI 109

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
           +    +    + + +SM P    G+ +++      + GD + I+ + G  + K+L  ++ 
Sbjct: 110 FTTDPKAFCLRVKGSSMEPRIHSGEFVLVEPQSPFSNGDDVFIRTKDGKNMIKILDYQKD 169

Query: 191 RSIDLMSLNCCYPVDTVEMSDIEWIARI 218
                 S+N  +    + + ++E +  +
Sbjct: 170 GEYRFSSINNDHKPFNLAIDEVELVYYV 197


>gi|322507551|gb|ADX03005.1| Putative phage repressor [Acinetobacter baumannii 1656-2]
          Length = 224

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 62/217 (28%), Gaps = 8/217 (3%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I   I     R  LT    A+ AG+   +    ++          S  S   +      T
Sbjct: 9   IGLRIKEERTRLGLTQPDFAQIAGISKRTLIDWEKDLSSPNAVQLSALSQAGVDVNYIIT 68

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
             ++L          +             S   G          N    +          
Sbjct: 69  GNKVLSSIGDLPDGFDGFSLIPVHEDVVISAGHGSVVCAGDNPSN---YMAFRNDWIRSR 125

Query: 129 GIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISR 188
           G      +    +    SM P     + ++ N+A        + +         K +  +
Sbjct: 126 GFSVKDLKVFITR--GDSMEPTIADKEPILTNTAEVTPQDGHIYVIRSGEMTWVKRIQRQ 183

Query: 189 RGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWAS 222
              ++ L+S N  YP   +++    D+E I +++ +S
Sbjct: 184 LDNTLLLISDNKAYPPMKLDLETAHDVEVIGKVVNSS 220


>gi|295096873|emb|CBK85963.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 192

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 68/198 (34%), Gaps = 21/198 (10%)

Query: 22  LTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP-STESIFKILAATNETICQLLDLPFSDG 80
           +T   +A  AG+   S    +     GR R P +   + K L  +       L    +  
Sbjct: 1   MTQVEVANSAGVSQQSIESIE----SGRTRKPRNLLDLAKALKCSP----DWLLNGKNIM 52

Query: 81  RTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRH 140
              E   + IP+L +  +G           TG+ +  V              +       
Sbjct: 53  PLAEISTRRIPVLSYVQAGELTEAKDVTDLTGD-FEYVLADSD---------VPATCFAL 102

Query: 141 KTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS--IDLMSL 198
           +    SM P +++GDI+I++  +    G+ ++ K    +   K            +L+ L
Sbjct: 103 RIDGDSMQPEFKEGDIVIIDPDLCPAPGEFVVAKNGGHEATFKKYRPLGVGINDFELVPL 162

Query: 199 NCCYPVDTVEMSDIEWIA 216
           N  YPV       ++ I 
Sbjct: 163 NPDYPVLRSADMKLQIIG 180


>gi|218558038|ref|YP_002390951.1| Repressor protein CI from phage origin [Escherichia coli S88]
 gi|218364807|emb|CAR02497.1| Repressor protein CI from phage origin [Escherichia coli S88]
          Length = 233

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 57/216 (26%), Gaps = 19/216 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS   I  +            
Sbjct: 24  RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLSDIGVVFKYLGIDNISFN 78

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                                +P             P    +       + S        
Sbjct: 79  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGM--FSPELRTFTKGDAERLVSTTKKA--- 133

Query: 134 QTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  + +  SM       P +  G +++++    V  GD  + +    +   K LI 
Sbjct: 134 SDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIR 193

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             G+   L  LN  YP+          + +++ ASQ
Sbjct: 194 DSGQVF-LQPLNPQYPMIPCN-ESCSVVGKVI-ASQ 226


>gi|209407392|emb|CAQ82008.1| repressor protein CI [Enterobacteria phage 2851]
          Length = 219

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 57/216 (26%), Gaps = 19/216 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS   I  +            
Sbjct: 10  RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLSDIGVVFKYLGIDNISFN 64

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                                +P             P    +       + S        
Sbjct: 65  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGM--FSPELRTFTKGDAERLVSTTKKA--- 119

Query: 134 QTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  + +  SM       P +  G +++++    V  GD  + +    +   K LI 
Sbjct: 120 SDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIR 179

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             G+   L  LN  YP+          + +++ ASQ
Sbjct: 180 DSGQVF-LQPLNPQYPMIPCN-ESCSVVGKVI-ASQ 212


>gi|117623333|ref|YP_852246.1| putative CI repressor of bacteriophage [Escherichia coli APEC O1]
 gi|168752471|ref|ZP_02777493.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|187776111|ref|ZP_02800576.2| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|189010451|ref|ZP_02807272.2| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|189402456|ref|ZP_02782534.2| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|189404513|ref|ZP_02790006.2| CI protein [Escherichia coli O157:H7 str. EC4501]
 gi|189405171|ref|ZP_02813660.2| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|189405760|ref|ZP_02824140.2| CI protein [Escherichia coli O157:H7 str. EC508]
 gi|208809661|ref|ZP_03251998.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208817192|ref|ZP_03258284.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820684|ref|ZP_03261004.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400501|ref|YP_002271236.1| repressor protein [Escherichia coli O157:H7 str. EC4115]
 gi|209427751|ref|YP_002274162.1| putative bacteriophage CI repressor [Enterobacteria phage YYZ-2008]
 gi|217328107|ref|ZP_03444189.1| repressor protein [Escherichia coli O157:H7 str. TW14588]
 gi|227886483|ref|ZP_04004288.1| repressor protein CI [Escherichia coli 83972]
 gi|237706857|ref|ZP_04537338.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|254793774|ref|YP_003078611.1| repressor protein CI [Escherichia coli O157:H7 str. TW14359]
 gi|300935255|ref|ZP_07150273.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|300975627|ref|ZP_07173106.1| peptidase S24-like domain protein [Escherichia coli MS 45-1]
 gi|300982354|ref|ZP_07176052.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|301046509|ref|ZP_07193662.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|302393138|ref|YP_003828968.1| CI protein [Stx2 converting phage II]
 gi|32128133|dbj|BAC77937.1| CI protein [Stx1 converting phage]
 gi|32128300|dbj|BAC78103.1| CI protein [Stx2 converting phage II]
 gi|115512457|gb|ABJ00532.1| putative CI repressor of bacteriophage [Escherichia coli APEC O1]
 gi|187768994|gb|EDU32838.1| CI protein [Escherichia coli O157:H7 str. EC4196]
 gi|188013689|gb|EDU51811.1| CI protein [Escherichia coli O157:H7 str. EC4113]
 gi|189000092|gb|EDU69078.1| CI protein [Escherichia coli O157:H7 str. EC4076]
 gi|189355469|gb|EDU73888.1| CI protein [Escherichia coli O157:H7 str. EC4401]
 gi|189365099|gb|EDU83515.1| CI protein [Escherichia coli O157:H7 str. EC4501]
 gi|189371589|gb|EDU90005.1| CI protein [Escherichia coli O157:H7 str. EC869]
 gi|189378456|gb|EDU96872.1| CI protein [Escherichia coli O157:H7 str. EC508]
 gi|208729462|gb|EDZ79063.1| CI protein [Escherichia coli O157:H7 str. EC4206]
 gi|208730811|gb|EDZ79501.1| CI protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740807|gb|EDZ88489.1| CI protein [Escherichia coli O157:H7 str. EC4042]
 gi|208970819|gb|ACI32363.1| putative bacteriophage CI repressor [Enterobacteria phage YYZ-2008]
 gi|209161901|gb|ACI39334.1| repressor protein [Escherichia coli O157:H7 str. EC4115]
 gi|217318534|gb|EEC26960.1| repressor protein [Escherichia coli O157:H7 str. TW14588]
 gi|226898067|gb|EEH84326.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227836687|gb|EEJ47153.1| repressor protein CI [Escherichia coli 83972]
 gi|254593174|gb|ACT72535.1| repressor protein CI [Escherichia coli O157:H7 str. TW14359]
 gi|300301529|gb|EFJ57914.1| peptidase S24-like domain protein [Escherichia coli MS 185-1]
 gi|300307191|gb|EFJ61711.1| peptidase S24-like domain protein [Escherichia coli MS 200-1]
 gi|300410290|gb|EFJ93828.1| peptidase S24-like domain protein [Escherichia coli MS 45-1]
 gi|300459507|gb|EFK23000.1| peptidase S24-like domain protein [Escherichia coli MS 21-1]
 gi|315287509|gb|EFU46920.1| peptidase S24-like domain protein [Escherichia coli MS 110-3]
 gi|315293071|gb|EFU52423.1| peptidase S24-like domain protein [Escherichia coli MS 153-1]
 gi|323957980|gb|EGB53692.1| peptidase S24 [Escherichia coli H263]
          Length = 231

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 57/216 (26%), Gaps = 19/216 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS   I  +            
Sbjct: 22  RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLSDIGVVFKYLGIDNISFN 76

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                                +P             P    +       + S        
Sbjct: 77  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGM--FSPELRTFTKGDAERLVSTTKKA--- 131

Query: 134 QTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  + +  SM       P +  G +++++    V  GD  + +    +   K LI 
Sbjct: 132 SDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIR 191

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             G+   L  LN  YP+          + +++ ASQ
Sbjct: 192 DSGQVF-LQPLNPQYPMIPCN-ESCSVVGKVI-ASQ 224


>gi|91210315|ref|YP_540301.1| putative CI repressor of bacteriophage [Escherichia coli UTI89]
 gi|195939328|ref|ZP_03084710.1| putative CI repressor of bacteriophage [Escherichia coli O157:H7
           str. EC4024]
 gi|209447145|ref|YP_002274230.1| repressor [Stx2-converting phage 1717]
 gi|215486128|ref|YP_002328559.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|261225735|ref|ZP_05940016.1| repressor protein CI [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258459|ref|ZP_05950992.1| repressor protein CI [Escherichia coli O157:H7 str. FRIK966]
 gi|291281724|ref|YP_003498542.1| CI protein [Escherichia coli O55:H7 str. CB9615]
 gi|302861176|ref|YP_003848877.1| CI repressor protein [Stx1 converting phage]
 gi|23343453|emb|CAC95084.1| repressor [Enterobacteria phage Nil2]
 gi|91071889|gb|ABE06770.1| putative CI repressor of bacteriophage [Escherichia coli UTI89]
 gi|209361124|gb|ACI43117.1| repressor [Stx2-converting phage 1717]
 gi|215264200|emb|CAS08544.1| predicted repressor protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|290761597|gb|ADD55558.1| CI protein [Escherichia coli O55:H7 str. CB9615]
 gi|294489683|gb|ADE88439.1| peptidase, S24 (LexA) family [Escherichia coli IHE3034]
 gi|307553159|gb|ADN45934.1| putative CI repressor of bacteriophage [Escherichia coli ABU 83972]
 gi|307627374|gb|ADN71678.1| repressor protein CI [Escherichia coli UM146]
 gi|320637900|gb|EFX07682.1| repressor protein CI [Escherichia coli O157:H7 str. G5101]
 gi|320643308|gb|EFX12497.1| repressor protein CI [Escherichia coli O157:H- str. 493-89]
 gi|320648651|gb|EFX17292.1| repressor protein CI [Escherichia coli O157:H- str. H 2687]
 gi|320654244|gb|EFX22302.1| repressor protein CI [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320664729|gb|EFX31869.1| repressor protein CI [Escherichia coli O157:H7 str. LSU-61]
 gi|323953159|gb|EGB49025.1| peptidase S24 [Escherichia coli H252]
          Length = 217

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 57/216 (26%), Gaps = 19/216 (8%)

Query: 14  DRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL 73
               +   +T   LA + G+         R      +R PS   I  +            
Sbjct: 8   RSRMKELGITQEKLAEELGMTQGGIGHWLRG-----SRHPSLSDIGVVFKYLGIDNISFN 62

Query: 74  DLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAI 133
                                +P             P    +       + S        
Sbjct: 63  HDGTFSPVGEYSSAPVKKQYEYPVFSHVQAGM--FSPELRTFTKGDAERLVSTTKKA--- 117

Query: 134 QTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
                  + +  SM       P +  G +++++    V  GD  + +    +   K LI 
Sbjct: 118 SDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIR 177

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
             G+   L  LN  YP+          + +++ ASQ
Sbjct: 178 DSGQVF-LQPLNPQYPMIPCN-ESCSVVGKVI-ASQ 210


>gi|221638398|ref|YP_002524660.1| LexA repressor [Rhodobacter sphaeroides KD131]
 gi|221159179|gb|ACM00159.1| LexA repressor [Rhodobacter sphaeroides KD131]
          Length = 222

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 63/216 (29%), Gaps = 5/216 (2%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESIFKILAAT 65
           ++ + I    +R  + PS    K  LD  S +   R       R          + +   
Sbjct: 2   ELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHRARAIEIV 61

Query: 66  NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTV-GVPEIR 124
                       +              +    +G+      G    G     + G P+  
Sbjct: 62  KLPEAMERAGFSARAAKAAAAPLPKGAVTVETAGALDLPLMGRIAAGLPIEAINGGPQSV 121

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAK 183
           +    + + + Q    + +  SM+      GDI+++      + GD ++      +   K
Sbjct: 122 TVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTADNGDIVVALVADHEATLK 181

Query: 184 VLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               R G  I L   N  Y         ++   R++
Sbjct: 182 RYRRR-GGMIALEPANDSYETQVYPEQLVKVQGRLV 216


>gi|218463028|ref|ZP_03503119.1| LexA repressor [Rhizobium etli Kim 5]
          Length = 239

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/233 (12%), Positives = 63/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A + ++        S                          S      G
Sbjct: 61  ARALEVIKLPEAYSPSLQPRRGFSPSVIEGSLGKPQPVAAPAAAKPIADNGSSVSVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|308377110|ref|ZP_07441152.2| repressor lexA [Mycobacterium tuberculosis SUMu008]
 gi|308348968|gb|EFP37819.1| repressor lexA [Mycobacterium tuberculosis SUMu008]
          Length = 248

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/217 (13%), Positives = 59/217 (27%), Gaps = 20/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + I + I          PS   +    GL  TS    +   +E +       +  + + 
Sbjct: 43  QRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVN 102

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
                   L  +    G     +   +P+L    +G                +   +P  
Sbjct: 103 VRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPI------LAEEAVEDVFPLPRE 156

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     +      K    SM       GD +++      + GD +      G+   
Sbjct: 157 LVG-------EGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMID-GEATV 208

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K      G  + LM  N  +       +D   + +++
Sbjct: 209 KTFKR-AGGQVWLMPHNPAFDPI--PGNDATVLGKVV 242


>gi|39998413|ref|NP_954364.1| Cro/CI family transcriptional regulator [Geobacter sulfurreducens
           PCA]
 gi|39985360|gb|AAR36714.1| transcriptional regulator, Cro/CI family [Geobacter sulfurreducens
           PCA]
 gi|298507358|gb|ADI86081.1| helix-turn-helix transcriptional regulator, LexA-related [Geobacter
           sulfurreducens KN400]
          Length = 212

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/212 (12%), Positives = 61/212 (28%), Gaps = 20/212 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           +   I ++ +   +T    A   G+     +  +R       + PS   +  +       
Sbjct: 12  LGGRIRKLRQARGMTQKAFADSLGIVQGFLSSIERG-----RKVPSDTLVIALCRTYGVN 66

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
           +  LL    +     +   +                     P G   +   +P       
Sbjct: 67  VTWLLQGKGAMNAPPDGAGEGAGEGT---------PLLESVPQGFPED---IPGDVVQGR 114

Query: 129 GIYA-IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
            ++  +             M P  R GD+++ + A     G+ +L+  R G+ + +    
Sbjct: 115 IVFPGMPQGCYAVLAYGDFMAPTIRDGDMVLFDPARPAAPGEIVLVTNRWGEAILRRY-R 173

Query: 188 RRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +   +     N  Y     +  D   I  ++
Sbjct: 174 LKAGELLFSPDNAAYSPFHPDP-DTRIIGTVV 204


>gi|218889540|ref|YP_002438404.1| transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|218769763|emb|CAW25523.1| transcriptional regulator [Pseudomonas aeruginosa LESB58]
          Length = 262

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/235 (11%), Positives = 53/235 (22%), Gaps = 34/235 (14%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
                LT S +A    +  T+ +              +     K        +       
Sbjct: 25  RRELGLTQSSIAEAFRMSQTAISMYMNGSN-----ALNAAVAAKFSTILEVPVSSFSPRL 79

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV---------------- 120
            ++     K     P+     +           P  +    +                  
Sbjct: 80  AAEIEGMAKAMHPKPVPDITDTLEPIHPWDDGTPIDDDEVEIPFYKEVEMAAGAGRNIEQ 139

Query: 121 -------PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
                      +         +     +    SM PL   G  + +++A +      +  
Sbjct: 140 EIKGRKLRFSYATLRAAGVDPSAAICTRVGGNSMEPLISDGATIGVDTATKHITDGEIYA 199

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD-----IEWIARILWAS 222
                 +  K +    G  + L S N   YP +     +     I  I  + W S
Sbjct: 200 IKHDDLLRVKFVYRLPGGGVRLRSYNRDEYPDEEYTPEEMRSQQISIIGWVFWWS 254


>gi|51596125|ref|YP_070316.1| prophage repressor protein [Yersinia pseudotuberculosis IP 32953]
 gi|51589407|emb|CAH21029.1| putative prophage repressor protein [Yersinia pseudotuberculosis IP
           32953]
          Length = 228

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 62/219 (28%), Gaps = 10/219 (4%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +       NL+   LARK+G+   + +K++    +  N          +L      
Sbjct: 5   LAERVSERRSALNLSQEELARKSGVSRVAISKAELGLTKNFNGNTLFNIARALLCNPEWL 64

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG---VPEIRS 125
                +       +              P  S  +        GN    +    + EI  
Sbjct: 65  QTGKGNPELQSTSSANWDANVKENKDSHPLQSYEYPKISWVSAGNWSEAIEPYSLDEIDE 124

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
                            +  SM         +G  +++N  ++   G  ++       + 
Sbjct: 125 WVTTTKYAGHNAFWLDVKGDSMTSPVGLTIPEGMSILVNPDVEPTSGKLVIAKLTDGNEA 184

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K  I   G    L  LN  YP+  +  +    I  ++
Sbjct: 185 TFKRYIEDAGNKY-LKPLNPQYPMIEINGN-CRIIGVVV 221


>gi|309701005|emb|CBJ00303.1| putative prophage repressor [Escherichia coli ETEC H10407]
          Length = 211

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 66/219 (30%), Gaps = 26/219 (11%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    +   +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 2   GERIRARRKELKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALAKALQCSP 56

Query: 70  C----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRS 125
                    L      +        PL+ +  +G                N        S
Sbjct: 57  DYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHK-RAIDNWYDTTVDCS 115

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGDI 180
                            +  SM         +G I++++  ++   G  ++       + 
Sbjct: 116 E---------DSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENEA 166

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 167 TFKKLVIDAGRRF-LKPLNPQYPMIEINGN-CKIIGVVV 203


>gi|326387883|ref|ZP_08209489.1| LexA repressor [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207929|gb|EGD58740.1| LexA repressor [Novosphingobium nitrogenifigens DSM 19370]
          Length = 228

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/221 (13%), Positives = 56/221 (25%), Gaps = 6/221 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    E   ++PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLTFIQNRLEESGISPSFEEMKDALDLKSKSGVHRLISALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD-SGVFPTGNKWNT 117
            + L    E                       P +    +         G    G     
Sbjct: 61  ARALEVIREPETASPRGAARVATKPAPTPPPPPFVAPEAANDVIEIPLHGRIAAGAPIEA 120

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           +       P         +    +    SM+      GD+ ++        G+ ++   R
Sbjct: 121 LE-GSATLPVPAALLGPGEHYALEVSGDSMVDAGILDGDLALIRRTEVARDGEIVVALVR 179

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
             +   K L   +   I L   N  Y       +D++   +
Sbjct: 180 GEEATLKYLRREK-GMIRLDPANAAYDPQFYTPNDVQVQGK 219


>gi|254486471|ref|ZP_05099676.1| LexA repressor [Roseobacter sp. GAI101]
 gi|214043340|gb|EEB83978.1| LexA repressor [Roseobacter sp. GAI101]
          Length = 239

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/227 (12%), Positives = 60/227 (26%), Gaps = 9/227 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +     +   I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 8   MLTKKQLDLLAFIHKRVQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 67

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG----SGGFFDSGVFPTGNK 114
            + +                        ++               S      G    G  
Sbjct: 68  ARAIEVVKLPDSMGGLPGSGFTPRVIDGDRPDMPPPAAAQPVSNASFDIPMMGRIAAGVP 127

Query: 115 WNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
              +          G   + + +    + +  SM+      GD++++      + GD ++
Sbjct: 128 IEAISTMTHSVAVPGSMVSGRGEHYALEVKGDSMIDAGINDGDVVVIRETSVADNGDIVV 187

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K      G SI L + N  Y    +    ++   R++
Sbjct: 188 ALVEDHEATLKTFKRH-GSSIALEAANPAYETRVLPADKVKVQGRLV 233


>gi|114328257|ref|YP_745414.1| transcriptional repressor [Granulibacter bethesdensis CGDNIH1]
 gi|114316431|gb|ABI62491.1| transcriptional repressor [Granulibacter bethesdensis CGDNIH1]
          Length = 255

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/232 (12%), Positives = 68/232 (29%), Gaps = 21/232 (9%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF--KILAATN 66
           + E +     +   +   LA++AG   T+ +K +R   +     P         +L    
Sbjct: 19  VGERMRHARIQRGWSQDALAKEAGTSQTTIDKIERNLTQRSRALPRLAQCLGVDLLTLDP 78

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGF-------FDSGVFPTGNKWNTVG 119
           + +        ++      ++ +  +                          G      G
Sbjct: 79  DYLGDYQPGTEAEAPPQSPRKLQGQVRIPAQPIPPPITGLSVRSVPVFGTAQGGALGATG 138

Query: 120 VPE-----IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
           +P+       +   G             +  SM P    G ++ ++        D +++ 
Sbjct: 139 LPDSAQALDWARLPGPLTGIPGLFALYVEGDSMEPWVEHGHLIYIHPTRPAAPRDHVVVV 198

Query: 175 PRTGD-----IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL-W 220
            + G+      + K L+ R    + L   N       ++   +  I R++ W
Sbjct: 199 VQDGEYDEPRALVKRLVRRTAGRLVLHQYNPA-GEIEIDARTVMRIYRVIPW 249


>gi|299134983|ref|ZP_07028174.1| transcriptional repressor, LexA family [Afipia sp. 1NLS2]
 gi|298589960|gb|EFI50164.1| transcriptional repressor, LexA family [Afipia sp. 1NLS2]
          Length = 234

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 57/229 (24%), Gaps = 11/229 (4%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I+   +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQYELLRFINERLKESGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLANR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPS-------GSGGFFDSGVFPT 111
            + +                    +  +     +    P                G    
Sbjct: 61  ARAIEVIKLPEPVASSGARRGFTPSVIEGNLGKVRSTVPGGFDESGEQPVAVPVMGRIAA 120

Query: 112 GNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
           G     +                 +    + +  SM       GD+ ++      + GD 
Sbjct: 121 GTPIEALQTRSHTISVPPDMLGSGEHYALEVRGDSMVEAGILDGDMALIQRNENADTGDI 180

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 VVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 228


>gi|309807064|ref|ZP_07701044.1| DNA-binding helix-turn-helix protein [Lactobacillus iners LactinV
           03V1-b]
 gi|325911652|ref|ZP_08174060.1| DNA-binding helix-turn-helix protein [Lactobacillus iners UPII
           143-D]
 gi|308166560|gb|EFO68759.1| DNA-binding helix-turn-helix protein [Lactobacillus iners LactinV
           03V1-b]
 gi|325476638|gb|EGC79796.1| DNA-binding helix-turn-helix protein [Lactobacillus iners UPII
           143-D]
          Length = 227

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/223 (12%), Positives = 59/223 (26%), Gaps = 24/223 (10%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT------- 65
           ID   +++NLT   L +K G   +S ++          R+P  E I +I           
Sbjct: 12  IDYFRKQNNLTMEELGQKLGKATSSISRWVSGE-----RYPKIEEIEQIANFFNTDIYTL 66

Query: 66  --NETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG------FFDSGVFPTGNKWNT 117
                  +                ++  +  +              +  G    G     
Sbjct: 67  IFGFNYNEDSKSDLLTVYNQLADIRKHKVYSYAQQQLDEQNKKRSIYVVGTSAAGEPIEY 126

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
                     +        D     +  SM P      I+  +    +  G+  + +   
Sbjct: 127 GDFDSEMIQTD---VPAKADKAIHIKGDSMEPKIASNSIIFYHEQPTLEIGEIGIFEING 183

Query: 178 GDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             +  K        + I L S+N  Y         +  + +++
Sbjct: 184 SAVTCKKYYVDYESKKIILKSINPKYEPMYFARDQVRILGKVV 226


>gi|257468521|ref|ZP_05632615.1| LexA repressor [Fusobacterium ulcerans ATCC 49185]
 gi|317062781|ref|ZP_07927266.1| LexA repressor [Fusobacterium ulcerans ATCC 49185]
 gi|313688457|gb|EFS25292.1| LexA repressor [Fusobacterium ulcerans ATCC 49185]
          Length = 212

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 67/216 (31%), Gaps = 19/216 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           I E I +  E   L+   LA   G    TS +K+++   +            + L  T  
Sbjct: 3   IGERIKKKREELKLSQEQLAEIMGYKSKTSIHKAEQGITDLPQS--KIIEFARALKTTPS 60

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127
            +    +           K + I +  +  +             GN +  +    +    
Sbjct: 61  YLMGWEEKIEKSNAVILDKSQFIYVPVYGKA-----------SAGNGYINMDT-VLYDKL 108

Query: 128 NGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLIS 187
             I          +    SM P    G+ ++++      C  ++ +     +   K++  
Sbjct: 109 IHINGYSHDSFLIEVSGDSMEPTILDGEFVLVDPTRTEICEGKIYVITYNNETYIKMIEK 168

Query: 188 RRGRSID-LMSLNCCYPVDTVEMSD---IEWIARIL 219
                I  L S+N  Y    ++  +   ++   R++
Sbjct: 169 HEEDEIVLLKSVNQKYRDKVIKKEEFENVKIEGRVV 204


>gi|258544054|ref|ZP_05704288.1| S24 (LexA) family peptidase [Cardiobacterium hominis ATCC 15826]
 gi|258520682|gb|EEV89541.1| S24 (LexA) family peptidase [Cardiobacterium hominis ATCC 15826]
          Length = 211

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 71/211 (33%), Gaps = 14/211 (6%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E + ++ E   +T    A + G+  ++    ++       R P  + + ++         
Sbjct: 5   ERLRKIVEGSGITQGDFAAQMGVAVSAQRNYEKG-----LRKPDIDYLQRL-------HD 52

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR-SPHNG 129
              D+ +    TT+  E  + +      GS G    G     +    + V +       G
Sbjct: 53  AGYDVLYLLTGTTKIPEGYVRIPKMSARGSMGSGIDGALAHDDVLEYITVSKDWIDRTMG 112

Query: 130 IYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRR 189
            Y+          +  SM P +     L+++  +     D + +    G++  K L  + 
Sbjct: 113 TYSKADNLRIIHGRGDSMAPTFSDNTPLLVDIGVTNFQQDAIYLFQLFGEVYIKRLQRKP 172

Query: 190 GRSIDLMSLNCCYPVDTV-EMSDIEWIARIL 219
                 +S N  Y    + E  D   IA ++
Sbjct: 173 RGGYKAISDNKYYESFDILEPDDFRIIALVV 203


>gi|84687233|ref|ZP_01015114.1| LexA repressor [Maritimibacter alkaliphilus HTCC2654]
 gi|84664821|gb|EAQ11304.1| LexA repressor [Rhodobacterales bacterium HTCC2654]
          Length = 230

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/225 (12%), Positives = 62/225 (27%), Gaps = 7/225 (3%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +     + E I +  +R  + PS    K  L   S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRIQRDGVPPSFDEMKEALQLRSKSGIHRLITALEERGYIRRLAHR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKW 115
               ++    +                 ++ +            +      G    G   
Sbjct: 61  ARAIEVTRLPDALDPSGKAGFEPRVIDGDRPDSRPAQAMPLEGSAMDLPLLGRIAAGTPI 120

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIK 174
             +   +      G      +    + +  SM+      GD++I+      + GD ++ +
Sbjct: 121 EAIEDGQSHVSVPGAMVGNGKHYALEVKGDSMINAGINSGDVVIIRETSHADNGDIVVAQ 180

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               +   K    R G  I L + N  +    +    I+   +++
Sbjct: 181 VDGYEATLKRF-RRAGDMIALEAANPAFETRILPQGQIKVQGKLV 224


>gi|294791093|ref|ZP_06756251.1| repressor LexA [Scardovia inopinata F0304]
 gi|294458990|gb|EFG27343.1| repressor LexA [Scardovia inopinata F0304]
          Length = 264

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 59/230 (25%), Gaps = 23/230 (10%)

Query: 8   KIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNK-----------SKRFGIEGRNRWPS 54
           +I +AI+  +      PS   +A+  GL  TS  K            +    +GR     
Sbjct: 34  QILQAIEEYSTTKGYIPSFREIAQLVGLKSTSSVKHQLNVLEKKGFIRLGANKGRAIELI 93

Query: 55  T----ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
           T    ESI        E          + GR                S        G   
Sbjct: 94  THLEEESITDASPQAQEKDQDHETDSGTYGRAEIYPFPTSQSESIVQSTDVPLV--GRIA 151

Query: 111 TGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGD 169
            G         +                  +    SM+      GD +++        GD
Sbjct: 152 AGTPITAEQHIDDVMRLPQRLTGDGNLFMLEVHGDSMIDAAICDGDFVVVREQHTAENGD 211

Query: 170 RLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            +       +   K     +   + LM  N  Y     + +    + +++
Sbjct: 212 IVAALLD-DEATVKTFRKDKSGHLWLMPHNPEYSPI--DGTYATIMGKVV 258


>gi|317484266|ref|ZP_07943191.1| peptidase S24-like protein [Bilophila wadsworthia 3_1_6]
 gi|316924474|gb|EFV45635.1| peptidase S24-like protein [Bilophila wadsworthia 3_1_6]
          Length = 241

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/235 (14%), Positives = 69/235 (29%), Gaps = 33/235 (14%)

Query: 11  EAIDRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
             +DR+     L   + LA   G+ P + ++++R       R      + K+      ++
Sbjct: 12  AILDRLLSGAGLHRDAQLAALLGVSPQAVSQARR------KRKIPEGWVVKVSQQCGLSM 65

Query: 70  CQLLDLPFSDGRT--TEKKEKEIPLLYFPPSGS--------GGFFDSGVFPTGNKW---- 115
             L+     +     +             P+G+             +     G       
Sbjct: 66  DWLMFGKGDESTPVASHAPVASSTSQASTPAGAAVPDLDLLCIPLVAASLSAGVGSLQTE 125

Query: 116 ----NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
               +            G      +    K    SM P    GD+ +++ + Q      +
Sbjct: 126 ADVLDYFAFRSDWLCRKG---NPDKMVLMKVYGDSMEPEICHGDMALIDQSKQQIYPHTI 182

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
                  +I  K + +  G  + L SLN  Y    V+        +  I +++W 
Sbjct: 183 YAVGVNEEIYIKQIETLPGHRMLLRSLNERYEPIEVDLRGDMAESVRIIGKVIWW 237


>gi|254511805|ref|ZP_05123872.1| LexA repressor [Rhodobacteraceae bacterium KLH11]
 gi|221535516|gb|EEE38504.1| LexA repressor [Rhodobacteraceae bacterium KLH11]
          Length = 232

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 64/229 (27%), Gaps = 13/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +   + PS    K+ LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRVQVDGVPPSFDEMKSALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I K+  +               G   E             +        G    G
Sbjct: 61  ARAIEIVKLPESLGGEPTVGFKPRVISGDRPEGPRPANFEPVTVDAMELPVM--GRIAAG 118

Query: 113 NKWNTVGVPEIRSPHNGI-YAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +     R    G   +   +    + +  SM       GD++++      + GD 
Sbjct: 119 VPIEAISHVSHRVAVPGSMVSGSGEHYALEVRGDSMIEAGINDGDVVVIRETSAADNGDI 178

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    R G++I L + N  Y    +    ++   R++
Sbjct: 179 VVALVEDQEATLKRFFRR-GQAIALEAANPAYETRVLPEDKVKVQGRLV 226


>gi|324116784|gb|EGC10698.1| peptidase S24 [Escherichia coli E1167]
          Length = 229

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 54/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 7   ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +                          G         E+       
Sbjct: 61  WLSSGVGNMSDSTVQPIPSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 117

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 118 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 177

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 178 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 218


>gi|309797052|ref|ZP_07691451.1| peptidase S24-like domain protein [Escherichia coli MS 145-7]
 gi|308119335|gb|EFO56597.1| peptidase S24-like domain protein [Escherichia coli MS 145-7]
          Length = 251

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 29  ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 82

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 83  WLSSGVGNMSDSTVQPIQSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 139

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 140 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 199

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 200 VKRLQMMKN-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 240


>gi|306841869|ref|ZP_07474549.1| LexA repressor [Brucella sp. BO2]
 gi|306287999|gb|EFM59401.1| LexA repressor [Brucella sp. BO2]
          Length = 240

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/235 (11%), Positives = 56/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD------------- 105
            + L            L           E  +  +                         
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGTGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K    +   SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|254821025|ref|ZP_05226026.1| LexA repressor [Mycobacterium intracellulare ATCC 13950]
          Length = 236

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/217 (12%), Positives = 56/217 (25%), Gaps = 20/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + I   I          PS   +    GL  TS    +   +E +       +  + + 
Sbjct: 31  QRTILNVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVD 90

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
                           G     +   +P+L    +G                +   +P  
Sbjct: 91  VRGADDDVAAPATEVAGSDALPEPTFVPVLGRIAAGGPI------LAEEAVEDVFPLPRE 144

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     +      K    SM       GD +++      + GD +      G+   
Sbjct: 145 LVG-------EGTLFLLKVVGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMLD-GEATV 196

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K      G  + LM  N  +       +D   + +++
Sbjct: 197 KTFKR-AGGQVWLMPHNPAFDPI--PGNDATVLGKVV 230


>gi|225351434|ref|ZP_03742457.1| hypothetical protein BIFPSEUDO_03029 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157778|gb|EEG71061.1| hypothetical protein BIFPSEUDO_03029 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 238

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/220 (12%), Positives = 67/220 (30%), Gaps = 17/220 (7%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSF-NKSKRFGIEGRNR-WPSTESIFK 60
            +K+  AI +        PS   +   AGL  P+S  ++ +    +G  R   +     +
Sbjct: 24  QRKVLGAIKKHLVEQGFAPSFREIGEAAGLKSPSSVKHQLQVLDDKGFIRMNANKGRAIE 83

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +++  ++ +            +       I      P          +    +  + + +
Sbjct: 84  VVSFDDDEVSPGKVAQVIPFPSQSDSSGSIMASRDVPLVGRIAAGVPITAEQHVDDVMRL 143

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLP-LYRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           PE  +               +    SM+      GD +++        GD +       +
Sbjct: 144 PERLTGT-------GNLFMLEVHGDSMIDAAICDGDFVVVREQNTAENGDIVAALLD-DE 195

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K    +    + L+  N  Y     + +  E + +++
Sbjct: 196 ATVKTF-RKDHGHVWLIPHNPAYSPI--DGTHAEIMGKVV 232


>gi|58040701|ref|YP_192665.1| LexA repressor [Gluconobacter oxydans 621H]
 gi|58003115|gb|AAW62009.1| LexA repressor [Gluconobacter oxydans 621H]
          Length = 259

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/241 (14%), Positives = 58/241 (24%), Gaps = 31/241 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSK---------- 42
           M +    ++   ID    R   +PS         L  K+G+     +  +          
Sbjct: 22  MLTRKQHQLLLYIDDHLRRTGYSPSFDEMKDALELRSKSGIHR-LISALEERGFLRRHHH 80

Query: 43  RFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTT---EKKEKEIPLLYFPPSG 99
           R       R P   +       T       +      G      E            P  
Sbjct: 81  RARALEVLRLPHMGTEAPAATGTGTAFVPAVLNQGQTGLEGAFSEASVANDRQTVSIPLY 140

Query: 100 SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILI 158
                   +    +  + + VP              +         SM       GDI I
Sbjct: 141 GRIAAGLPIEAMQDDSDRIDVPVSLLGT-------GEHYALTVAGDSMIEAGILDGDIAI 193

Query: 159 LNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +        G  ++      ++  K L  R G  I L + N  Y         +    R+
Sbjct: 194 IRRRETAENGQIIVALIDEQEVTLKKLRRR-GSMIALEAANRDYETRIFPAERVHIQGRL 252

Query: 219 L 219
           +
Sbjct: 253 V 253


>gi|229083181|ref|ZP_04215564.1| Helix-turn-helix domain protein [Bacillus cereus Rock4-2]
 gi|228700099|gb|EEL52702.1| Helix-turn-helix domain protein [Bacillus cereus Rock4-2]
          Length = 214

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 67/217 (30%), Gaps = 23/217 (10%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72
           + ++ +++N+T   LA    +  T+  + +        R P    I +I    N +    
Sbjct: 8   LSQLMKKNNMTDEQLAELLSVSRTTVLRWRNGE-----RSPKMSKISQIAKILNVSATYF 62

Query: 73  LDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYA 132
           +D   S         K    +Y   +              N    + VP+I     G   
Sbjct: 63  IDENESYCPEDHAITKRNIPIYGTIAAGKPI-----EAIENVIGDIQVPDIILDKYGF-- 115

Query: 133 IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS 192
              +    +    SM  +   G I +L     +N GD   +     D   K +       
Sbjct: 116 --EKLLALRINGDSMNRIVHDGHIAVLERTTNINNGDIAAVLINGYDATLKRIYK-TNNR 172

Query: 193 IDLMSL--NCCYPVDTVEMSDIE------WIARILWA 221
           I L     N        + +DIE       + + +W+
Sbjct: 173 IILEPDSFNPSIHPLMFDCTDIENCPEIKVVGKYIWS 209


>gi|241663869|ref|YP_002982229.1| phage repressor [Ralstonia pickettii 12D]
 gi|240865896|gb|ACS63557.1| putative phage repressor [Ralstonia pickettii 12D]
          Length = 292

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 65/212 (30%), Gaps = 13/212 (6%)

Query: 17  AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP 76
            E  +++PS  A    +      + K+          + E +   +   +E+  + +   
Sbjct: 75  CEPADISPSLAAEMKVISKPL--QLKQLNTPEGTEELAKEQMRAAIHKLDESELRAIAES 132

Query: 77  FSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT------VGVPEIRSPHNGI 130
                        +  L  P +             GN   T        +P        +
Sbjct: 133 KGFPARPIAVYNTLEELP-PETTVLITHVDVALSAGNGRETWHIEEKEPLPFQADYIRRL 191

Query: 131 YAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG-DRLLIKPRTGDIVAKVLISRR 189
            A        K +  SM P     D ++++ A +       +      G+++ K L    
Sbjct: 192 DASPKNLVAVKVRGDSMEPRLFDDDTVVVDRADRRIPASGGVFAIVYAGEMLVKRLFKLP 251

Query: 190 GRSIDLMSLNCCYPVDTVEMSD---IEWIARI 218
             SID++S N  Y    V+      I+ + R+
Sbjct: 252 DGSIDIVSDNPKYKSLVVQPDQLEHIDIVGRV 283


>gi|209549197|ref|YP_002281114.1| LexA repressor [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226694237|sp|B5ZN98|LEXA_RHILW RecName: Full=LexA repressor
 gi|209534953|gb|ACI54888.1| SOS-response transcriptional repressor, LexA [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 239

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/233 (12%), Positives = 63/233 (27%), Gaps = 15/233 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSKRFGIEGRNRW 52
           M +   +++   I    +   + PS         LA K+G+        +R  I      
Sbjct: 1   MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 53  PSTESIFKILAATNETICQLLDLPFSDGR-----TTEKKEKEIPLLYFPPSGSGGFFDSG 107
                + K+  A + +I        S                          S      G
Sbjct: 61  ARALEVIKLPEAYSPSIQPRRGFSPSVIEGSLGKPQPAAAPAPAKPVADNGNSVSVPVMG 120

Query: 108 VFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVN 166
               G   + +                 +    + +  SM+      GD +I+ +    +
Sbjct: 121 RIAAGVPISAIQNNTHDIVVPADMLGSGEHYALEVKGDSMIDAGIFDGDTVIIRNGSTAS 180

Query: 167 CGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            GD ++      +   K    +   SI L + N  Y         ++   +++
Sbjct: 181 PGDIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVKVQGKLV 232


>gi|145639950|ref|ZP_01795549.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae PittII]
 gi|145270916|gb|EDK10834.1| transcriptional activator-regulatory protein [Haemophilus
           influenzae PittII]
 gi|309751666|gb|ADO81650.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 235

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 67/229 (29%), Gaps = 23/229 (10%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
             + E +  M + + L+   LA K G+   +  +  +  I       + + I +I  A  
Sbjct: 4   DTLAERLRYMMDFNALSQQSLADKVGVSQQAIGQILKGEIS------NPKKILEISTALG 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG--GFFDSGVFPTGN-KWNTVGVPEI 123
                L         T +    +  +             +       G+        PE+
Sbjct: 58  VNPHWLKTGRGPIEPTAQGTSIQSLVSTDSDEHHRFRVDYLDVQAAAGHSGIENADYPEV 117

Query: 124 RSPHNGIY---------AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                            +     +       SM+P   KGDI+ +++ +    G+ +   
Sbjct: 118 IQSIYFSKEGLLEIVGKSTNDGISLINVPTDSMVPTINKGDIVFVDTKVNYYTGEGVYFF 177

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDI----EWIARIL 219
              G    K L+         +S N  YP   +   ++      I + +
Sbjct: 178 LLNGGAYIKRLMKLPTGVYRAISDNSVYPDFDIS-DELFDTAVIIGKFI 225


>gi|325675185|ref|ZP_08154870.1| LexA repressor [Rhodococcus equi ATCC 33707]
 gi|325553891|gb|EGD23568.1| LexA repressor [Rhodococcus equi ATCC 33707]
          Length = 220

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 60/218 (27%), Gaps = 29/218 (13%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            ++I   I    + H   PS   +A   GL   ++ +K  +   +               
Sbjct: 22  QQRILLTIRDWVDGHGCPPSTREIADAVGLRSTSTVSKHLKALEDK-------------- 67

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
                       L      T     +        P        + +    +    + +P 
Sbjct: 68  GFLRRGGSMTRQLDVRPFLTGSAPGRSTENTVTVPVVGDIAAGAPILAEEHADEMLSLPR 127

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                             + +  SM+      GD +++    + + G+ +      G+  
Sbjct: 128 ELVGS-------GTVFALRVRGESMVDAAICDGDTVVVRRQEEAHSGEIVAAMID-GEAT 179

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            KVL  R    + L   N  Y    ++  +   + +++
Sbjct: 180 VKVLRRR-NGHVLLEPRNPAYE--VIDGDEAVILGKVV 214


>gi|157155496|ref|YP_001461935.1| putative repressor protein [Escherichia coli E24377A]
 gi|191166562|ref|ZP_03028391.1| putative repressor protein [Escherichia coli B7A]
 gi|218694199|ref|YP_002401866.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           55989]
 gi|218703832|ref|YP_002411351.1| regulatory protein CI from bacteriophage origin [Escherichia coli
           UMN026]
 gi|300819564|ref|ZP_07099758.1| peptidase S24-like domain protein [Escherichia coli MS 107-1]
 gi|300895848|ref|ZP_07114428.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
 gi|331676460|ref|ZP_08377157.1| 26 kDa repressor protein (Regulatory protein CI) [Escherichia coli
           H591]
 gi|157077526|gb|ABV17234.1| putative repressor protein [Escherichia coli E24377A]
 gi|190903367|gb|EDV63087.1| putative repressor protein [Escherichia coli B7A]
 gi|218350931|emb|CAU96632.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           55989]
 gi|218430929|emb|CAR11803.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           UMN026]
 gi|300360234|gb|EFJ76104.1| peptidase S24-like domain protein [Escherichia coli MS 198-1]
 gi|300527890|gb|EFK48952.1| peptidase S24-like domain protein [Escherichia coli MS 107-1]
 gi|320196986|gb|EFW71605.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           WV_060327]
 gi|320643661|gb|EFX12798.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           O157:H- str. 493-89]
 gi|320648981|gb|EFX17575.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           O157:H- str. H 2687]
 gi|320665037|gb|EFX32141.1| Regulatory protein CI from bacteriophage origin [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323153453|gb|EFZ39708.1| helix-turn-helix family protein [Escherichia coli EPECa14]
 gi|325497847|gb|EGC95706.1| putative repressor protein [Escherichia fergusonii ECD227]
 gi|331075953|gb|EGI47250.1| 26 kDa repressor protein (Regulatory protein CI) [Escherichia coli
           H591]
          Length = 251

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 29  ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 82

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 83  WLSSGVGNMSDSTVQPIQSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 139

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 140 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 199

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 200 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 240


>gi|323159779|gb|EFZ45752.1| peptidase S24-like family protein [Escherichia coli E128010]
          Length = 230

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 66/215 (30%), Gaps = 15/215 (6%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +D        T   LA++ G+  +S N+        R     T  I K+L    E + 
Sbjct: 5   ERLDLAMRNAKFTQGRLAKEVGMAQSSVNQLLNKANGSR----KTVEIAKVLGVNPEWLA 60

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH--N 128
             +            + + I    +             +  G        P+I       
Sbjct: 61  SGVGPMEIVTSADSHQIRNIS-EDWVTDSYVVDVLDIRYSCGPGSYNSDFPDIVRSIAIE 119

Query: 129 GIYAIQ-------TQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
             YA +       +          SM       D++ ++ +++   GD +     +G   
Sbjct: 120 PGYASRVFGGRPASAIKAINAHGDSMKGTIDPEDLVFVDVSVRTFNGDGIYAFTYSGTSH 179

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
            K L   +  ++ ++S N  Y    +E  D E + 
Sbjct: 180 IKRLQKIKD-TLTVISDNPAYKDWAIEPEDFEQLH 213


>gi|302383254|ref|YP_003819077.1| LexA family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193882|gb|ADL01454.1| transcriptional repressor, LexA family [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 230

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/224 (14%), Positives = 62/224 (27%), Gaps = 6/224 (2%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   ++PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQHELLMFIHERIKETGVSPSFDEMKEALDLASKSGIHRLITALEERGFIRRLAHR 60

Query: 59  FKILA--ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            + L      E             R    +    P    P + +      G    G    
Sbjct: 61  ARALEVVKLPEQATTGPVRGRQPFRPDVIEGGGRPRAAEPANDTRELVLVGKIAAGVPIA 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKP 175
            +     R           +    + +  SM       GD++++      + G+ ++   
Sbjct: 121 AIQQDHGRYSVPEAMLGAGEHYMLEIEGDSMIEAGILNGDLVVIKRVDTASSGEIVVALV 180

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              +   K L  ++G SI L   N  Y         +E   +++
Sbjct: 181 EGEEATLKRL-RKKGNSIALEPANRAYETRIFGPDQVEVQGKLV 223


>gi|256061227|ref|ZP_05451378.1| LexA repressor [Brucella neotomae 5K33]
 gi|261325234|ref|ZP_05964431.1| LexA repressor [Brucella neotomae 5K33]
 gi|261301214|gb|EEY04711.1| LexA repressor [Brucella neotomae 5K33]
          Length = 240

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/235 (12%), Positives = 56/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD------------- 105
            + L            L           E  +  +                         
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K L      SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRLRREGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|296101665|ref|YP_003611811.1| putative phage represso [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295056124|gb|ADF60862.1| putative phage represso [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 256

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/228 (12%), Positives = 67/228 (29%), Gaps = 15/228 (6%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +        LT   L    G+   +  K +        +     +  K+      +
Sbjct: 27  LAERLKEARTLRGLTQKALGDLVGVSQAAIQKIETGKANQTTKLVELANALKV-KPEWLS 85

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSG-------SGGFFDSGVFPTGNK------W 115
             +   L           ++   +  +  S           F        G+       +
Sbjct: 86  SGEGAMLLTGQDEAIPPSDQWGTVEPWDNSTPLPDDEVEVPFLKDIELACGDGTFPREDY 145

Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175
           N   +   ++    + A +           SM P+  +G  + +N   +     ++    
Sbjct: 146 NGYKLRFSKATLRRVNAHRESVICFPAHGNSMEPVIPEGTTVAININDKKIVDGKVYAIS 205

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMSDIEWIARILWAS 222
           + G    K+L       + + S N   +P +  ++  ++ I R+ W S
Sbjct: 206 QDGWNRLKILYRVGPNRLSIRSFNHVEHPDEEADLDSVQIIGRMFWTS 253


>gi|331695961|ref|YP_004332200.1| SOS-response transcriptional repressor, LexA [Pseudonocardia
           dioxanivorans CB1190]
 gi|326950650|gb|AEA24347.1| SOS-response transcriptional repressor, LexA [Pseudonocardia
           dioxanivorans CB1190]
          Length = 243

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 64/226 (28%), Gaps = 25/226 (11%)

Query: 2   TSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGR-NRWPS 54
           TS +   +K+ E I    ER    PS   +    GL  TS   ++ +    +G   R P+
Sbjct: 29  TSLTPRQRKVLEVIRDWVERFGYPPSVREIGDAVGLTSTSSVHHQLRSLERKGYLRRDPN 88

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
                 + A  +              R        +PLL    +G               
Sbjct: 89  RTRAVDVRAPEDVADADADSRDPGTTRDEHPAPAYVPLLGDIAAGGPI------LAEQAV 142

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            +   +P            +        +  SM       GD +++        G+ +  
Sbjct: 143 QSVFPLPREIVG-------EGTLFLLNVRGDSMVEAAITDGDWVVVRQQPVAEQGEIVAA 195

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
               G+   K    R    + LM  N  Y        +   + R++
Sbjct: 196 MID-GEATVKTFRRR-DGHVWLMPANPAYDPI--PGDEATILGRVV 237


>gi|167856791|ref|ZP_02479443.1| putative prophage repressor CI [Haemophilus parasuis 29755]
 gi|167852086|gb|EDS23448.1| putative prophage repressor CI [Haemophilus parasuis 29755]
          Length = 217

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 67/218 (30%), Gaps = 28/218 (12%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN---- 66
           + +    +  NL    +A   G    +             R P+   + +++  T     
Sbjct: 7   QYVREKMQEQNLRQDDIAESMGKTQGAIGHWLTG-----RRMPNVNEVAQMINLTGVNKV 61

Query: 67  --ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                  + D   +   T+ KK +  PL+    +G            G  ++ +      
Sbjct: 62  ILNGDGTIEDFDPNITPTSVKKSRAYPLVSSIQAGMWTETYDFRDSEG--YDYIDTEIDA 119

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
            P              +    SM P + +GD+++++   + + GD +      G+   K 
Sbjct: 120 GP---------DAFFLRVSGMSMEPKFSEGDLVLIDVRKRPHPGDFVAAVNGNGEATLKR 170

Query: 185 LISR------RGRSIDLMSLNCCYPVDTVEMSDIEWIA 216
                          +L+ LN  +P  +    DI  I 
Sbjct: 171 YRELGELSPSGNPHFELVPLNQDFPTLSSMKQDIRIIG 208


>gi|90423954|ref|YP_532324.1| LexA repressor [Rhodopseudomonas palustris BisB18]
 gi|123089654|sp|Q215D1|LEXA_RHOPB RecName: Full=LexA repressor
 gi|90105968|gb|ABD88005.1| SOS-response transcriptional repressor, LexA [Rhodopseudomonas
           palustris BisB18]
          Length = 237

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/232 (12%), Positives = 61/232 (26%), Gaps = 14/232 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRW-----PST 55
           M +    ++   I+   +   + PS    K  LD  S +   R       R      P+ 
Sbjct: 1   MLTRKQYELLRFINERLKEAGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLPNR 60

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------GFFDSGV 108
               +++      +             +  +     +      G              G 
Sbjct: 61  ARAIEVIKLPELGVNPGGGNGRRGFTPSVIEGNLGRVRPAASLGGDDDSGRTVAVPVMGR 120

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNC 167
              G     +                 +    + +  SM+      GD+ ++      + 
Sbjct: 121 IAAGTPIEALQTRSHTISMPADMLGSGEHYALEVRGDSMVDAGILDGDMALIQKNDSADT 180

Query: 168 GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           GD ++      +   K    R   SI L   N  Y V  +  + +    +++
Sbjct: 181 GDIVVALIDEEEATLKRFRRRGA-SIALEPANAAYEVRILPPNRVRIQGKLI 231


>gi|311068351|ref|YP_003973274.1| LexA repressor [Bacillus atrophaeus 1942]
 gi|310868868|gb|ADP32343.1| LexA repressor [Bacillus atrophaeus 1942]
          Length = 206

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 62/227 (27%), Gaps = 36/227 (15%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILRFIKAEVKTKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                     E+ +     +   P        S +    N
Sbjct: 61  TKPRAIEILD-------------------EEEVQIPKSQVVNVPVIGKVTAGSPITAVEN 101

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +P+   P              +    SM+       D +I+      N G+ ++
Sbjct: 102 IEEYFPLPDRMVPP------DEHVFMLEIMGESMIDAGILDKDYVIVKQQSTANNGEIVV 155

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K         + L   N       ++   +  + +++
Sbjct: 156 AMTEDDEATVKRFYK-EDTHVRLQPENPTMEPIILQN--VSILGKVI 199


>gi|62179766|ref|YP_216183.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62127399|gb|AAX65102.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
          Length = 259

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 71/229 (31%), Gaps = 20/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   + ++    N+  + LA   G+D  + ++ +     G+ +  + +++ ++      
Sbjct: 2   NIGNRVRQLRRAKNMKIAELAEAIGVDAANISRLE----TGKQKQFTEQTLSRLADCLGV 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---------- 117
            I +L     S G T  K                          GN              
Sbjct: 58  DIAELFT-SDSKGNTVCKHSDMRKDSANVKDLFRIEILDVSASAGNGLIQGGDVIDVIHA 116

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +   + ++          +      +  SM P    GD++ ++ +I    GD + +    
Sbjct: 117 IEYNKDKALAMFGGRPAAELKVINVRGDSMAPTIEPGDLIFVDISINQFDGDGIYVFGFD 176

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
             I  K L       + ++S N  Y   ++            ++L  SQ
Sbjct: 177 DKIYVKRLQMIPD-KLLVISDNTNYREWSITKDNECRFGVFGKVL-ISQ 223


>gi|16273380|ref|NP_439627.1| transcriptional regulatory protein [Haemophilus influenzae Rd KW20]
 gi|260580259|ref|ZP_05848088.1| transcriptional regulatory protein [Haemophilus influenzae RdAW]
 gi|1175815|sp|P44207|Y1476_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional regulator
           HI_1476
 gi|1574317|gb|AAC23123.1| transcriptional regulatory protein [Haemophilus influenzae Rd KW20]
 gi|260092936|gb|EEW76870.1| transcriptional regulatory protein [Haemophilus influenzae RdAW]
          Length = 239

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 86/239 (35%), Gaps = 27/239 (11%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M   +     E I+ + ++ N  PS  ARK G+  ++  + ++   +     PS  ++ K
Sbjct: 1   MQYQNQDNFPERIEYLVDKLN-GPSEFARKTGVTLSTITRWRKGEAD-----PSRSNLVK 54

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEK----EIPLLYFPPSGSGGFFDSGVFPT----- 111
           I   T  +I  L      + +TTE+K                   G      + +     
Sbjct: 55  IAEVTGVSIEWLATGKIKEEKTTEEKPAGSLVSRAFERMQAMLEEGVSMIDSYSSINVSA 114

Query: 112 --GNKWNTVGVPEIRSPHNGIY-----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ 164
             G+    +  P+ + P++                      SMLP     D ++++ + +
Sbjct: 115 GFGSFNEGITQPDGQEPYSDELLTSLGVKADNCAVFWANGNSMLPTINNYDQMLVDLSRK 174

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNC-CYPVDTVEMS---DIEWIARIL 219
              GDR+ +      +  K +       I L+S N   YP  ++      +++ I +++
Sbjct: 175 EIQGDRIYLVQNGESVWVKRV-KMEWDGISLISDNKEEYPPISITGENAQNLQIIGQVV 232


>gi|311898752|dbj|BAJ31160.1| putative LexA repressor [Kitasatospora setae KM-6054]
          Length = 289

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/219 (13%), Positives = 56/219 (25%), Gaps = 28/219 (12%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            +++ E I    +R    PS   + +  GL  TS   ++      +G  R          
Sbjct: 88  QRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLR---------- 137

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                              R T  +    P   + P          +       +   +P
Sbjct: 138 --RDPHRPRAYEVRGVEVARPTATETSGRPSTSYVPLVGRIAAGGPILAEQTVEDVFPLP 195

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       + +      +  SM       GD + +        GD +      G+ 
Sbjct: 196 RQLVG-------EGELFALTVKGDSMVEAAICDGDWVTVRKQPVAENGDIVAAMID-GEA 247

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K L       I LM  N  Y        +   + +++
Sbjct: 248 TVKRLKR-EDGKIWLMPHNAAYEPI--PGDNATILGKVV 283


>gi|260556784|ref|ZP_05829002.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
 gi|260410043|gb|EEX03343.1| LexA repressor [Acinetobacter baumannii ATCC 19606]
          Length = 224

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 73/223 (32%), Gaps = 24/223 (10%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +       E +  + +   +T   LA K+G+  +  +  +    +      ST SI +
Sbjct: 5   MATL-----GENLKAIRKAKKMTQKELAMKSGVKQSVISDLETGNAK------STGSILE 53

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           +  A   T  +L     S      +   +  +       +G                +  
Sbjct: 54  LATALGVTAEELKKGIVSKFDNNVEPITKKLIPVLSWVQAGTMTSVEAIDPNKINEWLP- 112

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNC---GDRLLIKPRT 177
           P                   +    S  P Y +GD +++N   QV      D ++++  +
Sbjct: 113 PLSADD-------PDGCFYLRVVGVSNSPRYEEGDYILVNPNYQVCDLIADDLIVVRNNS 165

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSD-IEWIARIL 219
                K L+    +   L +LN  +  + +E  D +E +  ++
Sbjct: 166 D-ATFKKLVIESDQRKYLQALNPNFHPNIIEFEDGMELVGLVI 207


>gi|312138044|ref|YP_004005380.1| lexa repressor [Rhodococcus equi 103S]
 gi|311887383|emb|CBH46695.1| LexA repressor [Rhodococcus equi 103S]
          Length = 212

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 60/218 (27%), Gaps = 29/218 (13%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
            ++I   I    + H   PS   +A   GL   ++ +K  +   +               
Sbjct: 14  QQRILLTIRDWVDGHGCPPSTREIADAVGLRSTSTVSKHLKALEDK-------------- 59

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
                       L      T     +        P        + +    +    + +P 
Sbjct: 60  GFLRRGGSMTRQLDVRPFLTGSAPGRSTENTVTVPVVGDIAAGAPILAEEHADEMLSLPR 119

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                             + +  SM+      GD +++    + + G+ +      G+  
Sbjct: 120 ELVGS-------GTVFALRVRGESMVDAAICDGDTVVVRRQEEAHSGEIVAAMID-GEAT 171

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            KVL  R    + L   N  Y    ++  +   + +++
Sbjct: 172 VKVLRRR-NGHVLLEPRNPAYE--VIDGDEAVILGKVV 206


>gi|256113706|ref|ZP_05454510.1| LexA repressor [Brucella melitensis bv. 3 str. Ether]
 gi|265995060|ref|ZP_06107617.1| LexA repressor [Brucella melitensis bv. 3 str. Ether]
 gi|262766173|gb|EEZ11962.1| LexA repressor [Brucella melitensis bv. 3 str. Ether]
          Length = 240

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/235 (11%), Positives = 55/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD------------- 105
            + L            L           E  +  +                         
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K        SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRRLGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|260664377|ref|ZP_05865230.1| LexA repressor [Lactobacillus jensenii SJ-7A-US]
 gi|260562263|gb|EEX28232.1| LexA repressor [Lactobacillus jensenii SJ-7A-US]
          Length = 208

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/223 (11%), Positives = 63/223 (28%), Gaps = 31/223 (13%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             + K++   I+ + ++  ++ S L+ K G+  +  +           R        K  
Sbjct: 10  MRNSKEVIAYINELRKQQKMSISELSEKVGMAKSGVSLYFNG-----KREFPINHAEKFA 64

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
            A +  +  LL +                     P          +    N      +  
Sbjct: 65  KALHTNVFDLLGVGDDSMIK-------------VPVLGEIACGQPILAEPNIEGYRYI-- 109

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                       +     K +  SM+P   +   ++++    V   D + +         
Sbjct: 110 ------NCRDQSSNLFFLKAKGDSMVPTIPENSYVLIDRDESVEDNDIVAVLID-NSATL 162

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSD---IEWIARILWAS 222
           K      G ++ L   N  +P   +  ++    + + + +  S
Sbjct: 163 KRYHK-NGNTVTLTGDNPNFPPIVLTSTEDAIAQILGKAIQVS 204


>gi|261406209|ref|YP_003242450.1| LexA family transcriptional repressor [Paenibacillus sp. Y412MC10]
 gi|329930854|ref|ZP_08284253.1| repressor LexA [Paenibacillus sp. HGF5]
 gi|261282672|gb|ACX64643.1| transcriptional repressor, LexA family [Paenibacillus sp. Y412MC10]
 gi|328934556|gb|EGG31061.1| repressor LexA [Paenibacillus sp. HGF5]
          Length = 208

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 62/226 (27%), Gaps = 32/226 (14%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M+  S ++  I E I          PS   +    GL   ++ +    R   +G  R   
Sbjct: 1   MSKISSRQLAILEFIRNEVRSKGYPPSVREIGEAVGLASSSTVHGHLDRLEKKGLIRRDP 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+   + +    +   +  +L                     P          +    N 
Sbjct: 61  TK--PRAIELLGQEESESANLFTHTIAR-------------VPVVGKVTAGVPITAMENI 105

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            +   +P+        Y    +         SM       GD +I+      + GD ++ 
Sbjct: 106 EDYFPLPQH-------YVGDDKVFMLSVVGDSMIEAGIHSGDYVIVRQQQTADNGDIVVA 158

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +   + L   N  Y    +    +  + +++
Sbjct: 159 MTEEDEATVKTFYKEKD-HVRLQPENPTYEPLRLNH--VTILGKVI 201


>gi|299822660|ref|ZP_07054546.1| repressor lexA [Listeria grayi DSM 20601]
 gi|299816189|gb|EFI83427.1| repressor lexA [Listeria grayi DSM 20601]
          Length = 204

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 35/220 (15%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWPSTESIFK 60
            + I++ I    +     PS   +    GL   ++ +   +R   +G   R P+     +
Sbjct: 7   QQDIYDFIKAQVKAKGYPPSVREIGEAVGLASSSTVHGHLERLETKGLIRRDPTKPRAIE 66

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120
           IL                    + + E +IP     P        + +    N      +
Sbjct: 67  IL--------------------SLEDEIDIPSTVAVPIIGKVTAGTPITAIENVEEYFPL 106

Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGD 179
           PE  +      + ++     +    SM+      GD +I+      N G+ ++      +
Sbjct: 107 PEHLT------SGESNVFMLEIDGESMMKAGILDGDRVIVRQQSNANNGEIVVAMTEDNE 160

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K     +     L   N  +    ++   +  + +++
Sbjct: 161 ATCKRFYKEQD-HFRLQPENDAFEPIILQ--QVSILGKVI 197


>gi|327478517|sp|Q7TY15|LEXA_MYCBO RecName: Full=LexA repressor
 gi|327478518|sp|A1KM58|LEXA_MYCBP RecName: Full=LexA repressor
 gi|327478519|sp|C1AFH9|LEXA_MYCBT RecName: Full=LexA repressor
          Length = 236

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/217 (13%), Positives = 58/217 (26%), Gaps = 20/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + I + I          PS   +    GL  TS    +   +E +       +  + + 
Sbjct: 31  QRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVN 90

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
                   L  +    G     +    P+L    +G                +   +P  
Sbjct: 91  VRGADDAALPPVTEVAGSDALPEPTFAPVLGRIAAGGPI------LAEEAVEDVFPLPRE 144

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     +      K    SM       GD +++      + GD +      G+   
Sbjct: 145 LVG-------EGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMID-GEATV 196

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K      G  + LM  N  +       +D   + +++
Sbjct: 197 KTFKR-AGGQVWLMPHNPAFDPI--PGNDATVLGKVV 230


>gi|49186482|ref|YP_029735.1| LexA repressor [Bacillus anthracis str. Sterne]
 gi|49180409|gb|AAT55785.1| LexA repressor [Bacillus anthracis str. Sterne]
          Length = 269

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/226 (11%), Positives = 59/226 (26%), Gaps = 34/226 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M   +   + I + I    +     PS   + +  GL   ++ +    R   +G  R   
Sbjct: 64  MEKLTKRQQDILDFIKLKVQEKGYPPSVREIGQAVGLASSSTVHGHLSRLEEKGYIRRDP 123

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+   + +    E                 K    +P+                    + 
Sbjct: 124 TK--PRAIEILGEDRMDTETQSVIQVPIVGKVTAGLPI----------------TAVESV 165

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
                +P          A   Q    +    SM       GD++++        G+ ++ 
Sbjct: 166 EEHFPLPASIV------AGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSAYNGEIVVA 219

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +     L   N       ++   +  I +++
Sbjct: 220 LTEDNEATVKRFYKEKD-HFRLQPENSSLEPIILK--QVSVIGKVI 262


>gi|48697234|ref|YP_024964.1| putative prophage repressor protein [Burkholderia phage BcepC6B]
 gi|47779040|gb|AAT38403.1| putative prophage repressor protein [Burkholderia phage BcepC6B]
          Length = 244

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 71/250 (28%), Gaps = 46/250 (18%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           MT   H  I   I  + +   LT   LA   G+   S ++ +      +        + K
Sbjct: 1   MTEAQH--IGTRIRELRKAKGLTLQQLADVFGISRASVSEWESGRS--KPDANKLVLLAK 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEK--------------------------EIPLLY 94
            L    E +             +    +                          ++PL+ 
Sbjct: 57  ELHTAVEYLLNGDTNDAMSFADSAASRRRLRGGTKQSASIVDNSESNITEWPVGKLPLIS 116

Query: 95  FPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLP----- 149
           +  +G          P G+  + +  P         +   +     +    SM       
Sbjct: 117 WVQAGDWSEIVDNFQP-GDAEDWIACP---------FPSGSHGFVLRVVGDSMYNPSGDM 166

Query: 150 LYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM 209
            +R+GD + +N   +      ++ +        K L+        L +LN  +P   + +
Sbjct: 167 SFREGDFISVNPDREAQHRSLVIARHNGEKATFKQLLIDENDGPMLFALNPNWPKRYIAL 226

Query: 210 S-DIEWIARI 218
             D E I  +
Sbjct: 227 DKDTEIIGVV 236


>gi|295111675|emb|CBL28425.1| SOS-response transcriptional repressors (RecA-mediated
           autopeptidases) [Synergistetes bacterium SGP1]
          Length = 233

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/228 (14%), Positives = 77/228 (33%), Gaps = 13/228 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPST---ES 57
           MT  +   I   I    +   +    LA + G+ P +  + +   I  R+   S    E 
Sbjct: 1   MTEGAEAGIGARIMARRKALGMKRPELAERLGVKPNTLYRYEIGSIGIRDSMKSRIAKEL 60

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
              +    + T     +    +        +    +    + +G  F+      G +   
Sbjct: 61  GVSLAYLVSGTAEVGRERGSEETPEPVVPPQVYLPILDQEACAGSGFNWSDVRAGARK-W 119

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
           +  P + +         T+    K +  SM+    + G ++++N   +V  GD   ++  
Sbjct: 120 MPWPTLETGGP---VGPTKPYFVKVEGDSMIGANIQDGCLILVNPNTEVRSGDIAYVRWN 176

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE---WIARIL-W 220
                 K +I      ++L   N  +    ++  ++E    + +++ W
Sbjct: 177 -DRCSVKGIIFYNDGRVELRPANKDFSSIWIQRDEVEFLTILGKVVRW 223


>gi|293418613|ref|ZP_06661048.1| regulatory protein CI bacteriophage origin [Escherichia coli B088]
 gi|291325141|gb|EFE64556.1| regulatory protein CI bacteriophage origin [Escherichia coli B088]
          Length = 251

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 29  ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 82

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 83  WLSSGVGNMSDSTVQPIQTTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 139

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 140 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 199

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 200 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 240


>gi|218886357|ref|YP_002435678.1| phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757311|gb|ACL08210.1| putative phage repressor [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 236

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 68/232 (29%), Gaps = 27/232 (11%)

Query: 10  WEAI-DRMAERHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
           +EAI +R+ +   +   S LAR  G+ P S N +++ G      W     +      T  
Sbjct: 7   FEAIFERLMKAAGVRNDSELARALGITPQSVNGARKRGEVP-PAW-----VQSYAERTGT 60

Query: 68  TICQLLDLPFSDGRTTEKKEKE--------IPLLYFPPSGSGGFFDSGVFPTGNKWNTV- 118
           +   L           + +             +                   GN    V 
Sbjct: 61  SSDWLFFGRGPMRVEEQAQAAPAGKSAFGPETVTCADCELVMVPMVEARLSAGNGSFEVG 120

Query: 119 -GVPEIRSPHNGIYA---IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
             V    +            +     +    SM P    GD+++++ + +     ++   
Sbjct: 121 ADVERRYAFRTDFLLRKGSPSSMVLMRVDGDSMEPYVLNGDVVLVDQSQRDPRPGKVYAV 180

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE-----MSDIEWIARILWA 221
                +  K +++     + L S N  Y    ++        +  I R +W 
Sbjct: 181 GVEELVYLK-VVNASPGKLVLTSYNASYAPLEIDARGDLADGVRIIGRAVWV 231


>gi|313682117|ref|YP_004059855.1| phage repressor [Sulfuricurvum kujiense DSM 16994]
 gi|313154977|gb|ADR33655.1| putative phage repressor [Sulfuricurvum kujiense DSM 16994]
          Length = 219

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 70/228 (30%), Gaps = 25/228 (10%)

Query: 1   MTSFSHKKIWEAIDRMAE----RHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTE 56
           M +FS   I E I  +         +    +A    +   +F   K+     RN+ P TE
Sbjct: 1   MKTFS--DIVETIKDIVSSEFPEKKVFDKDVAELLDISQMNFATMKK-----RNKIPFTE 53

Query: 57  SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
            +      +      L +           +   +       + +GG         G    
Sbjct: 54  LLDFCAKRSIAINWLLYNQSPESLIEPTNRFYMVRYFSSVNASAGG---------GADNE 104

Query: 117 TVGVPEIRSPHNGIYAIQTQ-----DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRL 171
            +    +    N + ++  +              SM P +   DI+ +N +        +
Sbjct: 105 ELDYEPLMLEDNFVLSLGGEKELRHIEAINVSGDSMEPSFSYNDIIFINRSKTDISRGGI 164

Query: 172 LIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                   +  K +  R    +D++S N  YP       ++E I R++
Sbjct: 165 FTIRTEHGLFIKRIQVRIDGKLDIISDNKDYPTYVARRDEVEVIGRVV 212


>gi|193067699|ref|ZP_03048666.1| putative repressor protein [Escherichia coli E110019]
 gi|192959111|gb|EDV89547.1| putative repressor protein [Escherichia coli E110019]
          Length = 251

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 29  ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 82

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 83  WLSSGVGNMSDSTVQPIQSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 139

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 140 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 199

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 200 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 240


>gi|170718159|ref|YP_001785187.1| phage repressor [Haemophilus somnus 2336]
 gi|168826288|gb|ACA31659.1| putative phage repressor [Haemophilus somnus 2336]
          Length = 235

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 74/224 (33%), Gaps = 19/224 (8%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           I   I    ER NLT   LA+   +  ++    +        R P    I  I      T
Sbjct: 11  IGNRIREQRERLNLTRPELAKAVDVSLSALQGWE-----MNEREPQASMIITIANELGVT 65

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPT---GNKWNTVGVPEIRS 125
              LL       + T ++  E                S +  +   G+    V  P+ + 
Sbjct: 66  PNYLLTGENDQPKKTIERAVEKVKDLTENVVIMIASYSSINVSAGFGSFNEGVTKPDGKE 125

Query: 126 PHNGIY-----AIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCG-DRLLIKPRTGD 179
           P+             +     T   SM P    GD L+++       G D++ +     +
Sbjct: 126 PYADSLLQSLRVNPDKCAVFWTNGRSMEPTINNGDQLLVDLNRNQIKGDDKIYLIQHGEN 185

Query: 180 IVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSD---IEWIARIL 219
           I  K +  +    ++L+S N   YP   +   +   ++ I R++
Sbjct: 186 IWVKRVKMKWDG-VELVSDNKDEYPPIAISDEEAQNLQIIGRVV 228


>gi|331672656|ref|ZP_08373445.1| transcriptional activator-regulatory protein [Escherichia coli
           TA280]
 gi|331070299|gb|EGI41665.1| transcriptional activator-regulatory protein [Escherichia coli
           TA280]
          Length = 251

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/222 (12%), Positives = 55/222 (24%), Gaps = 23/222 (10%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70
           E +        LT   L    G+   +  K +            T  I +I  A      
Sbjct: 29  ERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKAN------QTTKIVEIANALGVRAE 82

Query: 71  QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGI 130
            L     +   +T +  +                       G         E+       
Sbjct: 83  WLSSGVGNMSDSTVQPIQSTV---SHSKYFKIDVLDIEVSAGPGVINREFVEVLRSVEYS 139

Query: 131 YAIQTQDT---------RHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
           +                    +  SM      GD+L ++  ++   GD +          
Sbjct: 140 FDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFDGDGIYAFLYDDTAH 199

Query: 182 AKVLISRRGRSIDLMSLNCCYPVDT-VEMSD---IEWIARIL 219
            K L   +   + ++S N  Y     +E  +   +    +++
Sbjct: 200 VKRLQMMKD-KLLVISDNKSYSPWDPIEKDEMNRVFIFGKVI 240


>gi|66396213|ref|YP_240570.1| ORF022 [Staphylococcus phage 29]
 gi|62636630|gb|AAX91741.1| ORF022 [Staphylococcus phage 29]
          Length = 209

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/221 (12%), Positives = 72/221 (32%), Gaps = 22/221 (9%)

Query: 3   SFSHKKIWE-AIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKI 61
              +K+I    I R+ + +N+  + L+R   +  T+ +       +   R    E + K 
Sbjct: 1   MLGNKEIMAKNISRLMKENNVDRNKLSRDLKISYTTLSDWIN--AKTYPRIDKIEMLAKY 58

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
                 ++ +            +  + +   +   P  S       ++   N  + +   
Sbjct: 59  FGVEKSSLVE---------SPNKIVQLDTLPVKKIPVVSKISAGMPIYTEENLVDYIYFS 109

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIV 181
                         ++   +    SM  L+ +GD++++     V  G   ++     +  
Sbjct: 110 TKNLNP------DKEEFGLQVSGDSMNELFDEGDVVVVEKDSIVENGQLGVVMINGYNGT 163

Query: 182 AKVLISRRGRSIDLMSL--NCCYPVDTVEMSD-IEWIARIL 219
            K +    G  I L+    N  +        D ++ + R++
Sbjct: 164 VKRI-RYNGDQIILIPESNNPNHYPQVYGKDDEVKIVGRVV 203


>gi|167970057|ref|ZP_02552334.1| LexA repressor [Mycobacterium tuberculosis H37Ra]
 gi|215404685|ref|ZP_03416866.1| LexA repressor [Mycobacterium tuberculosis 02_1987]
 gi|215412526|ref|ZP_03421260.1| LexA repressor [Mycobacterium tuberculosis 94_M4241A]
 gi|215431659|ref|ZP_03429578.1| LexA repressor [Mycobacterium tuberculosis EAS054]
 gi|215446973|ref|ZP_03433725.1| LexA repressor [Mycobacterium tuberculosis T85]
 gi|218754456|ref|ZP_03533252.1| LexA repressor [Mycobacterium tuberculosis GM 1503]
 gi|219558729|ref|ZP_03537805.1| LexA repressor [Mycobacterium tuberculosis T17]
 gi|253798198|ref|YP_003031199.1| repressor lexA [Mycobacterium tuberculosis KZN 1435]
 gi|254232822|ref|ZP_04926149.1| repressor lexA [Mycobacterium tuberculosis C]
 gi|254365377|ref|ZP_04981422.1| repressor lexA [Mycobacterium tuberculosis str. Haarlem]
 gi|254551776|ref|ZP_05142223.1| LexA repressor [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260187737|ref|ZP_05765211.1| LexA repressor [Mycobacterium tuberculosis CPHL_A]
 gi|260201845|ref|ZP_05769336.1| LexA repressor [Mycobacterium tuberculosis T46]
 gi|260206029|ref|ZP_05773520.1| LexA repressor [Mycobacterium tuberculosis K85]
 gi|294994188|ref|ZP_06799879.1| LexA repressor [Mycobacterium tuberculosis 210]
 gi|297635328|ref|ZP_06953108.1| LexA repressor [Mycobacterium tuberculosis KZN 4207]
 gi|297732324|ref|ZP_06961442.1| LexA repressor [Mycobacterium tuberculosis KZN R506]
 gi|306776999|ref|ZP_07415336.1| repressor lexA [Mycobacterium tuberculosis SUMu001]
 gi|306780902|ref|ZP_07419239.1| repressor lexA [Mycobacterium tuberculosis SUMu002]
 gi|306785527|ref|ZP_07423849.1| repressor lexA [Mycobacterium tuberculosis SUMu003]
 gi|306790123|ref|ZP_07428445.1| repressor lexA [Mycobacterium tuberculosis SUMu004]
 gi|306794207|ref|ZP_07432509.1| repressor lexA [Mycobacterium tuberculosis SUMu005]
 gi|306798625|ref|ZP_07436927.1| repressor lexA [Mycobacterium tuberculosis SUMu006]
 gi|306807479|ref|ZP_07444147.1| repressor lexA [Mycobacterium tuberculosis SUMu007]
 gi|306968779|ref|ZP_07481440.1| repressor lexA [Mycobacterium tuberculosis SUMu009]
 gi|306973114|ref|ZP_07485775.1| repressor lexA [Mycobacterium tuberculosis SUMu010]
 gi|307080823|ref|ZP_07489993.1| repressor lexA [Mycobacterium tuberculosis SUMu011]
 gi|307085415|ref|ZP_07494528.1| repressor lexA [Mycobacterium tuberculosis SUMu012]
 gi|313659657|ref|ZP_07816537.1| LexA repressor [Mycobacterium tuberculosis KZN V2475]
 gi|327478521|sp|A5U672|LEXA_MYCTA RecName: Full=LexA repressor
 gi|327478522|sp|Q50765|LEXA_MYCTU RecName: Full=LexA repressor
 gi|124601881|gb|EAY60891.1| repressor lexA [Mycobacterium tuberculosis C]
 gi|134150890|gb|EBA42935.1| repressor lexA [Mycobacterium tuberculosis str. Haarlem]
 gi|253319701|gb|ACT24304.1| repressor lexA [Mycobacterium tuberculosis KZN 1435]
 gi|308214656|gb|EFO74055.1| repressor lexA [Mycobacterium tuberculosis SUMu001]
 gi|308326302|gb|EFP15153.1| repressor lexA [Mycobacterium tuberculosis SUMu002]
 gi|308329831|gb|EFP18682.1| repressor lexA [Mycobacterium tuberculosis SUMu003]
 gi|308333474|gb|EFP22325.1| repressor lexA [Mycobacterium tuberculosis SUMu004]
 gi|308337469|gb|EFP26320.1| repressor lexA [Mycobacterium tuberculosis SUMu005]
 gi|308341141|gb|EFP29992.1| repressor lexA [Mycobacterium tuberculosis SUMu006]
 gi|308346074|gb|EFP34925.1| repressor lexA [Mycobacterium tuberculosis SUMu007]
 gi|308353666|gb|EFP42517.1| repressor lexA [Mycobacterium tuberculosis SUMu009]
 gi|308357513|gb|EFP46364.1| repressor lexA [Mycobacterium tuberculosis SUMu010]
 gi|308361466|gb|EFP50317.1| repressor lexA [Mycobacterium tuberculosis SUMu011]
 gi|308365061|gb|EFP53912.1| repressor lexA [Mycobacterium tuberculosis SUMu012]
 gi|323718714|gb|EGB27876.1| repressor lexA [Mycobacterium tuberculosis CDC1551A]
          Length = 236

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/217 (13%), Positives = 59/217 (27%), Gaps = 20/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + I + I          PS   +    GL  TS    +   +E +       +  + + 
Sbjct: 31  QRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVN 90

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
                   L  +    G     +   +P+L    +G                +   +P  
Sbjct: 91  VRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPI------LAEEAVEDVFPLPRE 144

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     +      K    SM       GD +++      + GD +      G+   
Sbjct: 145 LVG-------EGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMID-GEATV 196

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K      G  + LM  N  +       +D   + +++
Sbjct: 197 KTFKR-AGGQVWLMPHNPAFDPI--PGNDATVLGKVV 230


>gi|296171811|ref|ZP_06852925.1| SOS regulatory protein LexA [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295893947|gb|EFG73715.1| SOS regulatory protein LexA [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 231

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/217 (12%), Positives = 56/217 (25%), Gaps = 20/217 (9%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA 63
            + I   I          PS   +    GL  TS    +   +E +       +  + + 
Sbjct: 26  QRTILNVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVD 85

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEI 123
                           G     +   +P+L    +G                +   +P  
Sbjct: 86  VRGADDEVAAPATEVAGSDALPEPTFVPVLGRIAAGGPI------LAEEAVEDVFPLPRE 139

Query: 124 RSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVA 182
                     +      K    SM       GD +++      + GD +      G+   
Sbjct: 140 LVG-------EGTLFLLKVVGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMLD-GEATV 191

Query: 183 KVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           K      G  + LM  N  +       ++   + +++
Sbjct: 192 KTFKR-AGGQVWLMPHNPAFDPI--PGNEATVLGKVV 225


>gi|240080373|ref|ZP_04724916.1| putative CI protein [Neisseria gonorrhoeae FA19]
 gi|254494046|ref|ZP_05107217.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226513086|gb|EEH62431.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|319411131|emb|CBY91536.1| Repressor protein CI [Neisseria meningitidis WUE 2594]
          Length = 232

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/228 (14%), Positives = 69/228 (30%), Gaps = 19/228 (8%)

Query: 11  EAIDRM-AERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           + I  + A+R N   +  +R     P   N+         +      +  +I        
Sbjct: 5   DRIKNLIADRFNGNQAEFSRAINKAPAQINQWLNGYRNIGD---GVAAQIEIALGLPRGW 61

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPS--------GSGGFFDSGVFPTGNKW-NTVG- 119
               D P     + +     I  +    S            F+       GN + + +  
Sbjct: 62  VDGNDKPGIPVDSIKSNATVIGSVDAWDSKTPLSDDDCEVPFYKDVCLSAGNGFSDEIED 121

Query: 120 -----VPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIK 174
                +   +S                    SM P++  G  L +N+A ++    ++   
Sbjct: 122 YNGYKLRFSKSTLRRHGINPDDVVCVSADGDSMEPVFPDGATLGINTADKMIKDGKIYAI 181

Query: 175 PRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWAS 222
             +G +  K+L       + + S N  Y  +T  +  +  I R+ W S
Sbjct: 182 NHSGLLRTKILQKLPDNQVRIKSYNPEYKDETASLDSLTVIGRVFWWS 229


>gi|187929409|ref|YP_001899896.1| putative phage repressor [Ralstonia pickettii 12J]
 gi|187726299|gb|ACD27464.1| putative phage repressor [Ralstonia pickettii 12J]
          Length = 302

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/236 (14%), Positives = 65/236 (27%), Gaps = 27/236 (11%)

Query: 15  RMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTES-----IFKILAATNETI 69
               +  ++   LA+KA L  ++  + +R    G     +        +  +    +   
Sbjct: 65  ARRTQLEMSQEALAKKARLSQSTIAQIERGRNRGSKYVVALADALLVPVRWLADGGDMPP 124

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD---------SGVFPTGNKWNTVGV 120
                      +T  +   +  +     + S   +                G   +    
Sbjct: 125 RPSEVEGLFVSQTEAEDLVDRGVEELLQARSDDAYWKGTVAIPQFDAGGSMGGGIDLPDQ 184

Query: 121 P----------EIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDR 170
           P          E    +                  SM PL+  GD L+L+  +     D 
Sbjct: 185 PGLIQNLRVTKEWLDFNVRSCTSPKNLCVVTGFGDSMRPLFNPGDPLLLDRGVITVEIDA 244

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS-DIEWIARIL--WASQ 223
           +       +   K L    G  +  +S N  Y   T+    D E   R+L  W S+
Sbjct: 245 VYFFRIGKEGFIKRLQRVPGNGLIAISENKAYREWTITPDMDFEVFGRVLKAWRSE 300


>gi|195661226|ref|YP_002117694.1| CI-like repressor [Lactobacillus phage Lrm1]
 gi|166200940|gb|ABY84327.1| CI-like repressor [Lactobacillus phage Lrm1]
          Length = 224

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 75/228 (32%), Gaps = 21/228 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             ++ +I + ++ +  R  ++ S LAR+  +  +S ++          R      + K  
Sbjct: 1   MKTNDEIIKTLNDLRNREGISISELARRVDMAKSSVSRYFNGT-----REFPLNYVDKFA 55

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           +A   T  + L           KK       Y P   S G   +    T +   T+ +P+
Sbjct: 56  SAL-HTTPESLIGVSPVDSFKVKKLNVHSYPYIPAEISAGILCNVDPLTSDDVETIQLPD 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVN---CGDRLLIKPRTGD 179
                 G YA  +          SM      G ++ +     +     GD ++       
Sbjct: 115 S---VMGRYAGDSSILMMHVNGESMNQTIPDGSLIAVKQYSDIQDLNDGDIVVFADDGDY 171

Query: 180 IVAKVLISRRGRSID-LMSLNCC--YPVD-----TVEMSDIEWIARIL 219
              K   + R + I   +  +    +         +E  +I+ I R++
Sbjct: 172 A-VKYFYNDRQKQIVTFIPDSTDKRFSPIMYTYEDLEEENIKIIGRVV 218


>gi|315646590|ref|ZP_07899708.1| transcriptional repressor, LexA family protein [Paenibacillus
           vortex V453]
 gi|315278233|gb|EFU41553.1| transcriptional repressor, LexA family protein [Paenibacillus
           vortex V453]
          Length = 208

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 61/226 (26%), Gaps = 32/226 (14%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M+  S ++  I E I          PS   +    GL   ++ +    R   +G  R   
Sbjct: 1   MSKISSRQLAILEFIRNEVRSKGYPPSVREIGEAVGLASSSTVHGHLDRLEKKGLIRRDP 60

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+   + +    +      +L                     P          +    N 
Sbjct: 61  TK--PRAIELLGQEESDSANLFTHTIAR-------------VPVVGKVTAGVPITAMENI 105

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
            +   +P+        Y    +         SM       GD +I+      + GD ++ 
Sbjct: 106 EDYFPLPQH-------YVGDDKVFMLSVVGDSMIEAGIHSGDYVIVRQQQTADNGDIVVA 158

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +   + L   N  Y    +    +  + +++
Sbjct: 159 MTEEDEATVKTFYKEKD-HVRLQPENPTYEPLRLNH--VTILGKVI 201


>gi|52141849|ref|YP_084980.1| LexA repressor [Bacillus cereus E33L]
 gi|51975318|gb|AAU16868.1| LexA repressor (SOS response repressor) [Bacillus cereus E33L]
          Length = 269

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/226 (11%), Positives = 59/226 (26%), Gaps = 34/226 (15%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGRNRWPS 54
           M   +   + I + I    +     PS   + +  GL   ++ +    R   +G  R   
Sbjct: 64  MEKLTKRQQDILDFIKLKVQEKGYPPSVREIGQAVGLASSSTVHGHLSRLEEKGYIRRDP 123

Query: 55  TESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNK 114
           T+   + +    E                 K    +P+                    + 
Sbjct: 124 TK--PRAIEILGEDRMDTETQSVIQVPIVGKVTAGLPI----------------TAVESV 165

Query: 115 WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLI 173
                +P          A   Q    +    SM       GD++++        G+ ++ 
Sbjct: 166 EEHFPLPASIV------AGADQVFMLRISGDSMIEAGIFDGDLVVVRQQQSAYNGEIVVA 219

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                +   K     +     L   N       ++   +  I +++
Sbjct: 220 LTEDNEATVKRFYKEKD-HFRLQPENSSLEPIILK--QVSVIGKVI 262


>gi|153000591|ref|YP_001366272.1| putative phage repressor [Shewanella baltica OS185]
 gi|151365209|gb|ABS08209.1| putative phage repressor [Shewanella baltica OS185]
          Length = 247

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 62/213 (29%), Gaps = 21/213 (9%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           +    A K G+   +     + G       P  ++  +I      +I  L          
Sbjct: 35  SIREFAIKIGVSEGTLRNLIKGG------EPKLDTAIRIAEEAGVSIRWLATGNGPKYPN 88

Query: 83  TEKKEKEIPLLYFPPSGSG------GFFDSGVFPTGNK--WNTVGVPEIRSPHNGIYA-- 132
            +  +     + +                  V  TG+    +  GV    S         
Sbjct: 89  RQLDDISQEGIVYVHQDQFNEEYFLIEGYDVVVSTGHGAFNDETGVRRRLSFRKNWLKYR 148

Query: 133 --IQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRG 190
                       +  SM P    GD L+++ +        + +     D+ AK L     
Sbjct: 149 GLKPENLKVVYAKGNSMEPAIHSGDSLLVDISKTTLEDGCIFVLRLGDDLYAKRLQKLFD 208

Query: 191 RSIDLMSLNCCYPVDTVEMSD---IEWIARILW 220
             I+++S N  Y    V   +   ++ I +++W
Sbjct: 209 GGIEILSDNKEYKSQIVSAGELPMLQIIGKVVW 241


>gi|261495314|ref|ZP_05991765.1| putative LexA family transcriptional regulator/S24 family protease
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308991|gb|EEY10243.1| putative LexA family transcriptional regulator/S24 family protease
           [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 239

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 69/213 (32%), Gaps = 22/213 (10%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
             S  AR  G+   S ++  +   +     PS  ++ KI   +N ++  L     S  ++
Sbjct: 26  NYSEFARAVGVAQASLSRWVKGEAD-----PSRSNLVKIAEVSNVSLEWLATGKESKPQS 80

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPT-------GNKWNTVGVPEIRSPHNGIYAIQ- 134
                                     F T       G+    V  P+ + P+        
Sbjct: 81  ENTSIVAREFERLEKMADDIVSMINGFSTINVSAGFGSFNEGVTKPDGQEPYADSLLQSL 140

Query: 135 ----TQDTRHKTQDTSMLPLYRKGDILILNSAI-QVNCGDRLLIKPRTGDIVAKVLISRR 189
                         TSM P    GD ++++ +  +    D++ +      +  K +  + 
Sbjct: 141 GVKAHNCGVFWANGTSMHPTIADGDQMLVDFSKREPRGDDKIYLVQNGESVWVKRI-RKE 199

Query: 190 GRSIDLMSLNCCYPVDTVEMSD---IEWIARIL 219
              I+L+S N  Y    +   +   ++ I +++
Sbjct: 200 WDYIELISDNESYRPIQITAEEAQNLQIIGQVV 232


>gi|332853630|ref|ZP_08434860.1| peptidase S24-like protein [Acinetobacter baumannii 6013150]
 gi|332870803|ref|ZP_08439453.1| peptidase S24-like protein [Acinetobacter baumannii 6013113]
 gi|332728454|gb|EGJ59828.1| peptidase S24-like protein [Acinetobacter baumannii 6013150]
 gi|332732013|gb|EGJ63290.1| peptidase S24-like protein [Acinetobacter baumannii 6013113]
          Length = 227

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 70/202 (34%), Gaps = 13/202 (6%)

Query: 26  GLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEK 85
            LAR  G+ P S +        G+++    E++ K           L     S      +
Sbjct: 24  DLARAVGVKPPSVSDWL----SGKSKTMEGENLLKASKFLGVNPNWLATGNGSPTNNNIE 79

Query: 86  KEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG---VPEIRSPHNGIYAIQTQDTRHKT 142
            ++   +++   +             G     V     P   +  + I +          
Sbjct: 80  DDQLSNVIFRDLNLHKIPILD-FVQAGFWHEVVYDGTTPHSYTYTDYISSNPEAIFSVIV 138

Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRS-----IDLMS 197
           Q  SM P +++GD+LI++++I    G  ++ +  + +   K               +L+ 
Sbjct: 139 QGNSMEPDFKEGDMLIVDASIAPKPGSYVIAQNGSHEATFKKYRVLSHDEYGRDIFELIP 198

Query: 198 LNCCYPVDTVEMSDIEWIARIL 219
           LN  +P+ +    +I  I  ++
Sbjct: 199 LNKDFPILSSITHEIRIIGVVV 220


>gi|238021321|ref|ZP_04601747.1| hypothetical protein GCWU000324_01220 [Kingella oralis ATCC 51147]
 gi|237868301|gb|EEP69307.1| hypothetical protein GCWU000324_01220 [Kingella oralis ATCC 51147]
          Length = 226

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 63/203 (31%), Gaps = 19/203 (9%)

Query: 23  TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRT 82
           + S LAR  G   +  +  +R            E   KI   T  ++  L+         
Sbjct: 24  SDSDLARWLGFATSVISGYRRRETVP------LEQCIKIAEQTGVSLDWLILGKGDPKPQ 77

Query: 83  TEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN------TVGVPEIRSPHNGIYAIQTQ 136
            + +                         G   +         +P  R   N        
Sbjct: 78  HQPQSAVQDY--DDQDAVWVPLYDVYASAGGGEDVWGEEIEQYIPFSRVWLNQKNLHSKN 135

Query: 137 DTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLM 196
            +  K +  SM P    GD++++N+A QV  GD + +      +  K L +    S+ + 
Sbjct: 136 LSCVKVRGDSMEPTLNNGDVILVNTARQV--GDGVFVVRIGSLLRVKRLQTLINGSLKIS 193

Query: 197 SLNCCYPVDTVEM---SDIEWIA 216
           S N  Y  +T+     SD   I 
Sbjct: 194 SDNPIYESETLNPKEDSDFAIIG 216


>gi|23502022|ref|NP_698149.1| LexA repressor [Brucella suis 1330]
 gi|62290057|ref|YP_221850.1| LexA repressor [Brucella abortus bv. 1 str. 9-941]
 gi|82699984|ref|YP_414558.1| LexA repressor [Brucella melitensis biovar Abortus 2308]
 gi|148558946|ref|YP_001259065.1| LexA repressor [Brucella ovis ATCC 25840]
 gi|161619096|ref|YP_001592983.1| LexA repressor [Brucella canis ATCC 23365]
 gi|163843409|ref|YP_001627813.1| LexA repressor [Brucella suis ATCC 23445]
 gi|189024297|ref|YP_001935065.1| LexA repressor [Brucella abortus S19]
 gi|225627613|ref|ZP_03785650.1| LexA repressor [Brucella ceti str. Cudo]
 gi|225852643|ref|YP_002732876.1| LexA repressor [Brucella melitensis ATCC 23457]
 gi|237815566|ref|ZP_04594563.1| LexA repressor [Brucella abortus str. 2308 A]
 gi|254689369|ref|ZP_05152623.1| LexA repressor [Brucella abortus bv. 6 str. 870]
 gi|254693853|ref|ZP_05155681.1| LexA repressor [Brucella abortus bv. 3 str. Tulya]
 gi|254697502|ref|ZP_05159330.1| LexA repressor [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701886|ref|ZP_05163714.1| LexA repressor [Brucella suis bv. 5 str. 513]
 gi|254704432|ref|ZP_05166260.1| LexA repressor [Brucella suis bv. 3 str. 686]
 gi|254706672|ref|ZP_05168500.1| LexA repressor [Brucella pinnipedialis M163/99/10]
 gi|254714217|ref|ZP_05176028.1| LexA repressor [Brucella ceti M644/93/1]
 gi|254717653|ref|ZP_05179464.1| LexA repressor [Brucella ceti M13/05/1]
 gi|254730399|ref|ZP_05188977.1| LexA repressor [Brucella abortus bv. 4 str. 292]
 gi|256159873|ref|ZP_05457602.1| LexA repressor [Brucella ceti M490/95/1]
 gi|256255115|ref|ZP_05460651.1| LexA repressor [Brucella ceti B1/94]
 gi|256257615|ref|ZP_05463151.1| LexA repressor [Brucella abortus bv. 9 str. C68]
 gi|256263864|ref|ZP_05466396.1| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
 gi|260168846|ref|ZP_05755657.1| LexA repressor [Brucella sp. F5/99]
 gi|260546609|ref|ZP_05822348.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|260566321|ref|ZP_05836791.1| peptidase family S24 [Brucella suis bv. 4 str. 40]
 gi|260754886|ref|ZP_05867234.1| LexA repressor [Brucella abortus bv. 6 str. 870]
 gi|260758103|ref|ZP_05870451.1| LexA repressor [Brucella abortus bv. 4 str. 292]
 gi|260761927|ref|ZP_05874270.1| LexA repressor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883898|ref|ZP_05895512.1| LexA repressor [Brucella abortus bv. 9 str. C68]
 gi|261214138|ref|ZP_05928419.1| LexA repressor [Brucella abortus bv. 3 str. Tulya]
 gi|261219492|ref|ZP_05933773.1| LexA repressor [Brucella ceti M13/05/1]
 gi|261222310|ref|ZP_05936591.1| LexA repressor [Brucella ceti B1/94]
 gi|261314133|ref|ZP_05953330.1| LexA repressor [Brucella pinnipedialis M163/99/10]
 gi|261321987|ref|ZP_05961184.1| LexA repressor [Brucella ceti M644/93/1]
 gi|261752449|ref|ZP_05996158.1| LexA repressor [Brucella suis bv. 5 str. 513]
 gi|261755109|ref|ZP_05998818.1| LexA repressor [Brucella suis bv. 3 str. 686]
 gi|261758334|ref|ZP_06002043.1| peptidase family S24 [Brucella sp. F5/99]
 gi|265998274|ref|ZP_06110831.1| LexA repressor [Brucella ceti M490/95/1]
 gi|294852484|ref|ZP_06793157.1| LexA repressor [Brucella sp. NVSL 07-0026]
 gi|297248457|ref|ZP_06932175.1| LexA repressor [Brucella abortus bv. 5 str. B3196]
 gi|29427806|sp|Q8G0F1|LEXA_BRUSU RecName: Full=LexA repressor
 gi|71648699|sp|Q57CZ5|LEXA_BRUAB RecName: Full=LexA repressor
 gi|123727397|sp|Q2YRR1|LEXA_BRUA2 RecName: Full=LexA repressor
 gi|166224557|sp|A5VQR8|LEXA_BRUO2 RecName: Full=LexA repressor
 gi|189046530|sp|A9M5F7|LEXA_BRUC2 RecName: Full=LexA repressor
 gi|189046531|sp|B0CGU2|LEXA_BRUSI RecName: Full=LexA repressor
 gi|229621201|sp|B2S5Z4|LEXA_BRUA1 RecName: Full=LexA repressor
 gi|254809090|sp|C0RJB4|LEXA_BRUMB RecName: Full=LexA repressor
 gi|23347975|gb|AAN30064.1| LexA repressor [Brucella suis 1330]
 gi|62196189|gb|AAX74489.1| LexA, LexA repressor [Brucella abortus bv. 1 str. 9-941]
 gi|82616085|emb|CAJ11123.1| Peptidase family S24:Peptidase S24, C-terminal:LexA DNA-binding
           region [Brucella melitensis biovar Abortus 2308]
 gi|148370203|gb|ABQ60182.1| LexA repressor [Brucella ovis ATCC 25840]
 gi|161335907|gb|ABX62212.1| LexA repressor [Brucella canis ATCC 23365]
 gi|163674132|gb|ABY38243.1| LexA repressor [Brucella suis ATCC 23445]
 gi|189019869|gb|ACD72591.1| Peptidase family S24 [Brucella abortus S19]
 gi|225617618|gb|EEH14663.1| LexA repressor [Brucella ceti str. Cudo]
 gi|225641008|gb|ACO00922.1| LexA repressor [Brucella melitensis ATCC 23457]
 gi|237788864|gb|EEP63075.1| LexA repressor [Brucella abortus str. 2308 A]
 gi|260095659|gb|EEW79536.1| peptidase family S24 [Brucella abortus NCTC 8038]
 gi|260155839|gb|EEW90919.1| peptidase family S24 [Brucella suis bv. 4 str. 40]
 gi|260668421|gb|EEX55361.1| LexA repressor [Brucella abortus bv. 4 str. 292]
 gi|260672359|gb|EEX59180.1| LexA repressor [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674994|gb|EEX61815.1| LexA repressor [Brucella abortus bv. 6 str. 870]
 gi|260873426|gb|EEX80495.1| LexA repressor [Brucella abortus bv. 9 str. C68]
 gi|260915745|gb|EEX82606.1| LexA repressor [Brucella abortus bv. 3 str. Tulya]
 gi|260920894|gb|EEX87547.1| LexA repressor [Brucella ceti B1/94]
 gi|260924581|gb|EEX91149.1| LexA repressor [Brucella ceti M13/05/1]
 gi|261294677|gb|EEX98173.1| LexA repressor [Brucella ceti M644/93/1]
 gi|261303159|gb|EEY06656.1| LexA repressor [Brucella pinnipedialis M163/99/10]
 gi|261738318|gb|EEY26314.1| peptidase family S24 [Brucella sp. F5/99]
 gi|261742202|gb|EEY30128.1| LexA repressor [Brucella suis bv. 5 str. 513]
 gi|261744862|gb|EEY32788.1| LexA repressor [Brucella suis bv. 3 str. 686]
 gi|262552742|gb|EEZ08732.1| LexA repressor [Brucella ceti M490/95/1]
 gi|263093995|gb|EEZ17929.1| peptidase family S24 [Brucella melitensis bv. 2 str. 63/9]
 gi|294821073|gb|EFG38072.1| LexA repressor [Brucella sp. NVSL 07-0026]
 gi|297175626|gb|EFH34973.1| LexA repressor [Brucella abortus bv. 5 str. B3196]
 gi|326409162|gb|ADZ66227.1| Peptidase family S24 [Brucella melitensis M28]
 gi|326538872|gb|ADZ87087.1| LexA repressor [Brucella melitensis M5-90]
          Length = 240

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/235 (11%), Positives = 55/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD------------- 105
            + L            L           E  +  +                         
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K        SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRREGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|157734756|dbj|BAF80762.1| prophage repressor [Enterobacteria phage P22]
          Length = 216

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 67/220 (30%), Gaps = 28/220 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    ++  +  + L +  G+   + ++ +R   E     P+ ES+  +  A   + 
Sbjct: 7   GERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETE-----PNGESLLALSKALQCSP 61

Query: 70  C-----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                  L     +     E +     + +          +         W         
Sbjct: 62  DYLLKGDLSQTNVAYHSRHEPRGSYPLISWVSAGQWMEAVEPYHKRAIENW--------- 112

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGD 179
             H+              Q  SM         +G I++++  ++   G  ++       +
Sbjct: 113 --HDTTVDCSEDSFWLDVQGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENE 170

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 171 ATFKKLVMDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|117925374|ref|YP_865991.1| SOS-response transcriptional repressor, LexA [Magnetococcus sp.
           MC-1]
 gi|171460783|sp|A0L9E2|LEXA_MAGSM RecName: Full=LexA repressor
 gi|117609130|gb|ABK44585.1| SOS-response transcriptional repressor, LexA [Magnetococcus sp.
           MC-1]
          Length = 231

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 68/224 (30%), Gaps = 28/224 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--GLARKAGLD-PTSFNKSKRFGIEGRNRWPSTES 57
           MT  S ++I + I    +R  L P+   +A   G+  P++  + ++   +G  R      
Sbjct: 19  MTP-SQERIMQVIRNAIDRDGLPPTVKEIAEALGMKTPSAHEQVQKLVKKGFIR------ 71

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
             +                           + +P+       +G    +     G     
Sbjct: 72  --RTPRKARSIEIVEQSPEEEPVEKKPDVARLVPVPIIGEVAAGIPILAVENHIGEL--- 126

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPR 176
                           +      K +  SM+     +GD +++        GD ++    
Sbjct: 127 ---------LMDSRTARGPCFALKVKGDSMIDAEIFEGDYVVVRHQALAENGDIVVAILD 177

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEM-SDIEWIARIL 219
            G+   K L      +I+L   N  Y    V    DI  + ++L
Sbjct: 178 -GEATVKRLY-ISEETIELRPENRSYQPIVVPPGGDIRILGKVL 219


>gi|26990601|ref|NP_746026.1| Cro/CI family transcriptional regulator [Pseudomonas putida KT2440]
 gi|24985584|gb|AAN69490.1|AE016583_14 transcriptional regulator, Cro/CI family [Pseudomonas putida
           KT2440]
          Length = 215

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 73/215 (33%), Gaps = 18/215 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILA---A 64
           ++ + I       NLT   LA + G+D TS +  +R   +G +      S+  + A   A
Sbjct: 2   ELKDRIKAARAHANLTQGQLATQVGMDQTSISNLERGKSQGTSYIAQIASVCGVSALWLA 61

Query: 65  TNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                          G       + I ++     G+ G++       G            
Sbjct: 62  EGTGSMLHSVSNVMPGPPIISPTRRIEIVGTAQLGNDGYWVGLDVAEGWVETW------- 114

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKV 184
                  +        + +  SM P  R G I +     ++  G+ +++    G  + K 
Sbjct: 115 -------SRDEDAYALRLKGDSMAPAIRSGWIAVCEPNHRLVPGEYVMVTTVDGQSMVKE 167

Query: 185 LISRRGRSIDLMSLNCCY-PVDTVEMSDIEWIARI 218
           L+      ++L S+N  Y     +  +DIE I  +
Sbjct: 168 LLFENEEGVNLASVNAAYGERRVIAWADIEKIHYV 202


>gi|170723210|ref|YP_001750898.1| putative phage repressor [Pseudomonas putida W619]
 gi|169761213|gb|ACA74529.1| putative phage repressor [Pseudomonas putida W619]
          Length = 248

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/249 (15%), Positives = 71/249 (28%), Gaps = 34/249 (13%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
           M +   + +   +  +  RH L+P+ L R+ G+  ++ ++        +   PS   + K
Sbjct: 1   MQAMQKRNVATVLRELLARHGLSPTELHRRTGVPQSTLSRILSE----KIADPSDRHVSK 56

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEKEIPL------------LYFPPSGSGGFFDSGV 108
           I      +  QL                                       S  F     
Sbjct: 57  IADYFGVSTEQLRGRAELGASREAALPAHGHADLSDISLWDDETPVEDDEVSVPFLREVE 116

Query: 109 FPTGNKWNTVGVPEIRSPHNGIYAIQTQDT------RHKTQDTSMLPLYRKGDILILNSA 162
              G+    +   E      G  +++              +  SMLP+ R G  + +N+ 
Sbjct: 117 LAAGSGRFVIEESERARLRFGKRSLRHNGVQFDQAKCVTVRGNSMLPVLRDGATVGVNTG 176

Query: 163 I----QVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDT------VEMSDI 212
                 +  GD L      G +  K +       I L S N     D       ++   I
Sbjct: 177 KCSIGDIIDGD-LYAINHNGQLRVKQVYRLPTG-IRLRSFNRDEHPDEDYSFQLLQEEQI 234

Query: 213 EWIARILWA 221
             +  + W 
Sbjct: 235 SLLGHVFWW 243


>gi|85373679|ref|YP_457741.1| prophage MuMc02-like, S24 family peptidase [Erythrobacter litoralis
           HTCC2594]
 gi|84786762|gb|ABC62944.1| prophage MuMc02-like, peptidase, family S24 [Erythrobacter
           litoralis HTCC2594]
          Length = 211

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 67/217 (30%), Gaps = 15/217 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + E +DR+  +     + ++R  G +P    +  +    G  R    E    +     
Sbjct: 2   EHVREELDRLILKSGYGYASISRLLGRNPAYVQQFIKR---GSPRKLDDEDRKTLACFFG 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                                 +  +               V  +       G  E    
Sbjct: 59  VD--------EQVLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGFDERWLR 110

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGDIVAKVL 185
           H    A     +    +  SM P    GD ++++++       D + +      +V K +
Sbjct: 111 HLTS-AKSASLSIVGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDALVVKRI 169

Query: 186 ISRRGRS-IDLMSLNCCYPV-DTVEMSDIEWIARILW 220
             + G   I + S N  YP    ++ S++  + R++W
Sbjct: 170 AIKPGGRQITIASDNPAYPTWYDMDRSEVHVVGRVIW 206


>gi|315925034|ref|ZP_07921251.1| LexA repressor 1 [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621933|gb|EFV01897.1| LexA repressor 1 [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 219

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 71/216 (32%), Gaps = 9/216 (4%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAG-LDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
            +++ I +  +   ++ S LA   G  + +S  K +   I+          I +I  A  
Sbjct: 3   DLYKNIKKRRQELKISQSKLAELVGYTNRSSIAKIEAGKID-----LPQSKIVEIAEALR 57

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG-VPEIRS 125
            T  +L+          +    +  +              G  P G     V  +     
Sbjct: 58  TTPKELMGWEDEKAEIKKINWSDNVVPMAINRDVVSIPVLGSVPAGVPVEAVEDIIGTIE 117

Query: 126 PHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVL 185
                 A   +    +   TSM P+Y +GD +++      + G   +I     D   K +
Sbjct: 118 IPREWLAGGAEFIGLRVTGTSMYPMYLEGDTVVIEIKHDCDSGQDAIIYVNGYDATLKTV 177

Query: 186 ISRRGRSIDLMSLNCCYPVDTVEMSD--IEWIARIL 219
           +     +I L   N  +P  T    D  IE +  ++
Sbjct: 178 VKNDDGTITLKPRNPEWPTKTYGPGDDPIEILGPVV 213


>gi|254465213|ref|ZP_05078624.1| LexA repressor [Rhodobacterales bacterium Y4I]
 gi|206686121|gb|EDZ46603.1| LexA repressor [Rhodobacterales bacterium Y4I]
          Length = 233

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 62/229 (27%), Gaps = 12/229 (5%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP------- 53
           M +     + E I +  +R  + PS    K  LD  S +   R       R         
Sbjct: 1   MLTKKQLDLLEFIHKRLQRDGVPPSFDEMKEALDLRSKSGIHRLITALEERGFIRRLAHR 60

Query: 54  -STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTG 112
                I ++  +      +            +   +           +      G    G
Sbjct: 61  ARAIEILRLPDSLG-GTAEPQGFAPRVIDGGQASPRAAAAADPMRLAAIELPVMGRIAAG 119

Query: 113 NKWNTVGVPEIRSPHNGIYAIQ-TQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDR 170
                +     +    G       Q    + +  SM       GDI+++  A   + GD 
Sbjct: 120 VPIEAISQVSHQVAVPGGMISPNGQHYALEVKGDSMIEAGINDGDIVVIREADTADNGDI 179

Query: 171 LLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           ++      +   K    + G  I L + N  Y         ++   R++
Sbjct: 180 VVALVEGQEATLKYYQRQ-GGMIALEAANPVYETRRYREDQVQVQGRLV 227


>gi|254710220|ref|ZP_05172031.1| LexA repressor [Brucella pinnipedialis B2/94]
 gi|256031714|ref|ZP_05445328.1| LexA repressor [Brucella pinnipedialis M292/94/1]
 gi|261317778|ref|ZP_05956975.1| LexA repressor [Brucella pinnipedialis B2/94]
 gi|265988809|ref|ZP_06101366.1| LexA repressor [Brucella pinnipedialis M292/94/1]
 gi|261297001|gb|EEY00498.1| LexA repressor [Brucella pinnipedialis B2/94]
 gi|264661006|gb|EEZ31267.1| LexA repressor [Brucella pinnipedialis M292/94/1]
          Length = 240

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/235 (11%), Positives = 57/235 (24%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTT------------EKKEKEIPLLYFPPSGSGG-FFD 105
            + L            L                     +  +  P      + +      
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGNLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTVIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K        SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRREGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|22296545|ref|NP_680505.1| CI like protein [Lactobacillus phage A2]
 gi|6599314|emb|CAB63660.1| CI like protein [Lactobacillus phage A2]
          Length = 224

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 75/228 (32%), Gaps = 21/228 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             ++ +I + ++ +  R  ++ S LAR+  +  +S ++          R      + K  
Sbjct: 1   MKTNDEIIKTLNDLRNREGISISELARRVDMAKSSVSRYFNGT-----REFPLNYVDKFA 55

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           +A   T  + L           KK       Y P   S G   +    T +   T+ +P+
Sbjct: 56  SAL-HTTPESLIGVSPVDPFKVKKLNVHSYPYIPAEISAGILCNVDPLTSDDVETIQLPD 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV---NCGDRLLIKPRTGD 179
                 G YA  +          SM      G ++ +     +     GD ++       
Sbjct: 115 S---VMGRYAGDSSILMMHINGESMNQTIPDGSLIAVKQYNDIQDLKDGDIVVFADDGDY 171

Query: 180 IVAKVLISRRGRSID-LMSLNCC--YPVD-----TVEMSDIEWIARIL 219
              K   + R + I   +  +    +         +E  +I+ I R++
Sbjct: 172 A-VKYFYNDRQKQIVTFIPDSTDKRFSPIMYTYEDLEEENIKIIGRVV 218


>gi|17987123|ref|NP_539757.1| LexA repressor [Brucella melitensis bv. 1 str. 16M]
 gi|256044800|ref|ZP_05447704.1| LexA repressor [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565599|ref|ZP_05836083.1| LexA repressor [Brucella melitensis bv. 1 str. 16M]
 gi|265991224|ref|ZP_06103781.1| LexA repressor [Brucella melitensis bv. 1 str. Rev.1]
 gi|25453096|sp|Q8YHG1|LEXA_BRUME RecName: Full=LexA repressor
 gi|17982786|gb|AAL52021.1| lexa repressor [Brucella melitensis bv. 1 str. 16M]
 gi|260151667|gb|EEW86761.1| LexA repressor [Brucella melitensis bv. 1 str. 16M]
 gi|263002008|gb|EEZ14583.1| LexA repressor [Brucella melitensis bv. 1 str. Rev.1]
          Length = 240

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/235 (11%), Positives = 55/235 (23%), Gaps = 17/235 (7%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFD------------- 105
            + L            L           E  +  +                         
Sbjct: 61  ARALEVLRLPDSIAPGLSPQKKFAPSVIEGSLGKVASVQPVRPAPAPQNSEAPATVSVPV 120

Query: 106 SGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQ 164
            G    G   + +                 +    + +  SM+      GD +I+     
Sbjct: 121 MGRIAAGVPISAIQNQTHMLSLPPEMIGAGEHYALEVKGDSMIDAGIFDGDTIIIKRGDT 180

Query: 165 VNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            N G+ ++      +   K        SI L + N  Y         +    +++
Sbjct: 181 ANPGEIVVALVDEEEATLKRFRREGA-SIALEAANPAYETRIFGPDRVHVQGKLV 234


>gi|304322192|ref|YP_003855835.1| LexA repressor [Parvularcula bermudensis HTCC2503]
 gi|303301094|gb|ADM10693.1| LexA repressor [Parvularcula bermudensis HTCC2503]
          Length = 229

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 58/222 (26%), Gaps = 8/222 (3%)

Query: 3   SFSHKK--IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60
             + K+  +   I        ++PS    K  LD  S +   R       R        K
Sbjct: 1   MLTEKQRALLMFIHDRTTETGVSPSFEEMKEALDLKSKSGIHRLITALEERGFIRRLAHK 60

Query: 61  ILAATNETICQLLDLPFSDGRTTEKKEK----EIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
             A     + + +        +     +      P    P S        G    G    
Sbjct: 61  ARALEVVRLPENVGAAPRPQPSAPFAPRVIDGSRPTPPPPASDLTEISVLGKIAAGTPIT 120

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKP 175
            +   + R           +    +    SM       GD +I+        GD ++   
Sbjct: 121 AIQHEQARVQVPPSMLRSGEHFALEVAGDSMIEAGIFDGDTVIIQRCDDATNGDIVVALV 180

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217
              +   K L  +RG SI L   N  Y         ++   R
Sbjct: 181 EDEEATLKYL-RKRGNSIALEPANAAYETRIFGADQVKVQGR 221


>gi|118468004|ref|YP_887073.1| LexA repressor [Mycobacterium smegmatis str. MC2 155]
 gi|171472978|sp|A0QVY5|LEXA_MYCS2 RecName: Full=LexA repressor
 gi|71360996|emb|CAJ19247.1| LexA protein [Mycobacterium smegmatis]
 gi|118169291|gb|ABK70187.1| LexA repressor [Mycobacterium smegmatis str. MC2 155]
          Length = 243

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/219 (14%), Positives = 64/219 (29%), Gaps = 22/219 (10%)

Query: 6   HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTS--FNKSKRFGIEGRNRWPSTESIFKI 61
            + I E I          PS   +    GL  TS   ++ +    +G  R          
Sbjct: 36  QRTILEVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVD 95

Query: 62  LAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVP 121
           + A ++     +      G     +   +P+L    +G                +   +P
Sbjct: 96  VRAADDPAAAAVVTTDVAGSDALPEPTFVPVLGRIAAGGPI------LAEEAVEDVFPLP 149

Query: 122 EIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDI 180
                       +      K    SM+      GD +++      + GD +      G+ 
Sbjct: 150 RELVG-------EGSLFLLKVVGDSMVDAAICDGDWVVVRQQNVADNGDIVAAMID-GEA 201

Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             K     RG+ + LM  N  Y       ++   + +++
Sbjct: 202 TVKTFKRARGQ-VWLMPHNPAYDPI--PGNEAAVLGKVV 237


>gi|326623794|gb|EGE30139.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 231

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 71/229 (31%), Gaps = 20/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   + ++    N+  + LA   G+D  + ++ +     G+ +  + +++ ++      
Sbjct: 2   NIGNRVRQLRRAKNMKIAELAEAIGVDAANISRLE----TGKQKQFTEQTLSRLADCLGV 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---------- 117
            I +L     S G T  K                          GN              
Sbjct: 58  DIAELFT-SDSKGNTVCKHSDMRKDSDNVKDLFRIEILDVSASAGNGLIQGGDVIDVIHA 116

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +   + ++          +      +  SM P    GD++ ++ +I    GD + +    
Sbjct: 117 IEYNKDKALAMFGGRPAAELKVINVRGDSMAPTIEPGDLIFVDISINQFDGDGIYVFGFD 176

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
             I  K L       + ++S N  Y   ++            ++L  SQ
Sbjct: 177 DKIYVKRLQMIPD-KLLVISDNTNYREWSITKDNECRFGVFGKVL-ISQ 223


>gi|307700848|ref|ZP_07637873.1| repressor LexA [Mobiluncus mulieris FB024-16]
 gi|307613843|gb|EFN93087.1| repressor LexA [Mobiluncus mulieris FB024-16]
          Length = 251

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/249 (10%), Positives = 67/249 (26%), Gaps = 34/249 (13%)

Query: 1   MTSFS--HKKIWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKS------KRFGIEGRN 50
           M+  +   +++ + + R++   +  PS   LA   GL   S  +       ++  +    
Sbjct: 1   MSDLTKRQREVLDTLYRLSRELSYPPSVRELASAMGLSSPSSVQHHLEVLVEKGYLRRVP 60

Query: 51  RWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFP 110
             P      K+   T     ++        +   + ++         +           P
Sbjct: 61  NQPRALEFVKLPEGTPAATTEMAPHAPEAPKVYSETQRNNQNNSSLKTTENISATIHTIP 120

Query: 111 TGNK-------------------WNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL- 150
            G                          + E       ++    +    +    SM    
Sbjct: 121 IGVADTADSNAIPLVGRIAAGIPITAEELVEDTFMLPRLFTGAGELFMLEVNGESMRDAA 180

Query: 151 YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS 210
              GD +++ +  +   GD +      G+   K     +   I L+  N  +        
Sbjct: 181 IMNGDWVVVRAQNEARNGDIV-AAMLEGEATVKEFSRDK-GHIWLLPHNPSFEPI--PGD 236

Query: 211 DIEWIARIL 219
               + +++
Sbjct: 237 GATILGKVV 245


>gi|269125827|ref|YP_003299197.1| SOS-response transcriptional repressor, LexA [Thermomonospora
           curvata DSM 43183]
 gi|268310785|gb|ACY97159.1| SOS-response transcriptional repressor, LexA [Thermomonospora
           curvata DSM 43183]
          Length = 229

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/224 (14%), Positives = 66/224 (29%), Gaps = 25/224 (11%)

Query: 4   FSHKK--IWEAIDRMAERHNLTPS--GLARKAGLDPTSF--NKSKRFGIEGR-NRWPSTE 56
            + ++  + E I    +R    PS   +    GL  TS   ++ +    +G   R P+  
Sbjct: 17  LTQRQRMVLEVIRDSVQRRGYPPSMREIGEAVGLTSTSSVSHQLRTLQRKGYLRRDPNRP 76

Query: 57  SIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWN 116
              ++       +        ++G     K   +PL+    +G             +  +
Sbjct: 77  RAVEVRMPEGAPVRAAGTAASAEGAEAAPKAAMVPLVGRIAAGGPI------LAEESVED 130

Query: 117 TVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKP 175
              +P            +      +    SM       GD +++        GD +    
Sbjct: 131 VFALPRQLVG-------EGTHFLLQVSGDSMIEAAIADGDWVVVRQQPVAENGDIVAAMI 183

Query: 176 RTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
             G+   K    +    I LM  N  Y        +   + R++
Sbjct: 184 D-GEATVKTFKRKE-GHIWLMPQNKAYDPI--PGDEATILGRVV 223


>gi|23505482|ref|NP_700411.1| regulatory protein [Salmonella phage ST64B]
 gi|168822352|ref|ZP_02834352.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|23379229|gb|AAL25916.1| Sb38 [Salmonella phage ST64B]
 gi|205341260|gb|EDZ28024.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|261247208|emb|CBG25032.1| phage encoded transcriptional regulator [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267994039|gb|ACY88924.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158553|emb|CBW18064.1| predicted bacteriophage protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|320086315|emb|CBY96088.1| 26 kDa repressor protein Regulatory protein CI [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|323130316|gb|ADX17746.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332988930|gb|AEF07913.1| hypothetical protein STMUK_2020 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 231

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 70/229 (30%), Gaps = 20/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   + ++    N+  + LA   G+D  + ++ +     G+ +  + +++ ++      
Sbjct: 2   NIGNRVRQLRRAKNMKIAELAEAIGVDAANISRLE----TGKQKQFTEQTLSRLADCLGV 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---------- 117
            I +L       G T  K                          GN              
Sbjct: 58  DIAELFT-SDPKGNTVCKHSDMRKDSANVKDLFRIEILDVSASAGNGLIQGGDVIDVIHA 116

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +   + ++          +      +  SM P    GD++ ++ +I    GD + +    
Sbjct: 117 IEYNKDKALAMFGGRPAAELKVINVRGDSMAPTIEPGDLIFVDISINQFDGDGIYVFGFD 176

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
             I  K L       + ++S N  Y   ++            ++L  SQ
Sbjct: 177 DKIYVKRLQMIPD-KLLVISDNTNYREWSITKDNECRFGVFGKVL-ISQ 223


>gi|299067105|emb|CBJ38301.1| putative phage repressor [Ralstonia solanacearum CMR15]
          Length = 265

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/247 (12%), Positives = 60/247 (24%), Gaps = 42/247 (17%)

Query: 14  DRMAERHNL-TPSGLARKAGLDPTSFNKSK-RFGIEG----------------RNRWPST 55
           +   E   L T + +AR            + R   +G                       
Sbjct: 10  EAARELKGLETQAEVARALNFSQQRVKNWEARGMSKGGMLRAQEIFGCSATWLETGRLPM 69

Query: 56  ESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSG-------------G 102
           E++ +   +             S         + +  +   P  +               
Sbjct: 70  ETVKQKSDSHQMEATLKEQSEASTYNPEPAHTRTLGGVSVRPIVTYESLEELPKESTVLI 129

Query: 103 FFDSGVFPTGNKWNT------VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDI 156
                    GN   T        +P        + +        K    SM P     D 
Sbjct: 130 RRIDVELSAGNGRETWHIEEKEPLPFQADYIRRLDSKPKDLVAAKVNGDSMEPRLFDNDT 189

Query: 157 LILNSAIQVNC-GDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCC-YPVDTVEMSDIE- 213
           ++++ A         +      G+++ K L       + ++S N   Y   TV    +E 
Sbjct: 190 VVVDKADTRVPANGGVFALVYAGELLVKRLFRLPDGGLKVVSDNQARYEPVTVGPDQVEH 249

Query: 214 --WIARI 218
              I R+
Sbjct: 250 VSIIGRV 256


>gi|199598926|ref|ZP_03212335.1| hypothetical phage-like protein [Lactobacillus rhamnosus HN001]
 gi|199590126|gb|EDY98223.1| hypothetical phage-like protein [Lactobacillus rhamnosus HN001]
          Length = 224

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 74/228 (32%), Gaps = 21/228 (9%)

Query: 3   SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL 62
             ++ +I + ++ +  R  ++ S LAR+  +  +S ++          R      + K  
Sbjct: 1   MKTNDEIIKTLNDLRNREGISISELARRVDMAKSSVSRYFNGT-----REFPLNYVDKFA 55

Query: 63  AATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPE 122
           +A   T  + L           KK       Y P   S G   +    T +   T+ +P+
Sbjct: 56  SAL-HTTPESLIGVSPVDPFKVKKLNVHSYPYIPADISAGILCNVDPLTSDDVETIQLPD 114

Query: 123 IRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQV---NCGDRLLIKPRTGD 179
                 G YA  +          SM      G ++ +     +     GD ++       
Sbjct: 115 S---VMGRYAGDSSILMMHVNGESMNQTIPDGSLIAVKQYNDIQDLKDGDIVVFADDGDY 171

Query: 180 IVAKVLISRRGRSID-LMSLNCC--YPVD-----TVEMSDIEWIARIL 219
              K   + R + I   +  +    +         +E  +I  I +++
Sbjct: 172 A-VKYFYNDRQKQIVTFIPDSTDKRFSPIMYTYEDLEEENINIIGKVV 218


>gi|296331000|ref|ZP_06873475.1| LexA repressor [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674518|ref|YP_003866190.1| transcriptional repressor of the SOS regulon [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296152005|gb|EFG92879.1| LexA repressor [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305412762|gb|ADM37881.1| transcriptional repressor of the SOS regulon [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 205

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 61/227 (26%), Gaps = 37/227 (16%)

Query: 1   MTSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGL-DPTSFN-KSKRFGIEGR-NRWP 53
           MT  S ++  I   I    +     PS   +    GL   ++ +    R   +G   R P
Sbjct: 1   MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDP 60

Query: 54  STESIFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGN 113
           +     +IL                      + +     +   P        S +    N
Sbjct: 61  TKPRAIEILDE--------------------EVDIPQSQVVNVPVIGKVTAGSPITAVEN 100

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLL 172
                 +P+   P              +    SM+       D +I+      N G+ ++
Sbjct: 101 IEEYFPLPDRMVPP------DEHVFMLEIMGDSMIDAGILDKDYVIVKQQNIANNGEIVV 154

Query: 173 IKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
                 +   K         I L   N       ++   +  + +++
Sbjct: 155 AMTEDDEATVKRFYK-EDTHIRLQPENPTMEPIILQN--VSILGKVI 198


>gi|329919686|ref|ZP_08276664.1| DNA-binding helix-turn-helix protein [Lactobacillus iners SPIN
           1401G]
 gi|328937338|gb|EGG33762.1| DNA-binding helix-turn-helix protein [Lactobacillus iners SPIN
           1401G]
          Length = 231

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/227 (12%), Positives = 58/227 (25%), Gaps = 28/227 (12%)

Query: 13  IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKIL---------A 63
           ID    ++NLT   L +K G   +S ++          R+P  E I +I           
Sbjct: 12  IDYFRRQNNLTMEELGQKLGKAKSSISRWVSGE-----RYPKIEEIEQIAIFFNTDIYTL 66

Query: 64  ATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGG----------FFDSGVFPTGN 113
                  +                ++  +  +                  +  G    G 
Sbjct: 67  IFGFNYNENSKSNILTVYNQLTDIRKHKVYSYAQQQLDEQNSNLNEKSSIYVVGTSAAGE 126

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
                         +        D     +  SM P      I+  +    +  G+  + 
Sbjct: 127 PIEYGDFDSEMIQTD---VPAKADKAIHIKGDSMEPKIANNSIIFYHEQPTLEIGEIGIF 183

Query: 174 KPRTGDIVAKVLISR-RGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           +     +  K        + I L S+N  Y         +  + +++
Sbjct: 184 EINGSAVTCKKYYVDYNSKKIILKSINPKYEPMYFAKDQVRILGKVV 230


>gi|212709591|ref|ZP_03317719.1| hypothetical protein PROVALCAL_00636 [Providencia alcalifaciens DSM
           30120]
 gi|212687767|gb|EEB47295.1| hypothetical protein PROVALCAL_00636 [Providencia alcalifaciens DSM
           30120]
          Length = 214

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 71/230 (30%), Gaps = 29/230 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTS-FNKSKRFGIEGRNRWPSTESIF 59
           M    ++ I E +  + E   L+ + LA+  G    S     +        R  S +   
Sbjct: 1   MKKI-NEIIGERLKSIRESRGLSQAQLAKLCGYSAASRIGNYELGE-----RKISADDAL 54

Query: 60  KILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG 119
            I  A   +  +L+            +               G F               
Sbjct: 55  VISEALGVSPAELM------FGDRSDQVVSNYEYPLFSKVQAGAFTENSNA-------YT 101

Query: 120 VPEIRSPHNGIYAIQTQDTRHKTQDTSML------PLYRKGDILILNSAIQVNCGDRLLI 173
             +  +               + +  SM       P + +G +++++   +V+ GD  + 
Sbjct: 102 RSDAIAWIPTAKKASDSAFWLEVEGHSMTAPQGGRPSFPEGMLILVDPEQEVSFGDFCIA 161

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223
           +    +   K LI   G +  L  LN  + +  +  +  + I +++  SQ
Sbjct: 162 RLMNDEFTFKRLIR-EGETEYLEPLNPRFEMIPINGN-CQIIGKVV-KSQ 208


>gi|261821438|ref|YP_003259544.1| phage repressor [Pectobacterium wasabiae WPP163]
 gi|261605451|gb|ACX87937.1| putative phage repressor [Pectobacterium wasabiae WPP163]
          Length = 244

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/244 (12%), Positives = 64/244 (26%), Gaps = 37/244 (15%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +  +     L+   L    G+   +  K +            T  I ++  A +  
Sbjct: 5   LAERLKTVRTSQGLSQKALGDMVGVSQAAIQKIEGGKAS------QTTKIVELSNALHIR 58

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              L +           +  +   +                        V   +      
Sbjct: 59  PEWLANGEGPMRSDRVVRSLQESSIPPTSEWGTVSAWDSTTELSKDEVEVPFLKDIEFAC 118

Query: 129 GIYAIQTQDT-------------------------RHKTQDTSMLPLYRKGDILILNSAI 163
           G   IQ++D                                 SM P+   G  + +++  
Sbjct: 119 GDGRIQSEDYNGFKLRFSKATLRKVGANTDGSGVLCFPAAGDSMEPIIPDGTTVAVDTNN 178

Query: 164 QVNCGDRLLIKPRTGDI-----VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +     +L    + G         K L  + G  + + S N     +  + S++E I R+
Sbjct: 179 KRIIDGKLYAIAQEGGGNDKLKRIKQLYRKPGGLLVIHSFNRD-TDEETDESEVEIIGRV 237

Query: 219 LWAS 222
            W S
Sbjct: 238 FWYS 241


>gi|153009375|ref|YP_001370590.1| LexA repressor [Ochrobactrum anthropi ATCC 49188]
 gi|166224638|sp|A6X0K7|LEXA_OCHA4 RecName: Full=LexA repressor
 gi|151561263|gb|ABS14761.1| SOS-response transcriptional repressor, LexA [Ochrobactrum anthropi
           ATCC 49188]
          Length = 239

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/234 (12%), Positives = 56/234 (23%), Gaps = 16/234 (6%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP--STESI 58
           M +    ++   I    +   + PS    K  LD  S +   R       R       + 
Sbjct: 1   MLTRKQHELLLFIHERLKETGIPPSFDEMKEALDLASKSGIHRLITALEERGFIRRLPNR 60

Query: 59  FKILAATNETICQLLDLPFSDGRTT------------EKKEKEIPLLYFPPSGSGGFFDS 106
            + L            L                                  SG+      
Sbjct: 61  ARALEVLRLPDSIAPGLNAQKKFAPSVIEGSLGKTPPPPARPAPVATNDDTSGTVSVPVM 120

Query: 107 GVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQV 165
           G    G   + +                 +    + +  SM+      GD +I+      
Sbjct: 121 GRIAAGVPISAIQNQTHSLSLPPEMIGAGEHYALEVRGDSMIDAGIFDGDTVIIKRGDSA 180

Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
           N G+ ++      +   K    +   SI L + N  Y         +    +++
Sbjct: 181 NPGEIVVALVDDEEATLKRFRRKGA-SIALEAANPAYETRIFGPDRVRVQGKLV 233


>gi|322714235|gb|EFZ05806.1| regulatory protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 231

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 71/229 (31%), Gaps = 20/229 (8%)

Query: 8   KIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNE 67
            I   + ++    N+  + LA   G+D  + ++ +     G+ +  + +++ ++      
Sbjct: 2   NIGNRVRQLRRAKNMKIAELAEAIGVDAANISRLE----TGKQKQFTEQTLSRLADCLGV 57

Query: 68  TICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT---------- 117
            I +L     S G T  K                          GN              
Sbjct: 58  DIAELFT-SDSKGNTVCKHSDMRKDSANVKDLFRIEILDVSASAGNGLIQGGDVIDVIHA 116

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRT 177
           +   + ++          +      +  SM P    GD++ ++ +I    GD + +    
Sbjct: 117 IEYNKDKALAMFGGRPAAELKVINVRGDSMAPTIEPGDLIFVDISINQFDGDGIYVFGFD 176

Query: 178 GDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMS---DIEWIARILWASQ 223
             I  K L       + ++S N  Y   ++            ++L  SQ
Sbjct: 177 DKIYVKRLQMIPD-KLLVISDNTNYREWSITKDNECRFGVFGKVL-ISQ 223


>gi|9635515|ref|NP_059606.1| C2 [Enterobacteria phage P22]
 gi|62362268|ref|YP_224193.1| gp55 [Enterobacteria phage ES18]
 gi|168240083|ref|ZP_02665015.1| P22 repressor protein c2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194451869|ref|YP_002044323.1| P22 repressor protein c2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|59800201|sp|P69202|RPC2_BPP22 RecName: Full=Repressor protein C2
 gi|15655|emb|CAA24470.1| unnamed protein product [Enterobacteria phage P22]
 gi|1143409|emb|CAA60873.1| c2 [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|8439602|gb|AAF75024.1| repressor protein [Enterobacteria phage P22]
 gi|28394307|tpg|DAA01021.1| TPA_inf: prophage repressor [Enterobacteria phage P22]
 gi|58339111|gb|AAW70526.1| gp55 [Enterobacteria phage ES18]
 gi|169658888|dbj|BAG12645.1| prophage repressor [Enterobacteria phage P22]
 gi|194410173|gb|ACF70392.1| P22 repressor protein c2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205340367|gb|EDZ27131.1| P22 repressor protein c2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 216

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 67/220 (30%), Gaps = 28/220 (12%)

Query: 10  WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
            E I    ++  +  + L +  G+   + ++ +R   E     P+ E++  +  A   + 
Sbjct: 7   GERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETE-----PNGENLLALSKALQCSP 61

Query: 70  C-----QLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIR 124
                  L     +     E +     + +          +         W         
Sbjct: 62  DYLLKGDLSQTNVAYHSRHEPRGSYPLISWVSAGQWMEAVEPYHKRAIENW--------- 112

Query: 125 SPHNGIYAIQTQDTRHKTQDTSMLP----LYRKGDILILNSAIQVNCGDRLL-IKPRTGD 179
             H+              Q  SM         +G I++++  ++   G  ++       +
Sbjct: 113 --HDTTVDCSEDSFWLDVQGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENE 170

Query: 180 IVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
              K L+   GR   L  LN  YP+  +  +  + I  ++
Sbjct: 171 ATFKKLVMDAGRKF-LKPLNPQYPMIEINGN-CKIIGVVV 208


>gi|209552478|ref|YP_002284393.1| putative repressor cI [Pseudomonas phage PAJU2]
 gi|209528751|dbj|BAG75043.1| putative repressor cI [Pseudomonas phage PAJU2]
          Length = 234

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 88/230 (38%), Gaps = 22/230 (9%)

Query: 1   MTSFSHKKIWEAIDRMAE-RHNL-TPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESI 58
           M + S K +   +  +   R +L     L++++G+  ++ ++  R   +      + ++I
Sbjct: 13  MMADSRKILANNLKYLMNCRDDLDNQGKLSKRSGVAQSTISRIVRGDSDTGV--DTLDAI 70

Query: 59  FKILAATNETICQLLDLPFSDGRTTEKKEKE-----IPLLYFPPSGSGGFFDSGVFPTGN 113
            ++    +  +     +    G+ T  K        +PL+ +  +G          P G+
Sbjct: 71  ARVFKVDSSDLVDAGLIDKLQGQNTNIKGTSGLTDPVPLISWVQAGMFTEAIDNFAP-GD 129

Query: 114 KWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLI 173
               +  P   S               +    SMLP YR G+I++++  +    G  +++
Sbjct: 130 AEELLPCPFPHSER---------SFALRVHGESMLPDYRDGEIILVDPDLAYKHGSDVVV 180

Query: 174 KPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVE-MSDIEWIARILWAS 222
           +   G    K +   +  +  LM+LN  +P   +E   D      ++ AS
Sbjct: 181 RTPDGSTTFKRIQITQDGTY-LMALNPSFPSRYIEIPEDTRICG-VVIAS 228


>gi|83593233|ref|YP_426985.1| LexA repressor [Rhodospirillum rubrum ATCC 11170]
 gi|123725964|sp|Q2RT47|LEXA_RHORT RecName: Full=LexA repressor
 gi|83576147|gb|ABC22698.1| SOS-response transcriptional repressor, LexA [Rhodospirillum rubrum
           ATCC 11170]
          Length = 251

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/246 (10%), Positives = 62/246 (25%), Gaps = 30/246 (12%)

Query: 3   SFSHKK--IWEAIDRMAERHNLTPS--GLARKAGLDPTS-FNKS-----KRFGIEGRNRW 52
             + K+  +   ID+  +   ++PS   +    GL   S  ++      +R  ++     
Sbjct: 1   MLTRKQYLLLSFIDQRLKLSGVSPSFDEMKDALGLKSKSGIHRLIKGLEERGFLKRLPHR 60

Query: 53  PSTESIFKI------------------LAATNETICQLLDLPFSDGRTTEKKEKEIPLLY 94
                + ++                         + +    P               +  
Sbjct: 61  ARALEVLRLPCNLTFDGDGEALDDGQPAPLFGGPLPETGFSPQVIRGNFTPTLPSTQVPQ 120

Query: 95  FPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRK 153
              + S      G    G     +  P              +    + +  SM       
Sbjct: 121 VLFTESISLPLLGKIAAGTPIAALIDPTSSIDVPASMVRGGEHFALRIEGDSMIEAGILS 180

Query: 154 GDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIE 213
           GD+ ++    +   G  ++      +   K L  +   SI L   N  +         + 
Sbjct: 181 GDLAVVRRCDEAENGTVIVALVDNEEATLKRLRRKGA-SIALEPANRAFKTQIYGPDRVR 239

Query: 214 WIARIL 219
              R++
Sbjct: 240 IQGRLV 245


>gi|223986049|ref|ZP_03636078.1| hypothetical protein HOLDEFILI_03384 [Holdemania filiformis DSM
           12042]
 gi|223961999|gb|EEF66482.1| hypothetical protein HOLDEFILI_03384 [Holdemania filiformis DSM
           12042]
          Length = 204

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/218 (14%), Positives = 71/218 (32%), Gaps = 33/218 (15%)

Query: 11  EAIDRMAERHNLTPSGLARKAGLDP-TSFNKSKRFGIEGRNRWPSTESIFKILAATNETI 69
           E +  + +++++T + LA K G    T+  K +          P    + ++    N TI
Sbjct: 5   ENLRYLRKKYHITQNDLAEKFGYKSFTTIQKWEDGTS-----MPKMSILQQLADFFNLTI 59

Query: 70  CQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVG--VPEIRSPH 127
            +L++                           G     +      ++ +   + E     
Sbjct: 60  ERLINQD------------------LTRDEMSGVRVPVLGSVKAGYDHLAEQIVEDYEWV 101

Query: 128 NGIYAIQTQDTRHKTQDTSMLPL-YRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLI 186
           +   A   +         SM      +GD + ++    V+ G   ++     ++  K + 
Sbjct: 102 SPDEARGGEYFYLDVVGDSMKNARIEEGDRVYIHRQNSVDNGQIAVVLLENDEVTLKRVF 161

Query: 187 SRRGRSIDLMSLNCCYPVDTVEMSD-----IEWIARIL 219
            + G  I L   N  Y    V + D     ++ + R++
Sbjct: 162 YKDGDMI-LQPENDAYEPIVVPLKDVMDRRVQILGRLV 198


>gi|71648700|sp|Q5FNN8|LEXA_GLUOX RecName: Full=LexA repressor
          Length = 238

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/241 (14%), Positives = 58/241 (24%), Gaps = 31/241 (12%)

Query: 1   MTSFSHKKIWEAIDRMAERHNLTPS--------GLARKAGLDPTSFNKSK---------- 42
           M +    ++   ID    R   +PS         L  K+G+     +  +          
Sbjct: 1   MLTRKQHQLLLYIDDHLRRTGYSPSFDEMKDALELRSKSGIHR-LISALEERGFLRRHHH 59

Query: 43  RFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTT---EKKEKEIPLLYFPPSG 99
           R       R P   +       T       +      G      E            P  
Sbjct: 60  RARALEVLRLPHMGTEAPAATGTGTAFVPAVLNQGQTGLEGAFSEASVANDRQTVSIPLY 119

Query: 100 SGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILI 158
                   +    +  + + VP              +         SM       GDI I
Sbjct: 120 GRIAAGLPIEAMQDDSDRIDVPVSLLGT-------GEHYALTVAGDSMIEAGILDGDIAI 172

Query: 159 LNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +        G  ++      ++  K L  R G  I L + N  Y         +    R+
Sbjct: 173 IRRRETAENGQIIVALIDEQEVTLKKLRRR-GSMIALEAANRDYETRIFPAERVHIQGRL 231

Query: 219 L 219
           +
Sbjct: 232 V 232


>gi|118463995|ref|YP_882791.1| LexA repressor [Mycobacterium avium 104]
 gi|254776054|ref|ZP_05217570.1| LexA repressor [Mycobacterium avium subsp. avium ATCC 25291]
 gi|171472974|sp|A0QIQ3|LEXA_MYCA1 RecName: Full=LexA repressor
 gi|118165282|gb|ABK66179.1| LexA repressor [Mycobacterium avium 104]
          Length = 232

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/223 (13%), Positives = 59/223 (26%), Gaps = 22/223 (9%)

Query: 2   TSFSHKK--IWEAIDRMAERHNLTPS--GLARKAGLDPTSFNKSKRFGIEGRNRWPSTES 57
            S + ++  I   I          PS   +    GL  TS    +   +E +        
Sbjct: 21  PSLTERQRTILNVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERK------GY 74

Query: 58  IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNT 117
           + +          + +D   +   T       +P   F P          +       + 
Sbjct: 75  LRRDPNRPRAVDVRGVDDDVAAPATEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDV 134

Query: 118 VGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKGDILILNSAIQVNCGDRLLIKPR 176
             +P                   K    SM       GD +++      + GD +     
Sbjct: 135 FPLPRELVG-------DGTLFLLKVVGDSMVEAAICDGDWVVVRQQHVADNGDIVAAMID 187

Query: 177 TGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL 219
            G+   K      G  + LM  N  +       +D   + +++
Sbjct: 188 -GEATVKTFKR-AGGQVWLMPHNPAFDPI--PGNDATVLGKVV 226


>gi|85708240|ref|ZP_01039306.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. NAP1]
 gi|85689774|gb|EAQ29777.1| prophage MuMc02, peptidase, family S24 [Erythrobacter sp. NAP1]
          Length = 211

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 67/217 (30%), Gaps = 15/217 (6%)

Query: 7   KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATN 66
           + + E +DR+  +     + ++R  G +P    +  +    G  R    E    +     
Sbjct: 2   EHVREELDRLILKGGYGYASISRLLGRNPAYVQQFIKR---GSPRKLDDEDRKTLACFFG 58

Query: 67  ETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSP 126
                                 +  +               V  +       G  E    
Sbjct: 59  VD--------EQVLGGPANPVTDGMVEIPVLDVEASAGFGAVAASETAHTRFGFDERWLR 110

Query: 127 HNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQ-VNCGDRLLIKPRTGDIVAKVL 185
           H    A     +    +  SM P    GD ++++++       D + +      +V K +
Sbjct: 111 HLTS-AKSASLSIVGVKGDSMEPTLSDGDEVLVDASDHGSRLRDGIYVLRSDDALVVKRI 169

Query: 186 ISRRGRS-IDLMSLNCCYPV-DTVEMSDIEWIARILW 220
             + G   I + S N  YP    ++ S++  + R++W
Sbjct: 170 AIKPGGRQITIASDNPAYPTWYDMDRSEVHVVGRVIW 206


>gi|50121363|ref|YP_050530.1| regulator of pectin lyase production [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611889|emb|CAG75338.1| regulator of pectin lyase production [Pectobacterium atrosepticum
           SCRI1043]
          Length = 244

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/244 (12%), Positives = 62/244 (25%), Gaps = 37/244 (15%)

Query: 9   IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNET 68
           + E +        L+   L    G+   +  K +            T  I ++  A +  
Sbjct: 5   LAERLKTARTAQGLSQKALGDMIGVSQAAIQKIEVGKAS------QTTKIVELSNALHIR 58

Query: 69  ICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128
              L +           +  +   +                        V   +      
Sbjct: 59  PEWLANGGGPMHSDRVVRSLQESSIPPTSKWGTVSAWDNTTKLSEDEVEVPFLKDIEFAC 118

Query: 129 GIYAIQTQDT-------------------------RHKTQDTSMLPLYRKGDILILNSAI 163
           G   IQ++D                                 SM P+   G  + +++  
Sbjct: 119 GDGRIQSEDYNGFKLRFSKATLRKVGANTDGSGVLCFPAAGDSMEPIIPDGTTVAVDTNN 178

Query: 164 QVNCGDRLLIKPRTGDI-----VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARI 218
           +     +L    + G         K L  + G  + + S N     +    S++E I R+
Sbjct: 179 KRIID