RPSBLAST alignment of GI: 254780444 and SCOP domain: d2b5aa1

Alignment
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77
 Score = 35.2 bits (81), Expect = 0.004
 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 5/69 (7%)

Query: 6  HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65
           +K    + ++  +  ++   LA  AGL  T  ++     +E  +R  S  +I KI AA 
Sbjct: 8  KRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISE-----VERGDRNISLINIHKICAAL 62

Query: 66 NETICQLLD 74
          +        
Sbjct: 63 DIPASTFFR 71

SCOP domain information

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: SinR domain-like
domain: Regulatory protein C.BclI
species: Bacillus caldolyticus [TaxId: 1394]