BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] (223 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Score = 463 bits (1192), Expect = e-133, Method: Compositional matrix adjust. Identities = 223/223 (100%), Positives = 223/223 (100%) Query: 1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK Sbjct: 1 MTSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFK 60 Query: 61 ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120 ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV Sbjct: 61 ILAATNETICQLLDLPFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGV 120 Query: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI Sbjct: 121 PEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDI 180 Query: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ Sbjct: 181 VAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARILWASQ 223 >gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 26.2 bits (56), Expect = 0.47, Method: Compositional matrix adjust. Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 8/75 (10%) Query: 102 GFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNS 161 G D+ + TG+ N G P + I+++Q D + T +R ++ LNS Sbjct: 153 GILDNPLVVTGSAGNDTGTEVTFLPSSDIFSVQ--DFNYDTLQ------HRLRELSFLNS 204 Query: 162 AIQVNCGDRLLIKPR 176 ++Q++ D+ +PR Sbjct: 205 SVQISLIDKRSPEPR 219 >gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 24.3 bits (51), Expect = 2.0, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 65 TNETICQLLDLPF 77 NE ICQL+ PF Sbjct: 117 ANEKICQLIHFPF 129 >gi|254780836|ref|YP_003065249.1| putative type I restriction-modification system DNA methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 674 Score = 23.9 bits (50), Expect = 2.7, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 17/38 (44%) Query: 90 IPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPH 127 I LY P G+GGF + + + +P I PH Sbjct: 206 IRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPH 243 >gi|254780498|ref|YP_003064911.1| putative glycerol-3-phosphate acyltransferase PlsX [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 23.9 bits (50), Expect = 2.7, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Query: 30 KAGLDPTSFNKSKRFGIEGR----NRWPSTESIFKILA 63 K G DP +FN G++G + +SIF +L Sbjct: 288 KEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLG 325 >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 23.5 bits (49), Expect = 3.2, Method: Compositional matrix adjust. Identities = 10/45 (22%), Positives = 19/45 (42%) Query: 9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP 53 +W+ I R +RH L + + N+ + I +N +P Sbjct: 65 LWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYP 109 >gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] Length = 142 Score = 23.1 bits (48), Expect = 3.6, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Query: 35 PTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLPFSD 79 P SF K GI+ ++ P ES I T E I ++ L D Sbjct: 75 PVSFFLKKEVGIKSGSKLPGKESCGSI---TRENIRKIAQLKMQD 116 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 145,942 Number of Sequences: 1233 Number of extensions: 5786 Number of successful extensions: 22 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 11 length of query: 223 length of database: 328,796 effective HSP length: 71 effective length of query: 152 effective length of database: 241,253 effective search space: 36670456 effective search space used: 36670456 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)