>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea, cellular organelles, and some bacteria lack GlnRS. In these cases, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The descriminating form of GluRS differs from GlnRS and the non-descriminating form of GluRS in their C-terminal anti-codon binding domains.

Probab=97.34 E-value=0.001 Score=43.80 Aligned_cols=85 Identities=18% Similarity=0.208 Sum_probs=55.1 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHH Q ss_conf 22558897621577856687899876708982678888244420899999998765599833489999999999999999 Q gi|254780445|r 62 PPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENEYLAKGKKKDDIPVNEFRQACRDSASAW 141 (963) Q Consensus 62 PPy~nG~lH~GH~~n~~~kDi~~Ry~rm~G~~Vl~~~GwD~hGLPiE~~vek~l~~~~~~~~~~~~~~~~~~c~~~a~~~ 141 (963) T Consensus 7 APsPtG~LHiG~ar~al~n~~~Ak~--~~G~~~LRieD-------------------------TD~~-------r~~~e~ 52 (223) T cd00418 7 APSPTGYLHIGHARAALLNYLYAKK--YGGKFILRFDD-------------------------TDPE-------REVEEA 52 (223) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHH--HCCEEEEEECC-------------------------CCCC-------CCHHHH T ss_conf 8898985428999999999999998--59989997236-------------------------8864-------018889 Q ss_pred HHHHHHHHHHCCEEEECCC-CEECCCHHHHHHHHHHHHHHHHCC Q ss_conf 9999999997060776369-811577679899999999999879 Q gi|254780445|r 142 VKIQSKEFQRLGIVGDFEN-PYTTMTRESEAQIASELLKIAESD 184 (963) Q Consensus 142 i~~~~~~~~rlG~~~Dw~~-~y~T~dp~y~~~~~~~F~~l~~kG 184 (963) T Consensus 53 ~~~I~~dL~wLGl--~~d~~~~~QS~--r~~~y~~~~~~Li~~G 92 (223) T cd00418 53 EDSILEDLKWLGI--KWDEGPYYQSD--RFDIYYEYAEKLIEEG 92 (223) T ss_pred HHHHHHHHHHHCC--CCCCCEEEHHH--HHHHHHHHHHHHHHCC T ss_conf 9999999999189--99986853875--8999999999997569

HHsearch alignment for GI: 254780445 and conserved domain: cd00418