>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.

Probab=98.77 E-value=1.1e-08 Score=78.36 Aligned_cols=103 Identities=22% Similarity=0.402 Sum_probs=69.6 Q ss_pred HCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--------CCHHHHHHHHHHHHCC Q ss_conf 05688884899628225588976215778566878998767089826788882444--------2089999999876559 Q gi|254780445|r 48 ESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCH--------GLPIEWKVENEYLAKG 119 (963) Q Consensus 48 ~~~~~~~~f~l~dgPPy~nG~lH~GH~~n~~~kDi~~Ry~rm~G~~Vl~~~GwD~h--------GLPiE~~vek~l~~~~ 119 (963) T Consensus 13 ~r~~~k~~~v~~tG-~~PSG~~HIGn~rEv~~~~~V~ral~~~g~~~~~i~~~DD~D~lRKVp~~lp-e~-~~~ylg~P- 88 (354) T cd00674 13 EERKGKEKYVVASG-ISPSGLIHIGNFREVVTADAVRRALRDLGFEVRLIYSWDDYDPLRKVPDNVP-ES-LEQYIGMP- 88 (354) T ss_pred HHCCCCCCEEEECC-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHCCCCCCCC-HH-HHHHCCCC- T ss_conf 86278985899478-7999886320550178899999999975996799998405551003755787-99-99862996- Q ss_pred CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEC Q ss_conf 983348999999999999999999999999970607763 Q gi|254780445|r 120 KKKDDIPVNEFRQACRDSASAWVKIQSKEFQRLGIVGDF 158 (963) Q Consensus 120 ~~~~~~~~~~~~~~c~~~a~~~i~~~~~~~~rlG~~~Dw 158 (963) T Consensus 89 --L~~IP-dP~-G~~~SyaeHf~~~f~~~L~~~gi~~e~ 123 (354) T cd00674 89 --LSSVP-DPF-GCHESYAEHFNAPFEESLDRFGIEVEF 123 (354) T ss_pred --CEECC-CCC-CCCCCHHHHHHHHHHHHHHHCCCEEEE T ss_conf --30068-977-775459999999999999984982899

HHsearch alignment for GI: 254780445 and conserved domain: cd00674