RPSBLAST alignment for GI: 254780445 and conserved domain: cd00814

>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function. Length = 319
 Score = 62.5 bits (153), Expect = 6e-10
 Identities = 23/52 (44%), Positives = 29/52 (55%)

Query: 63  PYANGHIHIGHALNKILKDVIVRSFQMRNFNACFVPGWDCHGLPIEWKVENE 114
           PY NG  H+GH    +L DV  R  ++R ++  FV G D HG  IE K E E
Sbjct: 9   PYVNGVPHLGHLYGTVLADVFARYQRLRGYDVLFVTGTDEHGTKIEQKAEEE 60