RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|144199 pfam00519, PPV_E1_C, Papillomavirus helicase. This protein is a DNA helicase that is required for initiation of viral DNA replication. This protein forms a complex with the E2 protein pfam00508. Length = 432 Score = 29.4 bits (67), Expect = 0.49 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Query: 48 VNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQV 83 V D ++K YL S R+ VFEF P + E+ V Sbjct: 362 VKADDRYK---YLHS-RITVFEFPNPFPFDENGNPV 393 >gnl|CDD|146172 pfam03393, Pneumo_matrix, Pneumovirus matrix protein. Length = 252 Score = 29.5 bits (66), Expect = 0.55 Identities = 11/16 (68%), Positives = 13/16 (81%) Query: 140 AIPNAKIAPYQGIILL 155 AI NAKI PY G+IL+ Sbjct: 188 AITNAKIIPYAGLILV 203 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 28.6 bits (64), Expect = 0.88 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 11/55 (20%) Query: 118 GIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNN--WIRC 170 G GK STL+R + IP AP +G +LLD + I ++ + +R Sbjct: 36 GCGK------STLLRLLNRLNDLIPG---APDEGEVLLDGKDIYDLDVDVLELRR 81 >gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 269 Score = 28.2 bits (63), Expect = 1.1 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 8/41 (19%) Query: 123 SNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEI 163 S S STL+RC+ N I P G +L+D + I + Sbjct: 59 SGSGKSTLLRCI--------NRLIEPTSGKVLIDGQDIAAM 91 >gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213 Score = 28.2 bits (63), Expect = 1.3 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Query: 123 SNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRC 170 S S STL+RC+ L E P G I++D K+ + + N Sbjct: 35 SGSGKSTLLRCINLLE--------EPDSGTIIIDGLKLTDDKKNINEL 74 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 27.9 bits (62), Expect = 1.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Query: 148 PYQGIILLDDRKINEIQNNWIR 169 P G +L+D I + W+R Sbjct: 405 PTSGEVLIDGEDIRNLNLKWLR 426 >gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 214 Score = 27.9 bits (62), Expect = 1.6 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Query: 113 PYPFLGIGKNSNSVASTLIRCM-GLKELAIPNAKIAPYQGIILLDDRKINEIQNN 166 GI S + STL+RC+ GL++ P G I+L+ + + + Sbjct: 22 NEEVTGIFGASGAGKSTLLRCIAGLEK---------PDGGTIVLNGTVLFDSRKK 67 >gnl|CDD|37454 KOG2243, KOG2243, KOG2243, Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]. Length = 5019 Score = 27.0 bits (59), Expect = 3.1 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 6/70 (8%) Query: 25 FAHRLLVVFDSNKEFVAELDGLVVNKDGKFKP----IGYLPSDRLKVFE--FKYPCLYKE 78 F +++ D EF+AE D + G+ P I + L + + FK CLY Sbjct: 2942 FLKKIIKYVDEAHEFIAEFDAIGSRGKGEHFPRDQEIKFFAKVLLPLIDQYFKNHCLYFL 3001 Query: 79 DQEQVVLCSS 88 LCS Sbjct: 3002 SAALKPLCSG 3011 >gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 233 Score = 26.7 bits (59), Expect = 3.4 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Query: 117 LGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 GI S + STLIRC+ E P G +L+D + + +R Sbjct: 34 FGIIGRSGAGKSTLIRCINGLE--------RPTSGSVLVDGTDLTLLSGKELR 78 >gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339 Score = 26.4 bits (58), Expect = 4.7 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Query: 117 LGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 GI S + STL+R + L E P G + +D + + + +R Sbjct: 35 FGIIGYSGAGKSTLLRLINLLE--------RPTSGSVFVDGQDLTALSEAELR 79 >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain. Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-I topology. Length = 128 Score = 26.2 bits (58), Expect = 5.5 Identities = 7/31 (22%), Positives = 14/31 (45%) Query: 129 TLIRCMGLKELAIPNAKIAPYQGIILLDDRK 159 +I C L + + PY + LL +++ Sbjct: 21 NIIECRDLPAMDEQSGTSDPYVKLQLLPEKE 51 >gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.. Length = 238 Score = 25.9 bits (57), Expect = 5.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 148 PYQGIILLDDRKINEIQNNWIR 169 P G ILLD I ++ W+R Sbjct: 55 PTSGEILLDGVDIRDLNLRWLR 76 >gnl|CDD|36542 KOG1328, KOG1328, KOG1328, Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport, Signal transduction mechanisms]. Length = 1103 Score = 25.8 bits (56), Expect = 6.9 Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Query: 122 NSNSVA--STLIRCMGLKELAIPNAKIAPYQ 150 N NS +L++C+G + K P++ Sbjct: 441 NRNSGERLESLLKCLGALRESPFYQKYCPFK 471 >gnl|CDD|37338 KOG2127, KOG2127, KOG2127, Calmodulin-binding protein CRAG, contains DENN domain [Signal transduction mechanisms]. Length = 1020 Score = 25.3 bits (55), Expect = 8.6 Identities = 15/88 (17%), Positives = 29/88 (32%), Gaps = 1/88 (1%) Query: 31 VVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFK-YPCLYKEDQEQVVLCSSS 89 V+ D + ++V DG ++ LP V + E + + S Sbjct: 770 VMLDQSLQWVGLSDGKMIPSIPGPVTSLVLPYLSPLVLRKELESLDENEGDTVLSVSSFP 829 Query: 90 EECVMSRWNAAVHTKEILNEKNMPYPFL 117 + WN + + + N+P L Sbjct: 830 NHHPIIFWNLVWYFRRLDLRSNLPGLVL 857 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0683 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,014,689 Number of extensions: 98372 Number of successful extensions: 198 Number of sequences better than 10.0: 1 Number of HSP's gapped: 198 Number of HSP's successfully gapped: 20 Length of query: 171 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,383,754 Effective search space: 368235336 Effective search space used: 368235336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.7 bits)