RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|177488 PHA02774, PHA02774, E1; Provisional. Length = 613 Score = 30.2 bits (69), Expect = 0.26 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Query: 48 VNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQV 83 V + ++K YL S R+ VFEF P E+ V Sbjct: 534 VKAEDRYK---YLHS-RITVFEFPNPFPLDENGNPV 565 >gnl|CDD|179266 PRK01261, aroD, 3-dehydroquinate dehydratase; Provisional. Length = 229 Score = 29.5 bits (66), Expect = 0.43 Identities = 18/64 (28%), Positives = 35/64 (54%) Query: 1 MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYL 60 M+S ++ S N +L + ++ ++ NK+FV +L +++ KD K+KPI ++ Sbjct: 123 MVSYHTNNSDNMPAILDIMNEKNPDYVKVACNYNDNKKFVDDLQYILMKKDEKYKPIVFI 182 Query: 61 PSDR 64 P R Sbjct: 183 PMGR 186 >gnl|CDD|163417 TIGR03705, poly_P_kin, polyphosphate kinase 1. Members of this protein family are the enzyme polyphosphate kinase 1 (PPK1). This family is found in many prokaryotes and also in Dictyostelium. Sequences in the seed alignment were taken from prokaryotic consecutive two-gene pairs in which the other gene encodes an exopolyphosphatase. It synthesizes polyphosphate from the terminal phosphate of ATP but not GTP, in contrast to PPK2. Length = 672 Score = 26.7 bits (60), Expect = 3.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 150 QGIILLDDRKINEIQNNWIRCY 171 +GI +L+ ++ E Q W+R Y Sbjct: 101 EGIRVLNRDELTEAQREWLRKY 122 >gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters. Length = 247 Score = 26.5 bits (59), Expect = 3.5 Identities = 17/69 (24%), Positives = 28/69 (40%), Gaps = 12/69 (17%) Query: 104 KEILNEKNMPYP------FLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDD 157 KE L N+ P +G S STL+R + +P +I G +L D Sbjct: 14 KEALKNINLDIPKNQVTALIG---PSGCGKSTLLRSLNRMNDLVPGVRIE---GKVLFDG 67 Query: 158 RKINEIQNN 166 + I + + + Sbjct: 68 QDIYDKKID 76 >gnl|CDD|172753 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional. Length = 274 Score = 25.4 bits (55), Expect = 7.4 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Query: 128 STLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 STL+RC IP AK+ +G +L DR I + Q N ++ Sbjct: 60 STLLRCFNRMNDLIPGAKV---EGRLLYRDRNIYDSQINSVK 98 >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional. Length = 251 Score = 25.3 bits (55), Expect = 8.2 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 16/67 (23%) Query: 104 KEILNEKNMPYPFLGIGKN--------SNSVASTLIRCMGLKELAIPNAKIAPYQGIILL 155 K+ LN+ N+P I +N S ST +RC+ I N KI +G +LL Sbjct: 17 KQALNDINLP-----IYENKITALIGPSGCGKSTFLRCLNRMNDLISNVKI---EGEVLL 68 Query: 156 DDRKINE 162 D + I + Sbjct: 69 DGKNIYD 75 >gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional. Length = 342 Score = 25.1 bits (55), Expect = 8.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 40 VAELDGLVVNKDGKFKPIG 58 VA++DG + KPIG Sbjct: 273 VAQVDGSAFFAGPQLKPIG 291 >gnl|CDD|152831 pfam12396, DUF3659, Protein of unknown function (DUF3659). This domain family is found in bacteria and eukaryotes, and is approximately 70 amino acids in length. Length = 64 Score = 25.1 bits (56), Expect = 9.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 40 VAELDGLVVNKDGK 53 ++ L+GL VNKDG Sbjct: 1 LSGLEGLTVNKDGN 14 >gnl|CDD|178055 PLN02436, PLN02436, cellulose synthase A. Length = 1094 Score = 25.2 bits (55), Expect = 9.5 Identities = 10/19 (52%), Positives = 16/19 (84%) Query: 137 KELAIPNAKIAPYQGIILL 155 ++L IP++KI PY+ II+L Sbjct: 275 RKLPIPSSKINPYRMIIIL 293 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0821 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,666,628 Number of extensions: 154974 Number of successful extensions: 228 Number of sequences better than 10.0: 1 Number of HSP's gapped: 228 Number of HSP's successfully gapped: 11 Length of query: 171 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,114,577 Effective search space: 345624468 Effective search space used: 345624468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.4 bits)