BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 355 bits (911), Expect = e-100, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%) Query: 1 MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYL 60 MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYL Sbjct: 1 MISAESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYL 60 Query: 61 PSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIG 120 PSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIG Sbjct: 61 PSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIG 120 Query: 121 KNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY 171 KNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY Sbjct: 121 KNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRCY 171 >gi|254780970|ref|YP_003065383.1| phosphoribosylformylglycinamidine synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 737 Score = 26.9 bits (58), Expect = 0.18, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 12/48 (25%) Query: 73 PCLYKEDQEQVVLCSSSE--ECVMSRWNAAVHTKEILNEKNMPYPFLG 118 P L+ EDQ + V+C S E + VMS N KN+P +LG Sbjct: 663 PFLFGEDQGRYVVCISPENQDLVMSE----------ANNKNIPLRYLG 700 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Query: 21 IGLFFAHRLLVVFD-----SNKEFVAELDGLVVNKDGK 53 +G H LL + D NK ++G+VV KDG+ Sbjct: 779 MGEVLKHALLRMPDPLESEGNKSIPLSVEGIVVGKDGR 816 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.408 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,062 Number of Sequences: 1233 Number of extensions: 4169 Number of successful extensions: 11 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 6 length of query: 171 length of database: 328,796 effective HSP length: 68 effective length of query: 103 effective length of database: 244,952 effective search space: 25230056 effective search space used: 25230056 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)