BLAST/PSIBLAST alignment of GI: 254780449 and GI: 219682480 at iteration 1
>gi|219682480|ref|YP_002468864.1| hypothetical protein BUAPTUC7_578 [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] Length = 367
>gi|219622213|gb|ACL30369.1| hypothetical protein BUAPTUC7_578 [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] Length = 367
 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 2/144 (1%)

Query: 316 CGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIF 375
              ++DN F+ D N   F+ N   ++ +N  + + K       N +  QLIS+YANQ   
Sbjct: 226 SSNDLDNDFMNDTNPFLFVVNDGLISVNNRNKML-KDFKTIVPNVEFRQLISTYANQKFL 284

Query: 376 ADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKE 435
             S + L+   PE  +Y  K  S + +    L +G V   A   + +   +    +  K 
Sbjct: 285 RQSYLQLISEHPEIDQYQIK-HSRNIYKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKS 343

Query: 436 YGLKISGILSPDKATELQRSFYLK 459
           +G++ + IL P+ +  ++ S+++K
Sbjct: 344 FGIRATIILPPNASPIMKYSYFMK 367