BLAST/PSIBLAST alignment of GI: 254780449 and GI: 315122104 at iteration 1
>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335
>gi|313495506|gb|ADR52105.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335
 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 9/148 (6%)

Query: 309 FRDFQGLCGKNIDNQFILDLNRAS-FIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLIS 367
           F DF+ L   N   + + D ++AS FI NGKK+  D   + ++ L   F  + +++QLIS
Sbjct: 181 FYDFK-LLSPNKAYKGLRDASKASEFIVNGKKINIDTPEKMLENLKEIFPNDFEKVQLIS 239

Query: 368 SYANQSIFADSVVHLMQSIPEFAKYAS-KSGSASKFTAKTLTNGEVAFTAKYTTKVQAVD 426
            YA++ IF     H + SI     Y   K+ ++ KF A  L +G + F+A Y      VD
Sbjct: 240 CYAHEGIFDAPFTHKLFSINNPKNYTGVKTYNSYKFDA--LEDGTINFSATYKGNFSPVD 297

Query: 427 KIAGKPLKE-YGLKISGILSPDKATELQ 453
              G P    YG+K+ GILS     EL 
Sbjct: 298 ---GSPSTHGYGVKVDGILSKQSIPELH 322