BLAST/PSIBLAST alignment of GI: 254780449 and GI: 315122104 at iteration 1
>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335
>gi|313495506|gb|ADR52105.1| hypothetical protein CKC_01770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 335
 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 61  ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV 120
           IST ++ +A    ++ IPIYGT + FK+   GWGI+G  +D   LI  +GYG + A  L+
Sbjct: 41  IST-LESIAKKSLIAAIPIYGTIQAFKEKESGWGILGITTDVLTLIG-IGYGIKGAAALI 98

Query: 121 R 121
           R
Sbjct: 99  R 99