BLAST/PSIBLAST alignment of GI: 254780449 and GI: 320538773 at iteration 1
>gi|320538773|ref|ZP_08038451.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson] Length = 210
>gi|320031162|gb|EFW13163.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson] Length = 210
 Score = 60.1 bits (144), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 17/166 (10%)

Query: 301 VPLSD--QTLFRDFQGL-CGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFA 357
           VP+ D    L  DF  +     +  QF+LD +RA++  +GK + R +          QF 
Sbjct: 53  VPVLDTISILQDDFHKIKVTTQLSEQFLLDFDRATYKVDGKVIPRGDYI--------QFE 104

Query: 358 K---NPKQLQLISSYANQSIFADSVVHLMQSIPE-FAKYASKSGSASKFTAKTLTNGEVA 413
           K   + K+ QLISSYANQ   AD  +  M   P+ FAK+ + + + S +    + + ++ 
Sbjct: 105 KAIPDIKKRQLISSYANQMSLADPSIGAMSFFPDSFAKHGAHNSNVS-YEIWNIPDSKIK 163

Query: 414 FTAKYTTKVQAVDKIAG-KPLKEYGLKISGILSPDKATELQRSFYL 458
             AK  +K+  VD   G K    YGLK    LS +   +   S+YL
Sbjct: 164 LIAKVESKLTPVDLADGEKIYSSYGLKAEMTLSENTPPKYNYSYYL 209