BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780449|ref|YP_003064862.1| hypothetical protein
CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62]
         (459 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780449|ref|YP_003064862.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040126|gb|ACT56922.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 459

 Score =  681 bits (1757), Expect = 0.0,   Method: Composition-based stats.
 Identities = 459/459 (100%), Positives = 459/459 (100%)

Query: 1   MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVID 60
           MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVID
Sbjct: 1   MNISEINKYFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYHQVRELTQNKASTEQVID 60

Query: 61  ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV 120
           ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV
Sbjct: 61  ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV 120

Query: 121 RGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESI 180
           RGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESI
Sbjct: 121 RGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESI 180

Query: 181 GTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKAL 240
           GTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKAL
Sbjct: 181 GTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKAL 240

Query: 241 TKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKM 300
           TKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKM
Sbjct: 241 TKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKM 300

Query: 301 VPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNP 360
           VPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNP
Sbjct: 301 VPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNP 360

Query: 361 KQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTT 420
           KQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTT
Sbjct: 361 KQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTT 420

Query: 421 KVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           KVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK
Sbjct: 421 KVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459


>gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040125|gb|ACT56921.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 311

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 118/384 (30%), Positives = 179/384 (46%), Gaps = 75/384 (19%)

Query: 76  MIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTM 135
           MIP+YGT +EFKKGNYGWG +G +SD ALL     Y  +    LVRG SIA K  T G  
Sbjct: 1   MIPVYGTIQEFKKGNYGWGALGIVSDVALLAIPAAYLGKVLFGLVRGSSIATKIATTGIA 60

Query: 136 IAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKS 195
              +EA  + + T++ A    L KEGI +   +EG S  IKSES+G K  IS++  ++  
Sbjct: 61  TVVQEATVMTKTTQEGA---LLAKEGIEATHIMEGGSTAIKSESVGAKELISASQNSQ-- 115

Query: 196 AISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGK 255
                    + T+ G  ++                      TKA                
Sbjct: 116 ---------TVTQTGNISDA---------------------TKA---------------- 129

Query: 256 IFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGL 315
             S+TIK+   I++    ++AI +K+P              E+  +       FRDF+ L
Sbjct: 130 --SSTIKDAQSIDR----SQAIFQKMPL------------EEYPRLQKIGINYFRDFK-L 170

Query: 316 CGKNIDNQFILDLNRAS-FIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSI 374
            G N   + +LD +RA+ FI +GKK+  D++   + +L   F K+ +++QLISSYA++ I
Sbjct: 171 LGTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISSYAHEHI 230

Query: 375 FADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLK 434
           F       + ++     Y   S     +   TL +  ++F AK    V  ++   G   +
Sbjct: 231 FCKPFTKDLLNLANKNIYQ-LSNPRYSYQFNTLKDKTISFVAKEEGLVTYLN---GSLHR 286

Query: 435 EYGLKISGILSPDKATELQRSFYL 458
            YG+K  GILS +   EL  S Y+
Sbjct: 287 NYGIKAEGILSRNAPPELHFSSYV 310


>gi|315122103|ref|YP_004062592.1| hypothetical protein CKC_01765 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495505|gb|ADR52104.1| hypothetical protein CKC_01765 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 464

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 163/419 (38%), Positives = 235/419 (56%), Gaps = 32/419 (7%)

Query: 62  STKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVR 121
           S+K+ + A +  +S+IPIYGT + FKKG  GWGI GAI+D   L+PVVGYGA+    L R
Sbjct: 53  SSKIGETAKEALLSLIPIYGTIQSFKKGEIGWGIFGAITDVLTLVPVVGYGAKMVGALAR 112

Query: 122 GGSIALKAGTAGTMIAAKEACTIAQATEKTAKLT---ALTKEGITSIRTIEGSSVTIKSE 178
           GG+ A+K   AG + A+  A T A AT   A L     +TK  +         S T+K+ 
Sbjct: 113 GGNAAIKISKAGAIAASATASTYAAATRGGAALADGALITKYAMEGESAFNAGSATVKAT 172

Query: 179 S-------IGTKASISSTNTAEKSAISQKITTNSTTEIGKTTE-------VVEESISKI- 223
           S       + TKA+ S+ +T +K+AI   I+ N+      T E       VVE+S  K  
Sbjct: 173 SSTLYESNVITKAAESTHSTLDKAAI-LPISKNTIKTSVNTAEMDKIAAKVVEQSTKKTT 231

Query: 224 --NSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFI-EKLAHTTKAIDKK 280
             N +  K   +  +  +L   DP LE +YQ GK     I+ +  I EK+  T+ ++ K 
Sbjct: 232 LSNKKTIKQASKKFFIASLRAVDPGLELLYQGGK---AAIRKSRSIPEKIMKTSHSLPK- 287

Query: 281 IPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKL 340
                N W++I++  SE+KMV LSD++LFR+F+ L    +D QF+LDLNRA +I NGK +
Sbjct: 288 -----NTWKNIDSIPSEYKMVSLSDESLFRNFKQLNKNELDQQFLLDLNRAEYIINGKNM 342

Query: 341 ARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSAS 400
              N    +  L   FA +P++LQ+IS+YA+Q IFAD + +LM++IP    Y SK+G  +
Sbjct: 343 RDTNQKSQLAYLQKTFANDPQKLQIISAYAHQGIFADGISYLMETIPNMLSYGSKNG-KT 401

Query: 401 KFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
            F   TL    V  +AKYT  +   ++    PL+EYGLKI  IL P+KA +  + FY K
Sbjct: 402 TFQINTLGEEGVRLSAKYTASLVTENQAIKNPLREYGLKIDTILFPNKAPQFTQYFYTK 460


>gi|257471634|ref|ZP_05635633.1| hypothetical protein BaphL_02905 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|311087470|gb|ADP67550.1| hypothetical protein CWS_03010 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087954|gb|ADP68033.1| hypothetical protein CWU_03765 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 205

 Score =  186 bits (471), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLA 341
           FI      ++   + F  +  + +   + ++ L   N +DN F+ D N   F+ N   ++
Sbjct: 30  FIDESTWTVSDQLNSFNNIQSTIKHFQKKYEFLKSSNDLDNDFMNDTNPFLFVVNNGLIS 89

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
            +N  + ++        N +  QLIS+YANQ     S + L+   PE  +Y  K  S + 
Sbjct: 90  VNNRNKMLKDF-KTIVPNVEFRQLISTYANQKFLRQSYLQLISEHPEIDQYQIKH-SRNI 147

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           +    L +G V   A   + +   +    +  K +G++ + IL P+ +  ++ S+++K
Sbjct: 148 YKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKSFGIRATIILPPNASPIMKYSYFMK 205


>gi|311086306|gb|ADP66388.1| hypothetical protein CWO_03065 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086880|gb|ADP66961.1| hypothetical protein CWQ_03105 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
          Length = 205

 Score =  185 bits (468), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLA 341
           FI      ++   + F  +  + +   + ++ L   N +DN F+ D N   F+ N   ++
Sbjct: 30  FIDESTWTVSDQLNSFNNIQSTIKHFQKKYEFLKSSNDLDNDFMNDTNPFLFVVNDGLIS 89

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
            +N  + ++        N +  QLIS+YANQ     S + L+   PE  +Y  K  S + 
Sbjct: 90  VNNRNKMLKDF-KTIVPNVEFRQLISTYANQKFLRQSYLQLISEHPEIDQYQIKH-SRNI 147

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           +    L +G V   A   + +   +    +  K +G++ + IL P+ +  ++ S+++K
Sbjct: 148 YKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKSFGIRATIILPPNASPIMKYSYFMK 205


>gi|219681925|ref|YP_002468311.1| hypothetical protein BUAP5A_577 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219624768|gb|ACL30923.1| hypothetical protein BUAP5A_577 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 367

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLA 341
           FI      ++   + F  +  + +   + ++ L   N +DN F+ D N   F+ N   ++
Sbjct: 192 FIDESTWTVSDQLNSFNNIQSTIKHFQKKYEFLKSSNDLDNDFMNDTNPFLFVVNNGLIS 251

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
            +N  + ++        N +  QLIS+YANQ     S + L+   PE  +Y  K  S + 
Sbjct: 252 VNNRNKMLKDF-KTIVPNVEFRQLISTYANQKFLRQSYLQLISEHPEIDQYQIKH-SRNI 309

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           +    L +G V   A   + +   +    +  K +G++ + IL P+ +  ++ S+++K
Sbjct: 310 YKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKSFGIRATIILPPNASPIMKYSYFMK 367


>gi|219682480|ref|YP_002468864.1| hypothetical protein BUAPTUC7_578 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219622213|gb|ACL30369.1| hypothetical protein BUAPTUC7_578 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
          Length = 367

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLA 341
           FI      ++   + F  +  + +   + ++ L   N +DN F+ D N   F+ N   ++
Sbjct: 192 FIDESTWTVSDQLNSFNNIQSTIKHFQKKYEFLKSSNDLDNDFMNDTNPFLFVVNDGLIS 251

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
            +N  + ++        N +  QLIS+YANQ     S + L+   PE  +Y  K  S + 
Sbjct: 252 VNNRNKMLKDF-KTIVPNVEFRQLISTYANQKFLRQSYLQLISEHPEIDQYQIKH-SRNI 309

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           +    L +G V   A   + +   +    +  K +G++ + IL P+ +  ++ S+++K
Sbjct: 310 YKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKSFGIRATIILPPNASPIMKYSYFMK 367


>gi|15617174|ref|NP_240387.1| hypothetical protein BU584 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11387313|sp|P57644|Y584_BUCAI RecName: Full=Uncharacterized protein BU584; AltName: Full=yba3
 gi|25373122|pir||A84998 hypothetical protein [imported] - Buchnera sp. (strain APS)
 gi|10039239|dbj|BAB13273.1| hypothetical protein [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
          Length = 367

 Score =  183 bits (463), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 81/178 (45%), Gaps = 3/178 (1%)

Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLA 341
           FI      ++   + F  +  + +   + ++ L   N +DN F+ D N   F+ N   ++
Sbjct: 192 FIDESTWTVSDQLNSFNNIQSTIKHFQKKYEFLKSSNDLDNDFMNDTNPFLFVVNNALIS 251

Query: 342 RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASK 401
            +N  + ++        N +  QLIS+YANQ     S + L+   PE  +Y  K  S + 
Sbjct: 252 VNNRNKMLKDF-KTIVPNVEFRQLISTYANQKFLRQSYLQLISEHPEIDQYQIKH-SRNI 309

Query: 402 FTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
           +    L +G V   A   + +   +    +  K +G++ + IL P+ +  ++ S+++K
Sbjct: 310 YKINFLDDGSVKLVATNLSDLDVKNDNYIQKYKSFGIRATIILPPNASPIMKYSYFMK 367


>gi|27905000|ref|NP_778126.1| hypothetical protein bbp529 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|34098501|sp|Q89A26|Y529_BUCBP RecName: Full=Uncharacterized protein bbp_529; AltName: Full=yba3
 gi|27904398|gb|AAO27231.1| hypothetical protein bbp_529 [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 398

 Score =  143 bits (361), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 82/175 (46%), Gaps = 6/175 (3%)

Query: 288 WRDINTAHSEFKMVPLSDQTLFRDFQGLCGKN-IDNQFILDLNRASFIFNGKKLARDNSA 346
           W+ +N    + + V  + +  F  F  L   + +D+ FI +   +    NG+++++ +  
Sbjct: 227 WKSLNKIIGDNQQVS-TGKKFFNRFMSLRNTSRLDDSFIFEGEHSILQINGQQVSKYSPK 285

Query: 347 EAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAKT 406
             +         +    QLISS+++Q IF+   + L    P+  K+  K  S   +    
Sbjct: 286 TMLDDF-KTAIPDLASRQLISSFSHQGIFSQPYIELFSEHPDLVKFKPK-DSQFSYVVHE 343

Query: 407 LTNGEVAFTAKYTTKVQAVDKIAG-KPLKEYGLKISGILSPDKATE-LQRSFYLK 459
           + +G   FTA     +++  + +  K    +G+++S  LS DK+ E ++ S+YL+
Sbjct: 344 VEDGVFQFTATSQADLESSYETSDHKKYNAFGVQVSMTLSKDKSPEDVEYSYYLR 398


>gi|315122104|ref|YP_004062593.1| hypothetical protein CKC_01770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495506|gb|ADR52105.1| hypothetical protein CKC_01770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 335

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/195 (28%), Positives = 86/195 (44%), Gaps = 17/195 (8%)

Query: 263 NNAFIEKLAH-TTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNID 321
           N   I+ LA  ++K+I   IP +           SE   +       F DF+ L   N  
Sbjct: 145 NTIHIDSLAQNSSKSIGTIIPVV-----------SENPRLKKIATNYFYDFK-LLSPNKA 192

Query: 322 NQFILDLNRAS-FIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVV 380
            + + D ++AS FI NGKK+  D   + ++ L   F  + +++QLIS YA++ IF     
Sbjct: 193 YKGLRDASKASEFIVNGKKINIDTPEKMLENLKEIFPNDFEKVQLISCYAHEGIFDAPFT 252

Query: 381 HLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKI 440
           H + SI     Y     + + +    L +G + F+A Y      VD         YG+K+
Sbjct: 253 HKLFSINNPKNYTGVK-TYNSYKFDALEDGTINFSATYKGNFSPVDGSPST--HGYGVKV 309

Query: 441 SGILSPDKATELQRS 455
            GILS     EL  +
Sbjct: 310 DGILSKQSIPELHFT 324



 Score = 50.3 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 61  ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV 120
           IST ++ +A    ++ IPIYGT + FK+   GWGI+G  +D  L +  +GYG + A  L+
Sbjct: 41  IST-LESIAKKSLIAAIPIYGTIQAFKEKESGWGILGITTDV-LTLIGIGYGIKGAAALI 98

Query: 121 R 121
           R
Sbjct: 99  R 99


>gi|320538773|ref|ZP_08038451.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson]
 gi|320031162|gb|EFW13163.1| hypothetical protein SSYM_0353 [Serratia symbiotica str. Tucson]
          Length = 210

 Score = 92.6 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 318 KNIDNQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFAD 377
             +  QF+LD +RA++  +GK + R +  +  + +      + K+ QLISSYANQ   AD
Sbjct: 73  TQLSEQFLLDFDRATYKVDGKVIPRGDYIQFEKAI-----PDIKKRQLISSYANQMSLAD 127

Query: 378 SVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKP-LKEY 436
             +  M   P+         S   +    + + ++   AK  +K+  VD   G+     Y
Sbjct: 128 PSIGAMSFFPDSFAKHGAHNSNVSYEIWNIPDSKIKLIAKVESKLTPVDLADGEKIYSSY 187

Query: 437 GLKISGILSPDKATELQRSFYL 458
           GLK    LS +   +   S+YL
Sbjct: 188 GLKAEMTLSENTPPKYNYSYYL 209


>gi|58384653|gb|AAW72673.1| hypothetical protein [Buchnera aphidicola (Cinara cedri)]
          Length = 303

 Score = 70.3 bits (170), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 50/294 (17%), Positives = 102/294 (34%), Gaps = 12/294 (4%)

Query: 175 IKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQG 234
           + SE I    SIS  +      +   I  N+  E          S ++ N   S    + 
Sbjct: 13  LNSEIIKKADSISVLHNKNLKNVDVAIINNANQEFIAHIIPYNTSYNQENMISSNINNEV 72

Query: 235 IWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKA------IDKKIPFIGN-- 286
            +     + D   E        F +   NN   E  +  T+       I K  P      
Sbjct: 73  NYDYPCVEDDQEEELSEFDTIPFEDEYSNNEINELKSFNTECCDDLNNISKNFPINNPDV 132

Query: 287 QWRDINTAHSEFKMVPLSDQTLFRDFQGLCGK-NIDNQFILDLNRASFIFNGKKLARDNS 345
           +W  + + +   K +  S Q L   F  L     ++ +F+  L+  +   NGKK+  D +
Sbjct: 133 RWNILRSVNFSPKTIARSKQ-LQETFHELLDSGKLEQKFLDHLHGKTVYLNGKKVLSDQA 191

Query: 346 AEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAK 405
            + +           +  QLIS+Y +  +   +  +L +  P      +       +   
Sbjct: 192 PDIMNAFRES-VPEFQTQQLISTYVHPEVLDVAWENLFKRHPG-VINRTVDNEHYTYEID 249

Query: 406 TLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
            ++           T +Q         +  +G++ + I++ +   E++ SF+++
Sbjct: 250 EISPEMYKVAITKITDLQPSYSGDINEIHTHGMRAAMIITANFNPEMRYSFFVQ 303


>gi|116515293|ref|YP_802922.1| Yba3 [Buchnera aphidicola str. Cc (Cinara cedri)]
 gi|116257147|gb|ABJ90829.1| hypothetical protein BCc_379 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 303

 Score = 68.0 bits (164), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 50/294 (17%), Positives = 102/294 (34%), Gaps = 12/294 (4%)

Query: 175 IKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQG 234
           + SE I    SIS  +      +   I  N+  E          S ++ N   S    + 
Sbjct: 13  LNSEIIKKADSISVLHNKNLKNVDVAIINNANQEFIAHIIPYNTSYNQENMISSNINNEV 72

Query: 235 IWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKA------IDKKIPFIGN-- 286
            +     + D   E        F +   NN   E  +  T+       I K  P      
Sbjct: 73  NYDYPCVEDDQEEELSEFDTIPFEDEYSNNEINELKSFNTECCDDLNNISKNFPINNPDV 132

Query: 287 QWRDINTAHSEFKMVPLSDQTLFRDFQGLCGK-NIDNQFILDLNRASFIFNGKKLARDNS 345
           +W  + + +   K +  S Q L   F  L     ++ +F+  L+  +   NGKK+  D +
Sbjct: 133 RWNILRSVNFSPKTIARSKQ-LQETFHELLDSGKLEQKFLDHLHGKTVYLNGKKVLSDQA 191

Query: 346 AEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSIPEFAKYASKSGSASKFTAK 405
            + +           +  QLIS+Y +  +   +  +L +  P      +       +   
Sbjct: 192 PDIMNAFRES-VPEFQTQQLISTYVHPEVLDVAWENLSKRHPG-VINRTVDNEHYTYEID 249

Query: 406 TLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSPDKATELQRSFYLK 459
            ++           T +Q         +  +G++ + I++ +   E++ SF+++
Sbjct: 250 EISPEMYKVAITKITDLQPSYSGDINEIHTHGMRAAMIITANFNPEMRYSFFVQ 303


>gi|297579269|ref|ZP_06941197.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297536863|gb|EFH75696.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 1590

 Score = 47.6 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 48  LTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIP 107
           LTQ+       +  +    D A  V   ++P++ T  +F+KG+YG   +G ISD    +P
Sbjct: 913 LTQHLIDNRDQLKTTVTAGDYAKGVMQMIVPVWATVEDFQKGDYGMASLGLISDIGFFLP 972

Query: 108 VVGYGARAAI 117
           +     +AA 
Sbjct: 973 I----GKAAF 978


>gi|163800536|ref|ZP_02194437.1| inner membrane protein, putative [Vibrio sp. AND4]
 gi|159175979|gb|EDP60773.1| inner membrane protein, putative [Vibrio sp. AND4]
          Length = 1581

 Score = 46.4 bits (108), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 67  DVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAIN 118
           D A  V   ++P++ T  +F+KGNY  G +G +SD    +P+     +AA N
Sbjct: 915 DYAKGVMQMIVPVWATVEDFQKGNYYMGSLGLLSDVGFFLPI----GKAAFN 962


>gi|73983496|ref|XP_540777.2| PREDICTED: similar to Mucin-5B precursor (Mucin 5 subtype B,
            tracheobronchial) (High molecular weight salivary mucin
            MG1) (Sublingual gland mucin) [Canis familiaris]
          Length = 4944

 Score = 45.6 bits (106), Expect = 0.018,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 61/143 (42%), Gaps = 8/143 (5%)

Query: 144  IAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITT 203
            +  +T +T   +A+T +G+T+  T  G S    S+ +      S+T     SA++ +  T
Sbjct: 2191 VTASTIQTGPSSAVTSQGVTTSTTQTGPSSPATSQRLTA----STTQIGPSSAVTSQGVT 2246

Query: 204  NSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKN 263
             STT+ G ++    + ++   +Q   S+P       ++       S     ++  +T + 
Sbjct: 2247 TSTTQTGPSSPGTSQGVTASTTQTGPSSPATSHRLTVSTTQIGPSSPGTSQRVSESTTQT 2306

Query: 264  ----NAFIEKLAHTTKAIDKKIP 282
                    E+++  + +   ++P
Sbjct: 2307 LPTPARTTERVSSLSPSASPRLP 2329



 Score = 44.5 bits (103), Expect = 0.034,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 64/168 (38%), Gaps = 10/168 (5%)

Query: 117  INLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIK 176
                 G +++       +    K+      +T +T   +  T +G+T+  T         
Sbjct: 2552 FGTTEGITVSTTQTGPSSPGTTKKVTV---STIQTVPSSPETTQGVTASTT----QTAAS 2604

Query: 177  SESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIW 236
            S  I  +  +S+T T+  S  + +  T STT+ G ++    E ++   +Q   S+P    
Sbjct: 2605 STGITKRVLVSTTQTSPSSLRTSQGVTTSTTQTGPSSSGTTEKVTVSTTQTVPSSPGTTQ 2664

Query: 237  --TKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIP 282
              T + T   P+   I +R  I S T    +        T +  + +P
Sbjct: 2665 EVTVSTTHTGPSSPQITKRVLI-STTETGPSSPGTSQRITASTTQTVP 2711



 Score = 40.6 bits (93), Expect = 0.59,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 66/167 (39%), Gaps = 11/167 (6%)

Query: 122  GGSIALKAGTAGTMIAAKEAC--TIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSES 179
            G S  +   T  T  ++ +     +   T+ T   +  T + +T+  T  G S    +E 
Sbjct: 3622 GTSQGITVSTTQTGPSSPQITKRVLISTTQ-TVPSSPGTSQRLTASTTQTGPSSPGTTE- 3679

Query: 180  IGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKA 239
               KA++S+  T   S  + +  T STT+ G ++ V  + I+   +Q   S+PQ      
Sbjct: 3680 ---KATVSTIQTGPSSPGTSQRLTASTTQTGPSSPVTSQGITVSTTQTGPSSPQITKRVL 3736

Query: 240  LTKADPALESIYQRGKIFSNTIKNNAF----IEKLAHTTKAIDKKIP 282
            ++       S      +  +TI+         ++L  +T  I    P
Sbjct: 3737 ISTTQIVPSSPGTSQGVTVSTIQTGPSSPGTSQRLTASTTQIGPSSP 3783



 Score = 40.2 bits (92), Expect = 0.67,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 47/144 (32%), Gaps = 10/144 (6%)

Query: 123  GSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGT 182
             +I     + GT      + T    +         T +G+T+     G S    S  I  
Sbjct: 3360 STIQTGPSSTGTSQGVTVSTTQTGPSSPG------TSQGVTTSTIQTGPS----SPQITK 3409

Query: 183  KASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTK 242
            +  IS+T T   S  +    T  T + G ++    +  +   +Q   S+P       ++ 
Sbjct: 3410 RVLISTTQTGPSSPGTTHGVTEPTIQTGPSSPGTSKRFTTSTTQTGPSSPGTTKKATVST 3469

Query: 243  ADPALESIYQRGKIFSNTIKNNAF 266
                  S      +  +TI+    
Sbjct: 3470 IQTGPSSPGTSQGVTVSTIQTGPS 3493



 Score = 38.3 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 48/140 (34%)

Query: 127  LKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASI 186
             K  T  T+     +  I +    +   T  +  G T   T+        S  I  +  +
Sbjct: 3192 TKKVTVSTIQTVPSSPGITEKVTASTTQTGPSSPGTTHEVTVSTIQTGPSSSGITKRVLV 3251

Query: 187  SSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPA 246
            S+  T+  S  + +  T STT+ G ++    + +    +Q   S+PQ      ++     
Sbjct: 3252 STIETSPSSPGTSQKITASTTQTGPSSPGTSQRVPASTTQTGPSSPQITKRVLISTTQTG 3311

Query: 247  LESIYQRGKIFSNTIKNNAF 266
              S      +   TI+    
Sbjct: 3312 PSSPGTTHGVTEPTIQTGPS 3331



 Score = 37.9 bits (86), Expect = 3.1,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 54/134 (40%), Gaps = 18/134 (13%)

Query: 117  INLVRGGSIALKAGTAGTMIAAKEACTIAQ----ATEKTAKLTALTKEGITSIRTIEGSS 172
            I  V       +  TA T   A  +  I +    +T +T+  +  T +G+T+  T  G S
Sbjct: 2581 IQTVPSSPETTQGVTASTTQTAASSTGITKRVLVSTTQTSPSSLRTSQGVTTSTTQTGPS 2640

Query: 173  VTIKSESI------------GTKA--SISSTNTAEKSAISQKITTNSTTEIGKTTEVVEE 218
             +  +E +            GT    ++S+T+T   S    K    STTE G ++    +
Sbjct: 2641 SSGTTEKVTVSTTQTVPSSPGTTQEVTVSTTHTGPSSPQITKRVLISTTETGPSSPGTSQ 2700

Query: 219  SISKINSQLSKSTP 232
             I+   +Q   S P
Sbjct: 2701 RITASTTQTVPSPP 2714


>gi|320538774|ref|ZP_08038452.1| hypothetical protein SSYM_0354 [Serratia symbiotica str. Tucson]
 gi|320031163|gb|EFW13164.1| hypothetical protein SSYM_0354 [Serratia symbiotica str. Tucson]
          Length = 113

 Score = 45.2 bits (105), Expect = 0.023,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 5/50 (10%)

Query: 43  HQVRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYG 92
           H  +EL   K  T+QV        +++ +VA+SMIPIYGT REF+KGN G
Sbjct: 69  HITQELAMEKKVTDQV-----SAGEISKEVALSMIPIYGTIREFQKGNIG 113


>gi|261211805|ref|ZP_05926092.1| hypothetical protein VCJ_002068 [Vibrio sp. RC341]
 gi|260839155|gb|EEX65787.1| hypothetical protein VCJ_002068 [Vibrio sp. RC341]
          Length = 1480

 Score = 45.2 bits (105), Expect = 0.023,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 59  IDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAI 117
           +  +T   D A  V   ++P++GT  +F++G++G   +G ISD    +P+     +AA 
Sbjct: 813 LKTTTTAWDYAKGVMQMIVPVWGTVEDFQRGDHGMASLGLISDVGFFLPI----GKAAF 867


>gi|58615294|gb|AAW80256.1| adenylate cyclase-like protein [Vibrio cholerae]
          Length = 1046

 Score = 45.2 bits (105), Expect = 0.024,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 59  IDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAI 117
           +  +T   D A  V   ++P++GT  +F++G++G   +G ISD    +P+     +AA 
Sbjct: 380 LKTTTTAWDYAKGVMQMIVPVWGTVEDFQRGDHGMASLGLISDVGFFLPI----GKAAF 434


>gi|229523778|ref|ZP_04413183.1| hypothetical protein VCA_001355 [Vibrio cholerae bv. albensis
           VL426]
 gi|229337359|gb|EEO02376.1| hypothetical protein VCA_001355 [Vibrio cholerae bv. albensis
           VL426]
          Length = 1486

 Score = 44.9 bits (104), Expect = 0.030,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 48  LTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIP 107
           LTQ+       +  +T   D A  V  +++P++ T  +F+ GN+G   +G  SD    +P
Sbjct: 810 LTQHLIDKRDQLKTTTTAWDYAKGVMQAIVPVWATVEDFQNGNHGMATLGLFSDVGFFLP 869

Query: 108 VVGYGARAAIN 118
           +     +AA++
Sbjct: 870 I----GKAALS 876


>gi|284008185|emb|CBA74448.1| conserved pentapeptide repeat protein [Arsenophonus nasoniae]
          Length = 1253

 Score = 44.1 bits (102), Expect = 0.047,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 96/250 (38%), Gaps = 26/250 (10%)

Query: 76  MIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTM 135
           +IP Y T  E +KGN G  +  A+ D +   P   + A+AA    R      +A   G  
Sbjct: 617 LIPFYTTITEVRKGNTGQAVGAALFDVSGFFP---FLAKAAHISNRFSIAVGEAAVNGLQ 673

Query: 136 IAAKEACTIAQATEKTAKLTALTKEGI-------TSIRTIEGSSVTIKSESIGTKASISS 188
            A K+A T+ QA  + AK   L K GI        +    E  +  ++S   G +    +
Sbjct: 674 TALKQA-TLRQALHQGAKQ--LLKSGIPHVTNSLPANLFAELGTAFLRSADPGFELL--A 728

Query: 189 TNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALE 248
           +   +     +K+   S  ++   T++VE    K N      + +    K  T   PA  
Sbjct: 729 SGGLKGIHALKKVAKQSQQQLSGLTQLVEALEKKANDFPVAHSERF---KIETAYHPAQL 785

Query: 249 SIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTL 308
                 KI   + K+  +++    T +      PF     RD     +    VP+ ++  
Sbjct: 786 KEVPVTKIGRQSGKD-IYVQVYPETGQ------PFGRKYLRDTAGNLALAP-VPIGERLY 837

Query: 309 FRDFQGLCGK 318
               QGL GK
Sbjct: 838 QLKIQGLGGK 847


>gi|323451186|gb|EGB07064.1| hypothetical protein AURANDRAFT_71891 [Aureococcus anophagefferens]
          Length = 4154

 Score = 42.9 bits (99), Expect = 0.096,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 80/233 (34%), Gaps = 30/233 (12%)

Query: 72   VAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIP----VVGYGARAAINLVRGGSIAL 127
            +A +M  I G   E       WG+  A   A L+      +V Y  R+  N   G  +  
Sbjct: 3002 LAAAMAEIAGDIAE------RWGVADASKCADLVAKTVEDMVAYARRSRANASAGSIVVS 3055

Query: 128  KAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASIS 187
            + G A     A E     +     A LT    EGI          V++  E++  K  + 
Sbjct: 3056 RLGEA----VASEINAFTKDQRSGADLTDADIEGI----------VSLVDEALAAK--MV 3099

Query: 188  STNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPAL 247
                 ++SA  Q I   S    G  ++ +   I  + +    S  Q I T    +     
Sbjct: 3100 HREVHQESAAQQVIKYIS----GDISDNMSTQIRNLVASELASMAQQIGTSIARQLGADA 3155

Query: 248  ESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKM 300
            ++    GKI S+ +K+N    K       +D+    I  Q R       +   
Sbjct: 3156 QTTANVGKIISSHVKDNGRKGKGGVGVVIVDQLRTIIDTQRRATELMLQQRPQ 3208


>gi|147673479|ref|YP_001216303.1| putative inner membrane protein [Vibrio cholerae O395]
 gi|13377513|gb|AAK20749.1|AF325733_5 unknown [Vibrio cholerae]
 gi|146315362|gb|ABQ19901.1| putative inner membrane protein [Vibrio cholerae O395]
          Length = 962

 Score = 41.8 bits (96), Expect = 0.22,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66  KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
           +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 395 RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 438


>gi|13377544|gb|AAK20779.1|AF325734_5 putative inner membrane protein [Vibrio cholerae]
 gi|3004928|gb|AAC12276.1| putative inner membrane protein [Vibrio cholerae]
          Length = 1111

 Score = 41.8 bits (96), Expect = 0.22,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66  KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
           +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 544 RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 587


>gi|15640839|ref|NP_230470.1| inner membrane protein, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|9655272|gb|AAF93985.1| inner membrane protein, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
          Length = 1112

 Score = 41.8 bits (96), Expect = 0.22,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66  KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
           +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 545 RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 588


>gi|254225070|ref|ZP_04918684.1| hypothetical protein VCV51_0554 [Vibrio cholerae V51]
 gi|125622457|gb|EAZ50777.1| hypothetical protein VCV51_0554 [Vibrio cholerae V51]
          Length = 1328

 Score = 41.8 bits (96), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66   KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
            +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 963  RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 1006


>gi|121585705|ref|ZP_01675500.1| hypothetical protein VC274080_0898 [Vibrio cholerae 2740-80]
 gi|153818047|ref|ZP_01970714.1| hypothetical protein A5C_0837 [Vibrio cholerae NCTC 8457]
 gi|153822035|ref|ZP_01974702.1| hypothetical protein A5E_0912 [Vibrio cholerae B33]
 gi|227080999|ref|YP_002809550.1| hypothetical protein VCM66_0779 [Vibrio cholerae M66-2]
 gi|229505566|ref|ZP_04395076.1| hypothetical protein VCF_000777 [Vibrio cholerae BX 330286]
 gi|229510762|ref|ZP_04400241.1| hypothetical protein VCE_002169 [Vibrio cholerae B33]
 gi|229517883|ref|ZP_04407327.1| hypothetical protein VCC_001907 [Vibrio cholerae RC9]
 gi|229608586|ref|YP_002879234.1| hypothetical protein VCD_003506 [Vibrio cholerae MJ-1236]
 gi|254847958|ref|ZP_05237308.1| inner membrane protein [Vibrio cholerae MO10]
 gi|255744622|ref|ZP_05418573.1| beta/gamma crystallin domain-containing protein [Vibrio cholera CIRS
            101]
 gi|262161246|ref|ZP_06030357.1| beta/gamma crystallin domain-containing protein [Vibrio cholerae
            INDRE 91/1]
 gi|298499049|ref|ZP_07008856.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121550068|gb|EAX60084.1| hypothetical protein VC274080_0898 [Vibrio cholerae 2740-80]
 gi|126511393|gb|EAZ73987.1| hypothetical protein A5C_0837 [Vibrio cholerae NCTC 8457]
 gi|126520429|gb|EAZ77652.1| hypothetical protein A5E_0912 [Vibrio cholerae B33]
 gi|227008887|gb|ACP05099.1| hypothetical protein VCM66_0779 [Vibrio cholerae M66-2]
 gi|229344598|gb|EEO09572.1| hypothetical protein VCC_001907 [Vibrio cholerae RC9]
 gi|229350727|gb|EEO15668.1| hypothetical protein VCE_002169 [Vibrio cholerae B33]
 gi|229357789|gb|EEO22706.1| hypothetical protein VCF_000777 [Vibrio cholerae BX 330286]
 gi|229371241|gb|ACQ61664.1| hypothetical protein VCD_003506 [Vibrio cholerae MJ-1236]
 gi|254843663|gb|EET22077.1| inner membrane protein [Vibrio cholerae MO10]
 gi|255737653|gb|EET93047.1| beta/gamma crystallin domain-containing protein [Vibrio cholera CIRS
            101]
 gi|262028996|gb|EEY47649.1| beta/gamma crystallin domain-containing protein [Vibrio cholerae
            INDRE 91/1]
 gi|297543382|gb|EFH79432.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 1533

 Score = 41.8 bits (96), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66   KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
            +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 966  RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 1009


>gi|121725976|ref|ZP_01679275.1| hypothetical protein VCV52_0783 [Vibrio cholerae V52]
 gi|121631458|gb|EAX63828.1| hypothetical protein VCV52_0783 [Vibrio cholerae V52]
          Length = 1533

 Score = 41.8 bits (96), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66   KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
            +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 966  RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 1009


>gi|153820579|ref|ZP_01973246.1| inner membrane protein, putative [Vibrio cholerae NCTC 8457]
 gi|126508877|gb|EAZ71471.1| inner membrane protein, putative [Vibrio cholerae NCTC 8457]
          Length = 300

 Score = 41.8 bits (96), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 26/44 (59%)

Query: 66  KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVV 109
           +D+A  V ++++P++GT  + K G+ G   +G + D    +P+ 
Sbjct: 192 RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFLPIA 235


>gi|119501226|ref|XP_001267370.1| hypothetical protein NFIA_109670 [Neosartorya fischeri NRRL 181]
 gi|119415535|gb|EAW25473.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 447

 Score = 41.0 bits (94), Expect = 0.41,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 54/146 (36%), Gaps = 2/146 (1%)

Query: 126 ALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKAS 185
           A  A +    I+      I++A    A   A   EGI+S    EGS+ +  + S+  ++ 
Sbjct: 111 ATSAKSTALTISTNGDTAISEAAYSKAGTMATAGEGISSQGGGEGSTFSSPAPSV--RSL 168

Query: 186 ISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADP 245
            ++  T + +A S       TT  G        S +    Q S+  P    T       P
Sbjct: 169 TTTLTTVQSAAPSTHFYNVQTTHQGLAHANSTHSTANQQVQFSQPFPSSPATAVPPHLVP 228

Query: 246 ALESIYQRGKIFSNTIKNNAFIEKLA 271
              S        +N + +NA I  LA
Sbjct: 229 HGHSHTYSTATANNILTDNASILTLA 254


>gi|254413108|ref|ZP_05026880.1| Pentapeptide repeat protein [Microcoleus chthonoplastes PCC 7420]
 gi|196180272|gb|EDX75264.1| Pentapeptide repeat protein [Microcoleus chthonoplastes PCC 7420]
          Length = 885

 Score = 41.0 bits (94), Expect = 0.43,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 68/196 (34%), Gaps = 27/196 (13%)

Query: 256 IFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGL 315
           IF + I +  F+ K    T  I K  P    QW+ +           +S   +FR  Q L
Sbjct: 154 IFQDNIISWTFLIKRIQQTSPIIKGTPLNNQQWKLLQAV--------ISGTPVFRKKQHL 205

Query: 316 CG-KNIDNQFILDL---NRASFI--FNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSY 369
            G KN   + I       R S +          D + E I          P++++ I+  
Sbjct: 206 KGHKNAIQKTINGTPQQTRGSILAQVRQHLSEFDLAQEQIA---KSIPPGPQRIRGIAGS 262

Query: 370 ANQSIFADSVVHLMQSIPEFAKYASKSGSASKFT---------AKTLTNGEVAFTAKYTT 420
               +      H+    P++   A    S S +           +  ++GE+ + AK   
Sbjct: 263 GKTVLLCQKAAHIHLKHPDWNI-ALVFFSRSLYHTIISQLDKWLRRFSSGEIRYDAKGHR 321

Query: 421 KVQAVDKIAGKPLKEY 436
           K++ +    G+    +
Sbjct: 322 KLKVLHAWGGRKQPGF 337


>gi|320591421|gb|EFX03860.1| histone deacetylase rpd3 [Grosmannia clavigera kw1407]
          Length = 746

 Score = 40.6 bits (93), Expect = 0.47,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 68/172 (39%), Gaps = 19/172 (11%)

Query: 123 GSIALKAGTAG---TMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSV------ 173
            S A KA   G      A +EA   ++ +        + KE +  +  +E          
Sbjct: 563 ASTAEKAAEDGDVEMTDAVEEAPATSETS--AVATEVIEKEAVVPVEAVEAGETSKTTTS 620

Query: 174 ----TIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSK 229
                 +SE+     + + T+TA   A   +IT     E  +T++  E   +K  +   K
Sbjct: 621 DLTAAPESEATSKADAKAVTDTATSGAAETEITP--VAETSETSDTSETKETKEKAAEEK 678

Query: 230 STPQGIWTKALTKADPALESIYQRGKIFSNTIKNN-AFIEKLAHTTKAIDKK 280
           +T   I  KA+ +     ++  ++    S  +K   A +EK A   KA+++K
Sbjct: 679 TTEVTIP-KAVEQEKTVEDTTSKKEDAESTAVKEGEASVEKKADEEKAVEEK 729


>gi|213692066|ref|YP_002322652.1| hypothetical protein Blon_1184 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213523527|gb|ACJ52274.1| hypothetical protein Blon_1184 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320458178|dbj|BAJ68799.1| hypothetical protein BLIJ_1211 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 803

 Score = 40.6 bits (93), Expect = 0.54,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 72/192 (37%), Gaps = 21/192 (10%)

Query: 120 VRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITS----IRTIEGSSVTI 175
           + GGS + +   + T  A     T+A  TE T  LT     G  S    IR ++G+ +T+
Sbjct: 230 ITGGSTSNRIEVSTTAAAPDIRNTLAGVTETTRVLT--ASHGGESFRIPIRIVQGTEITL 287

Query: 176 KSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGI 235
           K    GT+    S N +E           + T+ G   +     ++        ST    
Sbjct: 288 KD---GTR-FTGSKNGSEW----------TVTDTGHRLDRDNMPVTDKVELSDGSTLPVA 333

Query: 236 WTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAH 295
           W KA      A   ++      + T+ N   +      ++A + K+  IG + R  +   
Sbjct: 334 WGKATLDPSGAAGPVWTMSGTATRTLDNGQTLTVNLTASRAWNAKLS-IGVEHRTADGNT 392

Query: 296 SEFKMVPLSDQT 307
           +    V L D T
Sbjct: 393 TPIPGVDLEDAT 404


>gi|194741494|ref|XP_001953224.1| GF17662 [Drosophila ananassae]
 gi|190626283|gb|EDV41807.1| GF17662 [Drosophila ananassae]
          Length = 596

 Score = 40.2 bits (92), Expect = 0.71,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 95/285 (33%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRAK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVP-LSDQ 306
            Q   +  NT K   F+       + + +K+P    + N  +       E   +     Q
Sbjct: 109 LQNILVNDNTHKIRNFLINHKDM-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLGQ 167

Query: 307 --TLFRD--FQGLCGKNID---NQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
               ++D   Q    +N     N+FILD    S IF  K    +   +AI+ + N + K 
Sbjct: 168 LKKHYKDQLLQRAMLENRIKYQNEFILDEELKSRIFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M+    F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMEDQSNFIKHILYLGMPAIAKFKELNDEFRNME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLKI-SGILSPDKATELQRSFYLK 459
            K    +QA  ++     K  G  + +     +         Y++
Sbjct: 282 EKSRKNLQAKLQMLASLKKPGGTSVINFNKPKEAPPTTNLKRYVR 326


>gi|322691248|ref|YP_004220818.1| hypothetical protein BLLJ_1059 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320456104|dbj|BAJ66726.1| hypothetical protein BLLJ_1059 [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 803

 Score = 40.2 bits (92), Expect = 0.74,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 70/192 (36%), Gaps = 21/192 (10%)

Query: 120 VRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITS----IRTIEGSSVTI 175
           + GGS + +   + T  A     T+A  TE    LT     G  S    IR ++G+ +T+
Sbjct: 230 ITGGSTSNRIEVSTTASAPDVRNTLAGVTETDQVLT--ASHGGESFRIPIRIVQGTEITL 287

Query: 176 KSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGI 235
           K    GT+    S N +E           + T+ G   +      +        ST    
Sbjct: 288 KD---GTR-FTGSENGSEW----------TVTDTGHRLDKDNMPDTDKVELSDGSTLPVA 333

Query: 236 WTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAH 295
           W KA      A   ++      + T+ N   +      ++A D K+  IG + R  +   
Sbjct: 334 WGKATLDPSGAAGPVWTMSGKATRTLDNGQTLTVNLTASRAWDAKLS-IGVEHRTADGNT 392

Query: 296 SEFKMVPLSDQT 307
           +    V L D T
Sbjct: 393 TLIPGVDLEDAT 404


>gi|215398894|gb|ACJ65696.1| WAP1-like protein 1 [Candida parapsilosis]
          Length = 1172

 Score = 40.2 bits (92), Expect = 0.77,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 67/186 (36%), Gaps = 3/186 (1%)

Query: 129 AGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISS 188
           A     +  A  A  I+   E TA+ +++ +  I      E ++V   +E    + S + 
Sbjct: 132 ASVTSMLEFAATAAPISSTVEPTAEESSVEETTIVEPSVEETTTVEPSAEESTAEESTAE 191

Query: 189 TNTAEKSAISQKITTNSTTEIGKTTE-VVEESISKINSQLSKSTPQGIWTKALTKADPAL 247
            +TAE+S   +     ST E     E   EES ++  +    +T +    ++  +   A 
Sbjct: 192 ESTAEESTAEESTAEESTAEESSVVEPTAEESTAEEPTAEEPTTEESTAEESTAEESTAE 251

Query: 248 ESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGN-QWRDINTAHSEFKMVPLS-D 305
           ES         +TI      E  A  +       P +        +  ++ +  VP +  
Sbjct: 252 ESTIVEPTAEESTIVEPTAEESTAEESTTSTSSDPLVTTAPTTSSDNPYATYPSVPKTAS 311

Query: 306 QTLFRD 311
              F D
Sbjct: 312 INGFAD 317


>gi|154334339|ref|XP_001563421.1| poly(A) polymerase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134060437|emb|CAM37605.1| putative polynucleotide adenylyltransferase [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 709

 Score = 39.9 bits (91), Expect = 0.82,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 71/181 (39%), Gaps = 11/181 (6%)

Query: 59  IDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAIN 118
           + + TKV    +D+A ++   +   RE ++   G   +  I+   +         + A  
Sbjct: 506 MTVDTKVSSAKIDLAPAIRTFHAVVRELRQYREGVTRLPVITVVDMTRIPT--FVKEAAG 563

Query: 119 LVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSE 178
            V    +A +A  +  +   + +     A+ +TAK     ++G +   T+  +++T   +
Sbjct: 564 YVEETEVAQEAQASSEVEEVRNSSNNTAASARTAK-----RDGTSLAATLSSTTITTAGD 618

Query: 179 SIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTK 238
           S GT AS++  + +E    +     + + E G  + +      +   Q        +  K
Sbjct: 619 STGTTASVTDRSVSE----AGHSLYDGSAESGAASTIDGHVCKRAREQDGTDGRATVAAK 674

Query: 239 A 239
           A
Sbjct: 675 A 675


>gi|258620006|ref|ZP_05715046.1| hypothetical protein VMD_00920 [Vibrio mimicus VM573]
 gi|258587739|gb|EEW12448.1| hypothetical protein VMD_00920 [Vibrio mimicus VM573]
          Length = 213

 Score = 39.9 bits (91), Expect = 0.83,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 66  KDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIP 107
           +D+A  V ++++P++GT  + K G+ G   +G + D     P
Sbjct: 172 RDIAYQVLMAILPVWGTVEDIKSGDAGMATLGVLGDVMFFYP 213


>gi|6164595|gb|AAF04457.1|AF078161_1 lacunin [Manduca sexta]
          Length = 3198

 Score = 39.5 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 132  AGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNT 191
            + T     E  ++   +E+T K +   +  + +  T E + +T  + SI TK +  S +T
Sbjct: 1325 SSTEAITSEKTSVISTSEETGKTSVSEEVTVKTTVTDEATEIT-STVSIETKETSVSGST 1383

Query: 192  AEKSAISQKITTNSTTEIGKTTEVV--EESISKINSQLSKSTPQGIWTKALTKADPALES 249
             E S  +     + TTE G T+     EES      +   ++     TK++   +  L +
Sbjct: 1384 EELSTQASSKIESPTTESGITSHTTESEESTVSTTEKGEVTSETTELTKSIVSTETMLST 1443

Query: 250  IYQRGKIFSNT 260
              +   + S T
Sbjct: 1444 TEKEETVMSTT 1454


>gi|115631695|ref|XP_781675.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115935242|ref|XP_001181523.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 660

 Score = 39.5 bits (90), Expect = 1.2,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 63/162 (38%), Gaps = 9/162 (5%)

Query: 128 KAGTAGTMIAAKEACTI----AQATEKTAKLTALTKEGITSIR----TIEGSSVTIKSES 179
           +A TA T+    EA  I    A+AT+K    +  T++  T+      T E  +  + S  
Sbjct: 275 EANTAPTVATVPEATRIVTTEAKATQKGTTESKSTRQPTTAAETRLVTTETDTTRMVSTG 334

Query: 180 IGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKA 239
            GT    ++     +   ++  TT   T+ G TTE          ++    T +   T+ 
Sbjct: 335 AGTTQMATTKPVTTRLVTTETDTTQMVTQKG-TTESKSTRKPTTAAETRLVTTETDTTRL 393

Query: 240 LTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKI 281
           +T      + + Q+G   S + +     E    TT+    ++
Sbjct: 394 VTTETDTTQMVTQKGTTESKSTRKPTTAETRLVTTETDTTRM 435


>gi|25143518|ref|NP_490886.2| hypothetical protein Y71G12B.11 [Caenorhabditis elegans]
 gi|16604230|gb|AAK73909.2|AC025726_2 Hypothetical protein Y71G12B.11a [Caenorhabditis elegans]
 gi|954750|gb|AAA74747.1| talin [Caenorhabditis elegans]
          Length = 2553

 Score = 39.1 bits (89), Expect = 1.5,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 69/185 (37%), Gaps = 3/185 (1%)

Query: 147  ATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNST 206
            A E+  ++T  T +       ++      K  +     +IS+ N+A+    S+    N  
Sbjct: 923  AAERLGQVTNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKDVIESRSYKENLV 982

Query: 207  TEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAF 266
             E  +T   +   I+ I          G   KA ++       + +       T +    
Sbjct: 983  YESTQTAGHLPNLITSIRESQKVDNTPGEKFKAQSRLIRDSYKVLETSVRLFETARTAVP 1042

Query: 267  IEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFIL 326
            +   +H   ++D+    +G    D+ T+ ++ + +  S Q L+ +      K +D+Q + 
Sbjct: 1043 MVSDSHLASSLDQSANRLGTSLADLRTSVNDAQQLNFSQQLLYSE---ELIKELDDQLVN 1099

Query: 327  DLNRA 331
               RA
Sbjct: 1100 TQKRA 1104


>gi|168700520|ref|ZP_02732797.1| methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
           [Gemmata obscuriglobus UQM 2246]
          Length = 618

 Score = 39.1 bits (89), Expect = 1.5,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 91/227 (40%), Gaps = 17/227 (7%)

Query: 45  VRELTQNKASTEQVIDISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAAL 104
           V  +++  AS++++ DI T + ++A     +++ +       + G  G G     ++   
Sbjct: 391 VGAMSEINASSKKIADIITTIDEIAFQT--NLLALNAAVEAARAGEQGRGFAVVATEVRN 448

Query: 105 LIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITS 164
           L       A+    L++     +K   AGT +  +   T+A+      ++T +  E  ++
Sbjct: 449 LAQRSATAAKEIKALIQDS---VKKVDAGTELVNRSGTTLAEIVTSVKRVTDIVTEMASA 505

Query: 165 IRTIEGSSVTIKSESIGTKASIS---STNTAEKSAISQKITTNSTT--------EIGKTT 213
            R        + ++++    +++   ++ T E SA +Q +T ++           +G   
Sbjct: 506 SREQSTGIEQV-NKAVAQMDTVTQRNASQTEEMSATAQTLTDHAAQLRDLVGRFNLGPGG 564

Query: 214 EVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNT 260
                  +K   + +   P+   TKA+     +  + + RG    ++
Sbjct: 565 HAPAAKAAKPAKRGAAPKPRAAVTKAINHRRSSNGNGHARGHELDSS 611


>gi|261326520|emb|CBH09481.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 1076

 Score = 39.1 bits (89), Expect = 1.6,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 59/148 (39%), Gaps = 4/148 (2%)

Query: 135 MIAAKEACTIAQATEK-TAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAE 193
                EA  +A+  E   A  T    E   ++  +  +     +E      ++++T T E
Sbjct: 512 ATETVEATEVAETAEALNATETVEATEVAEAVEALNATETVEATEVAEAVEALNATETVE 571

Query: 194 KSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQR 253
            + +++ +   + TE  + TEV E +   I+   +        ++ + +AD   +     
Sbjct: 572 ATEVAEAVEALNATETVEATEVFEGAEVTISVDGTDYVVVVEESEIVYQADTTRDDSVVE 631

Query: 254 GKIFSNTIK---NNAFIEKLAHTTKAID 278
           G I S  I+   +    +K   T +A++
Sbjct: 632 GAITSGGIEVDNDAKAADKNKATHEAVE 659


>gi|195498812|ref|XP_002096685.1| GE24912 [Drosophila yakuba]
 gi|194182786|gb|EDW96397.1| GE24912 [Drosophila yakuba]
          Length = 597

 Score = 38.7 bits (88), Expect = 1.8,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 92/285 (32%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRTK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVPLSDQT 307
            Q   +  NT K   F+       + + +K+P    + N  +       E   +    + 
Sbjct: 109 LQNILVNDNTHKIRNFLINHKPL-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLEQ 167

Query: 308 LFRDFQ------GLCGKNIDNQ--FILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
           L + ++       L    I  Q  FILD    S +F  K    +   +AI+ + N + K 
Sbjct: 168 LKQHYKEQLLRRALLQNRIKYQNEFILDEELKSRVFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M     F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMDDQSNFIKHILFLGMPAIAKFKELNDEFRNME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLK-ISGILSPDKATELQRSFYLK 459
            K    +Q   ++     K  G   ++     +         Y++
Sbjct: 282 EKSRKNLQHKLQMLSALKKPAGTSIVNFNKPKEAPPTTNLKRYVR 326


>gi|260824625|ref|XP_002607268.1| hypothetical protein BRAFLDRAFT_125174 [Branchiostoma floridae]
 gi|229292614|gb|EEN63278.1| hypothetical protein BRAFLDRAFT_125174 [Branchiostoma floridae]
          Length = 2643

 Score = 38.7 bits (88), Expect = 2.1,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 69/193 (35%), Gaps = 13/193 (6%)

Query: 114  RAAINLVRG---------GSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITS 164
            +     VRG           I+ K    G  I A  A     +   + KL     +  T+
Sbjct: 2277 KVVFEGVRGFGVYGDIAIDDISFKTVPCGIAIHATTAVPEQSSQSGSTKLVPTASKTSTT 2336

Query: 165  IRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKIN 224
              T    +   +S + G K S ++T  A  S+     T  STTE+  T+E   +  +   
Sbjct: 2337 DITTATYNTAQESTTDGAKTSEATTKPAPTSSEPLTTTHESTTEVATTSEATTQKPAPTA 2396

Query: 225  SQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFI 284
            S+   +T Q   T+  T ++   +      +  + T        ++  T++A  K  P  
Sbjct: 2397 SE-PLTTTQNSTTEVATASEATTKPAPTASEPLTTT---QDSTTEVGTTSEATTKPAPTS 2452

Query: 285  GNQWRDINTAHSE 297
                   + + +E
Sbjct: 2453 SEPLTTTHESTTE 2465



 Score = 37.2 bits (84), Expect = 5.9,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 62/153 (40%), Gaps = 8/153 (5%)

Query: 127  LKAGTAGTMIAAKEACTIAQ--ATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKA 184
                T      A E  T  Q   TE      A TK   T+   +  ++    +  +GT +
Sbjct: 2497 TSEATTKPAPTASEPLTTTQDSTTEVGTTSEATTKPAPTASEPL--TTTQDSTTEVGTTS 2554

Query: 185  SISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKAD 244
              ++T  A  ++     T +STTE+G T+E   +     +  L  +T Q   T+  T ++
Sbjct: 2555 E-ATTKPAPTASEPLTTTQDSTTEVGTTSEATTKPAPTASEPL--TTTQNSTTEVGTTSE 2611

Query: 245  PALESIYQRGKIFSNTIKNNAFIEKLAHTTKAI 277
             A  S++    + +NT     F   +  TT+ I
Sbjct: 2612 -ATTSVFAVTTVATNTQPPTTFETVMDTTTQEI 2643


>gi|307566355|ref|ZP_07628794.1| conserved domain protein [Prevotella amnii CRIS 21A-A]
 gi|307344932|gb|EFN90330.1| conserved domain protein [Prevotella amnii CRIS 21A-A]
          Length = 504

 Score = 38.7 bits (88), Expect = 2.3,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 3/130 (2%)

Query: 134 TMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAE 193
            M A++EA    +  +   K +    +   +I T+  + +TIKS SIG    I +   ++
Sbjct: 57  LMKASQEASI--KILQGNGKYSCKVIDSSIAIATLNNNVITIKSLSIGETELIVTDEDSK 114

Query: 194 KSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKAD-PALESIYQ 252
           + A    +   + T+I    E+ +  I K  ++L     + +  + +T  D  A      
Sbjct: 115 EQAKVNILVEETDTQIPDGVEIKDNVIKKWPAELIPEGGKIVLKEGITGIDVEAFRETPI 174

Query: 253 RGKIFSNTIK 262
           +  IF +T+K
Sbjct: 175 QEIIFPSTLK 184


>gi|254507937|ref|ZP_05120066.1| hypothetical protein VPMS16_3244 [Vibrio parahaemolyticus 16]
 gi|219549173|gb|EED26169.1| hypothetical protein VPMS16_3244 [Vibrio parahaemolyticus 16]
          Length = 786

 Score = 38.3 bits (87), Expect = 2.3,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 19/184 (10%)

Query: 147 ATEKTAKLTALTKE----GITSIRTIEGSS--VTIKSESIGTKASISSTNTAEKSAISQK 200
           AT++ A+LT +TKE    GI+   T +G    V +  E + ++ S  + +  E+      
Sbjct: 149 ATKQEAELTQITKEAKAKGISLTITSQGDYQFVAMNGEELHSEESFDALSKKEQEHFGAA 208

Query: 201 ITT------NSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRG 254
           I        N   ++ +  E   E I K+N  ++       + K L K       I    
Sbjct: 209 IDDLEVQLRNMVRQLTEWEEAYSEKIKKLNDDVTLDVITH-FIKQLKKDYSGYPEIKTYL 267

Query: 255 KIFSNTIKNNAFI------EKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTL 308
                 I +NA I      E+    T ++DKK+P        ++   S+F +V   +   
Sbjct: 268 TELQQDIVDNADIFLEQSAEQGEVATASLDKKLPRRYKVNVLVSRKDSDFPIVVEENPNY 327

Query: 309 FRDF 312
              F
Sbjct: 328 HSLF 331


>gi|329666726|gb|AEB92674.1| putative restriction endonuclease [Lactobacillus johnsonii DPC 6026]
          Length = 1562

 Score = 38.3 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 73/204 (35%), Gaps = 14/204 (6%)

Query: 198  SQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIF 257
            S K+  NS   I      V +         +K   +  W+  L K     ++I   GK  
Sbjct: 1226 SDKVLNNSLRMIRNYNAEVAKLKRDPKYIATKDNQKISWSDELKKKYKKGQTISFIGKKS 1285

Query: 258  SNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCG 317
               +    F +K  +    +DK+I      W++ NT   EF  + +  ++  R F  L  
Sbjct: 1286 LVKVLFRPFTKKYLY----LDKEIIARPGNWKEYNT---EFPTIIIPGKSNRRSFSALVA 1338

Query: 318  KNIDNQFILDLNRASFIF--NGKKLARDN-SAEAIQKLMNQFAKNPKQLQLISSYANQSI 374
                +Q I+D    +F    N      +N  A  ++KL      N   +  I S  N  I
Sbjct: 1339 NVPIDQNIMDAGAQTFCINQNHGLFNVENIDANLVKKLG---LNNKDLMPYIYSLLNSPI 1395

Query: 375  FADSVV-HLMQSIPEFAKYASKSG 397
            +      +L ++ P   K   K  
Sbjct: 1396 YKKYFYGNLKKNYPLVIKTKFKDD 1419


>gi|167645284|ref|YP_001682947.1| TonB-dependent receptor plug [Caulobacter sp. K31]
 gi|167347714|gb|ABZ70449.1| TonB-dependent receptor plug [Caulobacter sp. K31]
          Length = 1066

 Score = 38.3 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 59/386 (15%), Positives = 120/386 (31%), Gaps = 55/386 (14%)

Query: 61  ISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLV 120
           ++T    +A+    + IP   + +++  G     +VG + DA+     V   A    +L 
Sbjct: 23  LATVAAPLAITAIATAIPTLASAQDYTSGT----LVGTVRDAS--GAPVSGAAVTVKSLG 76

Query: 121 RGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESI 180
           +G +  L  G+ G                +     A++KEG          +V ++S   
Sbjct: 77  QGFTRQLVTGSDGQFRV--------PLVPQGGYSVAISKEGFQPT---SDGAVAVRSGGD 125

Query: 181 GTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLS-KSTPQGIWTKA 239
              +   S+  A  S +    T N   + G TT  +   +  +  Q+    T   +   A
Sbjct: 126 SAYSFTLSSADASVSEVVVTATANPQLDFGGTTTGLSVDLETLTKQVPVNRTITSVVLLA 185

Query: 240 LTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAID----KKIPFIGNQWRDINTA- 294
                 +  +   +  I  +++  NAF     + T   +      +PF   +  D+ T  
Sbjct: 186 PGAVQGSNTNFRGQPSIGGSSVAENAFYVNGLNITNFDNYLGGSTVPFDFYKSVDVKTGG 245

Query: 295 -HSEFKM--------VPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNS 345
             +EF          V  +      +F+       +   + +  + +F+  GK    DN 
Sbjct: 246 YQAEFGRSTGGIVNAVTKAGTN---EFKFAVRGQWEPDSLQEDQKDTFLRRGKLAKTDNK 302

Query: 346 AEAIQKLMNQFAKNPKQLQLISSYANQSIF-------------ADSVVHLMQS------- 385
           +  ++              +     NQ+ F              D    L          
Sbjct: 303 SLTLEAGGPIIPDRLFFFAMTQMRDNQTTFGSITGGSYNKETQRDPFYGLKLDGYITDRQ 362

Query: 386 IPEFAKYASKSGSASKFTAKTLTNGE 411
             EF  + +K  +          +  
Sbjct: 363 HLEFTYFDTKGSAKRSTRQYEFDDTT 388


>gi|169830864|ref|YP_001716846.1| methyl-accepting chemotaxis sensory transducer [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169637708|gb|ACA59214.1| methyl-accepting chemotaxis sensory transducer [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 679

 Score = 38.3 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 57/326 (17%), Positives = 112/326 (34%), Gaps = 48/326 (14%)

Query: 89  GNY---GWGIVGAISDAALLIPVVGY--------GARAAINLVRGGSIALKAGTAGTMIA 137
           GNY   GW I   + +  LL P+V          GA   + LV  G  A++  TA     
Sbjct: 314 GNYRGQGWSIAAGVDERELLAPLVAIRNGAFAVGGAVLLVGLVAAGWFAVRL-TAPLRRM 372

Query: 138 AKEACTI----------AQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASIS 187
            +EA  +           ++T++  +L A   + + ++R +        +        IS
Sbjct: 373 IEEANKVGEGDLTRRLETKSTDEIGELAAAFNQMVDALRGLVARVGESSANLAAQSQEIS 432

Query: 188 STNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGI------------ 235
           ++  +E+ A        STT++  T E        +     K     +            
Sbjct: 433 AS--SEEVASVMDQVAGSTTQVAATAEQASSGAQALVQSAEKMKHAALGGNKHVFQSVKT 490

Query: 236 ------WTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWR 289
                  TK +T +   LE    +    +  I + A    L     AI+      G Q R
Sbjct: 491 IESTQEATKRITASTKELEQRTGKVSQITRVITDIADQTNLLALNAAIEAAR--AGEQGR 548

Query: 290 DINTAHSEFKMVPLSDQTLFRDFQGL---CGKNIDNQFILDLNRASFIFNGKKLARDNSA 346
                  E + +        ++   +    G+ +          A+ +  G + AR  + 
Sbjct: 549 GFAVVAEEVRKLAEQSAGAAKEISQIVSEIGRGMQAVSSSTDATAAAVAKGVETAR-QAG 607

Query: 347 EAIQKLMNQFAKNPKQLQLISSYANQ 372
           +A ++++    +N + ++ I+  + Q
Sbjct: 608 DAFKEIVKTVRENIEMIEQIAQGSKQ 633


>gi|195568910|ref|XP_002102455.1| GD19920 [Drosophila simulans]
 gi|194198382|gb|EDX11958.1| GD19920 [Drosophila simulans]
          Length = 597

 Score = 38.3 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 92/285 (32%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRTK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVPLSDQT 307
            Q   I  NT K   F+       + + +K+P    + N  +       E   +      
Sbjct: 109 LQNILINDNTHKIRNFLINHKPL-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLDQ 167

Query: 308 LFRDFQ------GLCGKNIDNQ--FILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
           L + ++       L    I  Q  FILD    S +F  K    +   +AI+ + N + K 
Sbjct: 168 LKQHYKEQLLRRALLQNRIKYQNEFILDEELKSRVFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M     F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMDDQSNFIKHILFLGMPAIAKFKELNDEFRNME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLKISGI-LSPDKATELQRSFYLK 459
            K    +Q   ++     K  G  I+      + A       Y++
Sbjct: 282 EKSRKNLQHKLQMLSALKKPAGTSIANFNKPKEAAPTTNLKRYVR 326


>gi|153873986|ref|ZP_02002377.1| ABC transporter, transmembrane region [Beggiatoa sp. PS]
 gi|152069550|gb|EDN67623.1| ABC transporter, transmembrane region [Beggiatoa sp. PS]
          Length = 544

 Score = 38.3 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 53/140 (37%), Gaps = 6/140 (4%)

Query: 324 FILDLNR---ASFIFNGKKLA--RDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADS 378
           FIL +N     S I  G K+   +    EA        ++  + +Q I +Y  +  +   
Sbjct: 176 FILLVNPIVIYSTILLGHKIKALKQKENEAYATFQQNLSETLEAIQQIRAYNRERYYLGR 235

Query: 379 VVHLMQSIPEFAK-YASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYG 437
           V+     I  +A  YA KS +A +F+   L  G   F A     V   D   G+    + 
Sbjct: 236 VIDNANRIKNYAIAYAWKSDAAGRFSFNILLTGFEIFRALSMFMVLFSDLTIGQMFAVFS 295

Query: 438 LKISGILSPDKATELQRSFY 457
                +    +   +Q S++
Sbjct: 296 YLWFMLTPMQEIINIQYSYH 315


>gi|309355014|emb|CAP39824.2| CBR-CLEC-223 protein [Caenorhabditis briggsae AF16]
          Length = 2419

 Score = 38.3 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 63/146 (43%), Gaps = 2/146 (1%)

Query: 123 GSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGT 182
            S   +  ++ T      + T   ++  TA+ ++ T E  +S  T E SS T +  S  T
Sbjct: 578 SSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSST 637

Query: 183 KASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESIS--KINSQLSKSTPQGIWTKAL 240
           KA  SS+ T   S+ +    ++STTE+  ++   E S S  ++ S  + + P    T+  
Sbjct: 638 KAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVP 697

Query: 241 TKADPALESIYQRGKIFSNTIKNNAF 266
           + +  A  S        S+T    + 
Sbjct: 698 SSSTTAEPSSSTTEVPSSSTTAEPSS 723


>gi|167520372|ref|XP_001744525.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776856|gb|EDQ90474.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1082

 Score = 38.3 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 74/236 (31%), Gaps = 40/236 (16%)

Query: 84  REFK-KGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEAC 142
           + FK KGNY +G     SD         Y            ++  KA +     A+ E  
Sbjct: 556 QMFKAKGNYNFGAHA--SDK-----PSSY------------TVTTKASSVPARPASSEKA 596

Query: 143 TIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKIT 202
             A               G   + ++ G + T    ++  KA   S + A++  ++    
Sbjct: 597 VSAPKAAPALAERMKAFHGQPPVNSVVGGNTTPAPPTVSDKALRESESMAKRGGVAAIAA 656

Query: 203 TNSTTEIGKTTEVVEESISKINSQLSK------------------STPQGIWTKALTKAD 244
              TT+   T     E+ S+  S  +K                    PQG   +A  +A 
Sbjct: 657 RFLTTQTEGTAPQAREAASRRRSSTAKVAEVARAFAVTAAVPSPAQEPQGSKPEAPVRAT 716

Query: 245 PALESIYQRGKIFSNTI--KNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEF 298
           P    +   G +  + +  K      +     +A+ +KI         +     ++
Sbjct: 717 PRASGVSASGAVKCDVVPPKTAVTANQSVRGIRALFEKISATSTTPAPVTICRPKY 772


>gi|28571555|ref|NP_649704.3| CG14609 [Drosophila melanogaster]
 gi|19528181|gb|AAL90205.1| AT27838p [Drosophila melanogaster]
 gi|28381152|gb|AAF54049.2| CG14609 [Drosophila melanogaster]
 gi|220949732|gb|ACL87409.1| CG14609-PA [synthetic construct]
          Length = 597

 Score = 38.3 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 92/285 (32%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRAK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVPLSDQT 307
            Q   I  NT K   F+       + + +K+P    + N  +       E   +      
Sbjct: 109 LQNILINDNTHKIRNFLINHKPL-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLDQ 167

Query: 308 LFRDFQ------GLCGKNIDNQ--FILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
           L + ++       L    I  Q  FILD    S +F  K    +   +AI+ + N + K 
Sbjct: 168 LKQHYKEQLLRRALLQNRIKYQNEFILDEELKSRVFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M     F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMDDQSNFIKHILFLGMPAIAKFKELNDEFRNME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLKISGI-LSPDKATELQRSFYLK 459
            K    +Q   ++     K  G  I+      + A       Y++
Sbjct: 282 EKSRKNLQHKLQMLSALKKPAGTSIANFNKPKEAAPTTNLKRYVR 326


>gi|114561682|ref|YP_749195.1| permease [Shewanella frigidimarina NCIMB 400]
 gi|114332975|gb|ABI70357.1| permease [Shewanella frigidimarina NCIMB 400]
          Length = 510

 Score = 38.3 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 70/190 (36%), Gaps = 26/190 (13%)

Query: 103 ALLIPVVGYGARAAINLV--RGGSIALKAGTAGTMIAAKEACTIAQATEK---------- 150
           A++ P+    +     L+  R     + A T+     A ++   A+              
Sbjct: 109 AIVRPIAAITSAIVAGLLVGRDDDDGIPASTSAKAKTATDSSASAKPVSSCCGSKSTASS 168

Query: 151 ---TAKLTALTKEGITSIRTIEGSS---VTIKSESIGTKASISSTNTAEKSAISQKITTN 204
                  T  T  G T+  T++ +S     IKSES+ + + +S    A+    S+     
Sbjct: 169 DASAEASTETTSIGKTTTSTMQNASVKMTAIKSESVNSGSILSPMTAAQSIGGSRSQVKQ 228

Query: 205 STTEIGKTTEVVEESI------SKINSQLSKSTPQGIWTKAL--TKADPALESIYQRGKI 256
           S+    K  +   ES       +K+   +   TP    T +   +KA+P +E+I      
Sbjct: 229 SSCCGSKAADKPAESAPAACCSTKVKDDVKDETPAATVTSSCCSSKAEPKVEAISTSCCS 288

Query: 257 FSNTIKNNAF 266
            + T+ + A 
Sbjct: 289 TAATVNHAAS 298


>gi|294890010|ref|XP_002773038.1| protein PARM-1 precursor, putative [Perkinsus marinus ATCC 50983]
 gi|239877741|gb|EER04854.1| protein PARM-1 precursor, putative [Perkinsus marinus ATCC 50983]
          Length = 452

 Score = 37.9 bits (86), Expect = 3.1,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 67/179 (37%), Gaps = 10/179 (5%)

Query: 123 GSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIE---GSSVTIKSES 179
                +   +GT    +EA +    TE++   T  T+E ++   T E     + T +   
Sbjct: 196 SGTTTEEAVSGTTT--EEAVSGTTTTEESVSGTTTTEEAVSGTTTTEEAVSGTTTTEESV 253

Query: 180 IG--TKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWT 237
           IG  T+ ++S T T E+ A+S   T  + +    T E V  S +     +S +T +   +
Sbjct: 254 IGTTTEEAVSGTTTTEE-AVSGTTTEGAVSGTTTTEEAV--SGTTTEGAVSGTTTEESVS 310

Query: 238 KALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHS 296
              T                +N+ +    I      +   +  +P+  N    +N+  S
Sbjct: 311 GTTTVESVETTEAVVGTTDAANSAETTTTIPAAEGDSVDDEGDMPYCDNYCIGLNSGKS 369


>gi|322490473|emb|CBZ25733.1| hypothetical protein, unknown function [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 742

 Score = 37.9 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 66/179 (36%), Gaps = 5/179 (2%)

Query: 121 RGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESI 180
           R   +A     A   I       +  ++   A        G+TS++   G S ++ + S 
Sbjct: 287 RSSCMAASMPEASVGICTAVGVAMTGSSCPAAAPVRAGAPGVTSLKITMGGSTSVVAASA 346

Query: 181 GTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTK-A 239
                ++S   A++   S + +T S        +   +SI   + +   S+P    TK  
Sbjct: 347 PLSPLVNSPLLAQQQPRSAERSTRSLHATSDAHKGGVDSIDVESDEDRISSPGTGPTKPT 406

Query: 240 LTKADPALESIYQRGKIFS-NTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSE 297
           + +A+     +Y   +  S +  K     E++     A+ + + F     R I +A  E
Sbjct: 407 VAQAEARYRYLYDEFRKVSRSRAKLLEESERMKRKQTALQEALDFYR---RKIVSAAEE 462


>gi|194899223|ref|XP_001979160.1| GG13919 [Drosophila erecta]
 gi|190650863|gb|EDV48118.1| GG13919 [Drosophila erecta]
          Length = 597

 Score = 37.9 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 91/285 (31%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRTK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVPLSDQT 307
            Q   +  NT K   F+       + + +K+P    + N  +       E   +      
Sbjct: 109 LQNILVNDNTHKIRNFLINHKPL-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLDQ 167

Query: 308 LFRDFQ------GLCGKNIDNQ--FILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
           L + ++       L    I  Q  FILD    S +F  K    +   +AI+ + N + K 
Sbjct: 168 LKQHYKEQLLRRALLQNRIKYQNEFILDEELKSRVFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M     F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMDDQSNFIKHILFLGMPAIAKFKELNDEFRHME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLK-ISGILSPDKATELQRSFYLK 459
            K    +Q   ++     K  G   ++     +         Y++
Sbjct: 282 EKSRKNLQHKLQMLSALKKPAGTSIVNFNKPKEAPPTTNLKRYVR 326


>gi|216905980|ref|YP_002333576.1| gp15 [Bacillus phage TP21-L]
 gi|215809707|gb|ACJ70541.1| gp15 [Bacillus phage TP21-L]
          Length = 947

 Score = 37.9 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 50/262 (19%), Positives = 95/262 (36%), Gaps = 13/262 (4%)

Query: 117 INLVRGGSIALKAGTAGTMIAAKE-ACTIAQATEKTAKL-TALTK-EGITSIRTIEGSSV 173
             +V   ++A+  G AG   A+   A  +  A ++       ++K + I+     E   +
Sbjct: 46  FGMVGASAVAMGIGLAGVAGASLGLATGLVGAVKEGMSFEKQMSKVQSISGSSGHEMGEL 105

Query: 174 TIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQ 233
           T K+  +G     SST  AE          N++ +I     ++  + +  N +L ++T  
Sbjct: 106 TAKARELGKSTRYSSTEVAEGFEFMSLAGWNASQQISAIGPLLNMATAG-NMELGRAT-- 162

Query: 234 GIWTKALTKADPALESIYQRGKIFSNT-IKNNAFIEKLAHTTKAIDKKIPFIGNQWRDIN 292
            I T  +T          +   +F+ T  K N  I++L    K +       G    + N
Sbjct: 163 DIVTDTMTGFSMQANEAGKASDLFAVTQSKTNTSIDQLGEAMKYVAPVANAFGMDLSETN 222

Query: 293 TAHSEFKMV----PLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNSAEA 348
               EF        ++   L      L G   +    LD    S        +  N  + 
Sbjct: 223 VILGEFANAGTKGSMAGTALRAGLSRLAGPPKEASKALDALGVSTTNTDG--SMRNIRDI 280

Query: 349 IQKLMNQFAKNPKQLQLISSYA 370
           +  L   F+   ++ Q++S+ A
Sbjct: 281 VGDLSKGFSNLSQEQQIVSAKA 302


>gi|291228002|ref|XP_002733970.1| PREDICTED: hypothetical protein, partial [Saccoglossus kowalevskii]
          Length = 2071

 Score = 37.5 bits (85), Expect = 3.9,   Method: Composition-based stats.
 Identities = 50/284 (17%), Positives = 95/284 (33%), Gaps = 29/284 (10%)

Query: 142 CTIAQATEKTAKLTALTKEG---ITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAIS 198
             + + TE T +   LT E    I ++  I     T++S ++G K+ +     AE     
Sbjct: 218 TVMNKMTEITTRYEKLTVESTKYIETLHVIIVKHTTLESTTVGVKSVVDDREKAEDDR-E 276

Query: 199 QKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKIFS 258
           +KI  +   E     E + + +S +   L    P       L K            ++ S
Sbjct: 277 KKIIEDELKEHSYDLEELLKWVSAVEISLGSEQPLKEEPGQLNK------------QVKS 324

Query: 259 NTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGK 318
           N +      +     T A+     F+      ++   +E   +      L + ++ +  +
Sbjct: 325 NKVIAADVDDHKKPVTDALSGADIFLATYGDKVDDVEAE--RLRRDHADLTKRYKKVADE 382

Query: 319 NIDNQFILDLNRASFIFNGKKLA-----RDNSAEAIQKLMNQFAKNPKQLQLISSYANQS 373
             D    LD ++ +     KK++        S   ++KL N  AK+  +L+       Q 
Sbjct: 383 TDDRDSNLDDSKKTLDLFTKKVSSFETWLVPSERTMKKLQNSVAKDLPKLK------EQE 436

Query: 374 IFADSVVHLMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFTAK 417
             A      +    E     + +G      AK      V F   
Sbjct: 437 KNAKKFAADVADHKEELDDTNMTGQHFIDEAKNFKEMIVEFRTT 480


>gi|195344169|ref|XP_002038661.1| GM10941 [Drosophila sechellia]
 gi|194133682|gb|EDW55198.1| GM10941 [Drosophila sechellia]
          Length = 597

 Score = 37.5 bits (85), Expect = 4.1,   Method: Composition-based stats.
 Identities = 50/285 (17%), Positives = 92/285 (32%), Gaps = 25/285 (8%)

Query: 193 EKSAISQKITTNSTTE--IGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           +   + ++ T NS TE   G T  +    + K +   +         K L        + 
Sbjct: 49  QHVMVDERWTPNSLTEQFKGMTDLLTRRLVFKNHESKANRQRYFRENKRLKLQCRDGRTK 108

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---IGNQWRDINTAHSEFKMVPLSDQT 307
            Q   I  NT K   F+       + + +K+P    + N  +       E   +      
Sbjct: 109 LQNILINDNTHKIRNFLINHKPL-QRLYQKMPIHLVVDNINQRTFVMRKERDRLEFRLDQ 167

Query: 308 LFRDFQ------GLCGKNIDNQ--FILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN 359
           L + ++       L    I  Q  FILD    S +F  K    +   +AI+ + N + K 
Sbjct: 168 LKQHYKEQLLRRALLQNRIKYQNEFILDEELKSRVFLKKIENSNVRLKAIKTINNTYKK- 226

Query: 360 PKQLQLISSYANQSIFADSVVH----LMQSIPEFAKYASKSGSASKFTAKTLTNGEVAFT 415
                +I    +  IF + ++      M     F K+    G  +    K L +      
Sbjct: 227 -----MIQVLVHDEIFYEPILRSLSSDMDDQSNFIKHILFLGMPAIAKFKELNDEFRNME 281

Query: 416 AKYTTKVQAVDKIAGKPLKEYGLK-ISGILSPDKATELQRSFYLK 459
            K    +Q   ++     K  G   ++     + A       Y++
Sbjct: 282 EKSRKNLQHKLQMLSALKKPAGTSIVNFNKPKEAAPTTNLKRYVR 326


>gi|292656292|ref|YP_003536189.1| ABC transporter permease [Haloferax volcanii DS2]
 gi|291370426|gb|ADE02653.1| ABC-type transport system permease protein (homolog of LolDCE
           lipoprotein release factor) [Haloferax volcanii DS2]
          Length = 411

 Score = 37.5 bits (85), Expect = 4.7,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 63/178 (35%), Gaps = 8/178 (4%)

Query: 105 LIPVVGYGARAAINLVRG-GSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGIT 163
           L  VVG   R  +  +R   S  +     G  +A     T++          A+  EG+ 
Sbjct: 7   LFGVVGLAGRRVLGRLRTTSSKQVLLSVIGVALAVTLMTTVSGIALGLGAENAIQSEGVD 66

Query: 164 SIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKI 223
                E S+ +  + S+G+     +    ++ A  +++   +  +    T   E+  +  
Sbjct: 67  YWVVPEASTASSVAVSVGSPQLGDTHAITDRLARDERVDYATPVQTQLVTLAPEDGSTDE 126

Query: 224 NSQLSKSTPQ-------GIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTT 274
               +   P        G+ T+ALT  DP   +    G      + N+A  E L  + 
Sbjct: 127 YVLAAGIIPPEEPTSVVGVSTEALTPGDPHYANGSYDGPRTGELVLNDAAAELLGVSA 184


>gi|229007823|ref|ZP_04165405.1| TROVE domain protein [Bacillus mycoides Rock1-4]
 gi|228753436|gb|EEM02892.1| TROVE domain protein [Bacillus mycoides Rock1-4]
          Length = 489

 Score = 37.5 bits (85), Expect = 4.9,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 335 FNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHL----MQSIPEFA 390
           FN  K   DNS E +        ++PK +  ++ YA +  +  SV H+    + + PE  
Sbjct: 40  FNEPKFYGDNSEELVTTAKQIMDRDPKFVASLAVYAREVFYMRSVTHVLAVELANHPEGR 99

Query: 391 KYASKSGSA 399
           KYA ++ S 
Sbjct: 100 KYARQTVSR 108


>gi|226363227|ref|YP_002781009.1| enoyl-CoA hydratase [Rhodococcus opacus B4]
 gi|226241716|dbj|BAH52064.1| putative enoyl-CoA hydratase [Rhodococcus opacus B4]
          Length = 260

 Score = 37.2 bits (84), Expect = 5.2,   Method: Composition-based stats.
 Identities = 54/229 (23%), Positives = 85/229 (37%), Gaps = 15/229 (6%)

Query: 28  NISIVDKTMDVLPLYHQVRELTQNKASTEQVID-ISTKVKDVAVDVAVSMIPIYGTYREF 86
           +I  VD T+D   L   +   T+  A T + +D I+      A D  V    + GT R F
Sbjct: 4   DIPGVDTTVDNGVLRVTLNRPTRMNAVTTETLDAIADAFAKHAGDAEVRAAILTGTGRAF 63

Query: 87  KKGN--YGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTI 144
             G    G  I G  S A +        A  A      G++   A   G  +A   AC +
Sbjct: 64  CTGADLGGLDISGPPSSATIDAANRAAAAIRAFPRPVIGAVNGPAAGVGVSLAL--ACDL 121

Query: 145 AQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTN 204
             ATE +  L A TK G+      +G +  + + SIG   ++     AE+    + +T  
Sbjct: 122 TIATESSYFLLAFTKVGLMP----DGGATALVAASIGRARALKMALLAERMPAREALTAG 177

Query: 205 STT------EIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPAL 247
                    E   T + +   ++   S+    T   +    L + D A 
Sbjct: 178 LIADVYPDEEFATTVDALGRRLADGPSEAFHFTKDAVNDATLVELDNAF 226


>gi|268680112|ref|YP_003304543.1| chemotaxis sensory transducer [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618143|gb|ACZ12508.1| chemotaxis sensory transducer [Sulfurospirillum deleyianum DSM
           6946]
          Length = 393

 Score = 37.2 bits (84), Expect = 5.9,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 75/180 (41%), Gaps = 8/180 (4%)

Query: 123 GSIALKAGTAGTMIAAKEACTIAQA-TEKTAKLTALTKEGITSIRTIEGSSVTIKSESIG 181
            S+A       +  A +EA  I++   E+T +++ +T++   + ++IE ++ TI    + 
Sbjct: 185 SSLAQVVTAINSNKALQEARDISKTLAEQTKEISLITQD---ASKSIEDTANTI---VVV 238

Query: 182 TKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALT 241
            +   +     + +    +  TN+  +IG  T  ++   S+ N     +T +        
Sbjct: 239 NEKLAAEVRNVQVTNEMAQELTNAVEQIGNITTAIKYIASETNLLALNATIEAARAGEHG 298

Query: 242 KADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMV 301
           +    + S  ++    SN   ++  +  +    K +D+ +P +     +I    +E + +
Sbjct: 299 RGFAVVASEVRKLSDQSNKSTDSIRVS-IMEVQKVVDQIVPALQKTVDEIIHTQAEVERI 357


>gi|241018399|ref|XP_002405770.1| secreted mucin MUC17, putative [Ixodes scapularis]
 gi|215491800|gb|EEC01441.1| secreted mucin MUC17, putative [Ixodes scapularis]
          Length = 3497

 Score = 37.2 bits (84), Expect = 6.4,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 54/162 (33%), Gaps = 15/162 (9%)

Query: 120  VRGGSIALKAGTA--GTMIAAK-------EACTIAQATEKTAKLTALTKEGITSIRTIEG 170
            V   SIA  A T   GT  AA        EA T    T         T EG TS  T  G
Sbjct: 2293 VTSPSIATSAETTSEGTSPAATSPGATSTEATTPEVTTPAGTTPAVSTAEGPTSEVTTHG 2352

Query: 171  SSV------TIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKIN 224
             +       TI + S  T    +S  T  + A SQ  T+  TT    T  V     +   
Sbjct: 2353 GTTPEVTTPTIITSSETTSEISTSEVTTPEGATSQVTTSEVTTPGATTPAVTTPITTPAI 2412

Query: 225  SQLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAF 266
            S    +TP+G+ +   T      E     G     +    A 
Sbjct: 2413 STPEVTTPEGVTSSVTTPEGVTPEVTTLAGTTLEVSTPEAAS 2454


>gi|307352368|ref|YP_003893419.1| polymorphic outer membrane protein [Methanoplanus petrolearius DSM
           11571]
 gi|307155601|gb|ADN34981.1| polymorphic outer membrane protein [Methanoplanus petrolearius DSM
           11571]
          Length = 866

 Score = 37.2 bits (84), Expect = 6.6,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 62/165 (37%), Gaps = 3/165 (1%)

Query: 119 LVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSE 178
           LV G + +  + TAG         T   A E T+    +  +GI    T+ G   ++ S 
Sbjct: 522 LVLGTAPSPSSITAGDSSIVSADLTRNSADEDTSPGGYVP-DGIPVTFTLAGGPGSLSSL 580

Query: 179 SIGTKASISSTNTAEKSAISQKITTNSTTEIGKTT-EVVEESISKINSQLSKSTPQGIWT 237
           S  T + +S+T  +  S  +  I      +I   T +V     S        +T  GI  
Sbjct: 581 SGATVSGVSATTYSSSSPGTATIAATVDNQIANCTVQVNSGGGSSSGGSGGSNTDTGIGF 640

Query: 238 KALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIP 282
               KA   +     +G ++   +     IEKL  T +  D  +P
Sbjct: 641 AEDLKAGENVSLEMNKGAVYRVDLTAKTDIEKLMITVRK-DSSVP 684


>gi|260905459|ref|ZP_05913781.1| hypothetical protein BlinB_09025 [Brevibacterium linens BL2]
          Length = 528

 Score = 36.8 bits (83), Expect = 7.4,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 60/157 (38%), Gaps = 7/157 (4%)

Query: 94  GIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAK 153
           G  G + D      +     +A I++  G +  LK G  GT ++ +    +    E    
Sbjct: 26  GAGGTLEDVIAEEGLADKLGKAGIDINTGVA-NLKLGGEGTTVSVETQDALNSVVENLVN 84

Query: 154 LTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTT 213
                K GI SI    G    IK   I     ++  N  + + +       ++  IGK T
Sbjct: 85  EKLADKAGIVSIDLKNGD---IK---IDLAKVVNGENGEDLNGLDPNTQVLTSETIGKIT 138

Query: 214 EVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
           + V E++  +  + +++   G+       + PA  S+
Sbjct: 139 DAVAEALGTLGGKFNETLKDGLNDAHAKISLPAEGSV 175


>gi|326668004|ref|XP_002662132.2| PREDICTED: hypothetical protein LOC116993 [Danio rerio]
          Length = 5131

 Score = 36.8 bits (83), Expect = 7.5,   Method: Composition-based stats.
 Identities = 44/207 (21%), Positives = 77/207 (37%), Gaps = 19/207 (9%)

Query: 107  PVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIR 166
            P     + A+I  V   S++    T  T+ +   A TI   T + +     T        
Sbjct: 2286 PASSLMSTASITKVTFTSLSTGESTGQTVTSKDTASTIRTFTNQGSTPFTATT------- 2338

Query: 167  TIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQ 226
                ++  +K E + TK        +E + I    T  STT+ G    +  ES       
Sbjct: 2339 ----AATVMKDEEVSTKP-------SESTIIDDLETQFSTTQTGDLDNISSESTITSTMT 2387

Query: 227  LSKSTPQGIWTKALTKADPALESIYQRGKIFS-NTIKNNAFIEKLAHTTKAIDKKIPFIG 285
              K+TP+ + T + + + P+ ES     +     T K+      L +TT   DK +  + 
Sbjct: 2388 SDKTTPKDVLTLSFSSSFPSTESETSGDETSEKTTAKDLVSPISLLYTTSRSDKDLTKLT 2447

Query: 286  NQWRDINTAHSEFKMVPLSDQTLFRDF 312
                  ++  +       S++T  RDF
Sbjct: 2448 ETISVSSSTDAAVTSTKSSEKTTARDF 2474


>gi|110815982|gb|ABG91740.1| muramidase-released protein [Streptococcus suis]
          Length = 1256

 Score = 36.8 bits (83), Expect = 7.9,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 70/197 (35%), Gaps = 12/197 (6%)

Query: 80  YGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGG-SIALKAGTAGTMIAA 138
           YGT ++F    Y +G    +   +L++       +A   +     +IA     A T   A
Sbjct: 12  YGTKQQFSIRKYHFGAASVLLGVSLVLGAGAQVVKADETVASSEPTIASSVAPASTEAVA 71

Query: 139 KEA--------CTIAQATEKTAKLTALTKEGITSIRTIEG---SSVTIKSESIGTKASIS 187
           KEA          +A  + +  K  A+ ++  +    + G     +    ++   KA   
Sbjct: 72  KEAEKTNAENTSAVATTSTEVEKAKAVLEQVTSESPLLAGLGQKELAKTEDATLAKAIKD 131

Query: 188 STNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPAL 247
           +      +      +  +  ++      V+ +   + ++L K T  G+ T AL    P  
Sbjct: 132 AQTKLAAAKAILADSEATVEQVEAQVAAVKVANEALGNELQKYTVDGLLTAALDTVAPDT 191

Query: 248 ESIYQRGKIFSNTIKNN 264
            +   +      T+ ++
Sbjct: 192 TASTLKVGDGEGTLLDS 208


>gi|260774231|ref|ZP_05883146.1| ATP-dependent protease La Type II [Vibrio metschnikovii CIP 69.14]
 gi|260611192|gb|EEX36396.1| ATP-dependent protease La Type II [Vibrio metschnikovii CIP 69.14]
          Length = 786

 Score = 36.8 bits (83), Expect = 8.2,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 62/181 (34%), Gaps = 14/181 (7%)

Query: 146 QATEKTAKLTALTKEGITSIRTIEGSS---VTIKSESIGTKASISSTNTAEKSAISQKIT 202
           +  ++ A +T   KE   S+          V +  E + T+ +  + +  E+   +Q I 
Sbjct: 151 KQEQELAAITLRAKERDISLSITNQGEYQFVAMNGEEMHTEETFDALSKKEQEHFAQTID 210

Query: 203 T------NSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESIYQRGKI 256
                  N   ++ +  E   E I K+N  ++         +         E      ++
Sbjct: 211 ELEVSLRNMVRQLTEWEEAYSEKIKKLNDDVTLDVISHFIKQLKIDYSKYPEIKSYLTEL 270

Query: 257 FSNTIKNNAFI-----EKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRD 311
             + ++N         E+    T A+DKK+P        +  A  EF +V   +      
Sbjct: 271 QKDIVENVEIFLDETGEQGELATAALDKKLPRRYKVNVLVCRASQEFPVVVEENPNYHSL 330

Query: 312 F 312
           F
Sbjct: 331 F 331


>gi|284042464|ref|YP_003392804.1| methyl-accepting chemotaxis sensory transducer with Cache sensor
           [Conexibacter woesei DSM 14684]
 gi|283946685|gb|ADB49429.1| methyl-accepting chemotaxis sensory transducer with Cache sensor
           [Conexibacter woesei DSM 14684]
          Length = 823

 Score = 36.8 bits (83), Expect = 8.3,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 76/196 (38%), Gaps = 19/196 (9%)

Query: 95  IVGAISDAALLI---PVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQATEKT 151
           I GAI+D A             R A + VRG   A       T  A  EA T+A   E+ 
Sbjct: 547 IAGAIADVAQGAERQVTTVGTTRQANDGVRGAVSASTESAQATTTAVGEARTLA---EQG 603

Query: 152 AKLTALTKEGITSIR-TIEGSSVTI-----KSESIGT-KASISS-TNTAEKSAISQKITT 203
           A+  +   E + ++R + E ++  I     KSE IG    +I    +     A++  I  
Sbjct: 604 AEAVSQASEAMQAVRASSEDATEAIRDLGAKSERIGGIVETIGGIADQTNLLALNAAIEA 663

Query: 204 NSTTEIGKTTEVVEESISKINSQLSKSTPQ-----GIWTKALTKADPALESIYQRGKIFS 258
               E G+   VV E + K+  +   +        G   +   +A  A+E+  +R     
Sbjct: 664 ARAGEQGRGFAVVAEEVRKLAEESQDAAATIAELIGEIRRGTARAVQAVEAGAERTSAGV 723

Query: 259 NTIKNNAFIEKLAHTT 274
            T+++     +   T+
Sbjct: 724 ATVEDARNTFRSIRTS 739


>gi|120401060|ref|YP_950889.1| Fis family transcriptional regulator [Mycobacterium vanbaalenii
           PYR-1]
 gi|119953878|gb|ABM10883.1| transcriptional regulator, Fis family [Mycobacterium vanbaalenii
           PYR-1]
          Length = 473

 Score = 36.8 bits (83), Expect = 8.5,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 71/182 (39%), Gaps = 5/182 (2%)

Query: 127 LKAGTAGTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASI 186
           +K     T   + +A  +   T K A  T            +E    + K  +     S+
Sbjct: 86  IKEAGDKTAATSAQAAELTDRTVKDATKTMAKAAEDAKKAIVEADQTSRKEFT----ESV 141

Query: 187 SSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPA 246
           ++  TA  + + +    +S   + K   ++E+  ++++++ S S  + + TKA+ + DPA
Sbjct: 142 TAAKTALTAEVRRIFAGDSPELLEKLQPLLEKFSAELDAKSSASITE-VVTKAVKQFDPA 200

Query: 247 LESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQ 306
             +        +  ++     E L    + + +KI  IG   +      S  K+ P+   
Sbjct: 201 DPTSPMAKHTATLELRQQQLTELLGKNHEVLTQKIDEIGTAVKVQEARASLSKVTPIKGD 260

Query: 307 TL 308
           T 
Sbjct: 261 TF 262


>gi|15604326|ref|NP_220842.1| ribonuclease D (RND) [Rickettsia prowazekii str. Madrid E]
 gi|3861018|emb|CAA14918.1| RIBONUCLEASE D (rnd) [Rickettsia prowazekii]
 gi|292572078|gb|ADE29993.1| Ribonuclease D [Rickettsia prowazekii Rp22]
          Length = 281

 Score = 36.4 bits (82), Expect = 8.9,   Method: Composition-based stats.
 Identities = 35/161 (21%), Positives = 64/161 (39%), Gaps = 12/161 (7%)

Query: 226 QLSKSTPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIG 285
           Q S    + I    L  A   +E +Y+  K  +N I +N    K  HT  A+      + 
Sbjct: 133 QKSNWLKRPITNDMLNYAILDVEYLYKIYKELNNIIISNNLTHKYQHTLSALLD----VR 188

Query: 286 NQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFNGKKLARDNS 345
           N   ++  A  +       D+   R  Q L     +N   +++ R  FI +   +     
Sbjct: 189 NYKVELKDAWKKI-RYKSDDENFNRTIQVLAAYREENAQTINIPRKHFILDEDLIK---- 243

Query: 346 AEAIQKLMNQFAKNPKQLQLISSYANQSIFADSVVHLMQSI 386
              + K M    K+ K L+L S Y ++  + D +++L  ++
Sbjct: 244 ---LCKNMPLNYKDFKNLKLKSKYLHKKKYKDEIINLFNNL 281


>gi|325954017|ref|YP_004237677.1| aconitate hydratase 1 [Weeksella virosa DSM 16922]
 gi|323436635|gb|ADX67099.1| aconitate hydratase 1 [Weeksella virosa DSM 16922]
          Length = 925

 Score = 36.4 bits (82), Expect = 9.1,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 83/239 (34%), Gaps = 23/239 (9%)

Query: 89  GNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTAGTMIAAKEACTIAQAT 148
           G   WG+ G  ++AA+L   + +     I L   G I         +++      + +  
Sbjct: 214 GVIAWGVGGIEAEAAMLGQPIFFTCPEVIGLKLTGEIPAHCTATDMVLSI---TKVLREK 270

Query: 149 EKTAKLTALTKEGITSIRTIEGSSVTIKSESIG-----------TKASISSTNTAEKS-- 195
               K   +  +G+ S+   + ++++  S   G           T   + STN +++   
Sbjct: 271 GVVGKFVEVFGDGLDSLTVTDRATISNMSPEFGCTVTYFPIDHRTLEYMHSTNRSQEQIH 330

Query: 196 AISQKITTNSTTEIG----KTTEVVEESISKINSQLS--KSTPQGIWTKALT-KADPALE 248
            +      N     G    K + VVE  +  +   +S  K     I  K L  K    LE
Sbjct: 331 IVEDYCKENLLWRTGKEQIKYSSVVEFDLGSLEPTVSGPKRPQDKILVKDLAEKFAGLLE 390

Query: 249 SIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQT 307
           S + R      T K +A++      T+    K+P      R         + V + ++ 
Sbjct: 391 SEHNREYQSVPTRKESAWLADGGSGTEFTFGKVPIENTDPRPHEVVKESIQSVRIINKN 449


>gi|118360888|ref|XP_001013675.1| hypothetical protein TTHERM_00833680 [Tetrahymena thermophila]
 gi|89295442|gb|EAR93430.1| hypothetical protein TTHERM_00833680 [Tetrahymena thermophila SB210]
          Length = 1670

 Score = 36.4 bits (82), Expect = 9.1,   Method: Composition-based stats.
 Identities = 55/307 (17%), Positives = 104/307 (33%), Gaps = 55/307 (17%)

Query: 186  ISSTNTAEKSAISQKITTNSTTEIG--KTTEVVEESISKINSQLSKSTPQGIWTKALTKA 243
            +S++N ++ S     I T ST +IG    + +     S    QL+    +     +  + 
Sbjct: 825  LSASNNSQISPKKSIIKTVSTNKIGGLSISNLPMGRGSISQQQLTVPDKKKYIQNSNREE 884

Query: 244  DPALESIYQRG-----KIFSNTIKNNAFIEKLAHTTKAIDKKIPFIGNQ-------WRDI 291
              +     +RG     +IF  T KNN  +  +   ++    K+P   N+       ++D 
Sbjct: 885  GNSNIIDERRGSKRLSEIFKVTPKNNNSMTSIFSASRTSFNKLPDEENKDDQNIKSFQDQ 944

Query: 292  NTAHSEFKMVPLS--------------DQTLFRDFQGLCGKNIDNQFILD---------- 327
            + A    K +                  +   RD   LC  NID +F+ D          
Sbjct: 945  DQAEQNKKTLHSMLEGDDTKPGVLVEFMRNHLRDMLNLCVGNIDYEFVKDELSTIAINYT 1004

Query: 328  -LNRASFIFNGKKLARDNSAEAIQKLMNQFAKN---------PKQLQLISSYANQSIFAD 377
             L +   IF  K      S   I++    F +N          +++  IS+  N  I   
Sbjct: 1005 ILEKVLSIFMDKLKEIKMSESYIERFHQAFQENMLKVIPKTVIEKVGNISNLRN--IVMK 1062

Query: 378  SVVHLMQSIPEFAKY-ASKSGSASKFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPL--- 433
                L        ++ A++           + + E      Y+ +++   +I        
Sbjct: 1063 CFEILYLEYSLIGQFTAAQVEYVLNGVINFIHDKEDQ-IKLYSHEIRYKYQIDPAKYFFL 1121

Query: 434  KEYGLKI 440
            K+ GL+ 
Sbjct: 1122 KKIGLQA 1128


>gi|50293151|ref|XP_448989.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528302|emb|CAG61959.1| unnamed protein product [Candida glabrata]
          Length = 1024

 Score = 36.4 bits (82), Expect = 9.3,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 106/259 (40%), Gaps = 25/259 (9%)

Query: 117 INLVRGGSIALKAGTAGTMIAAKEA---CTIAQATEKTAKLTALTKEGITSIRTIEGSSV 173
                G + +    + G +  +K      +IA  T+  + L   T   +TS+     +  
Sbjct: 599 FGNSLGNNTSATTSSTGGLFGSKSQNNNSSIAFGTQTPSTLAPSTAPALTSLNHSAQAPN 658

Query: 174 TIKSESIGTKASISSTNTA---EKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKS 230
           T+K+ S+GT +SI++TN       S  S++   NS T+  K      ++ SK +S L+ +
Sbjct: 659 TVKTTSLGTGSSINTTNPTLPLANSTNSEQKLPNSLTQPVKIPPSTMKAASKKDSSLTSA 718

Query: 231 ---TPQGIWTKALTKADPALESIYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKIPF---- 283
               P+ ++  +  K    L S        ++T   +  +E + +T++++  ++ F    
Sbjct: 719 YRLAPRALFMSSDDKTTSTLRSHSASKDSKNSTEITHLPLENITNTSRSLGDQLLFNPDK 778

Query: 284 -------IGNQWRDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDLNRASFIFN 336
                  I N+      A+SE+K +    +      QG+    +++    D   + ++  
Sbjct: 779 KSFRSLIIKNKKVPEKIANSEYKRITFEAKN---KNQGVDESELESPR-NDT-PSPYVNT 833

Query: 337 GKKLARDNSAEAIQKLMNQ 355
             +++  + A A  +    
Sbjct: 834 SGRISTPSKAMAAMEFNTT 852


>gi|284006360|emb|CBA71595.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 319

 Score = 36.4 bits (82), Expect = 9.4,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 93/253 (36%), Gaps = 30/253 (11%)

Query: 74  VSMIPIYGTYREFKKGNYGWGIVGAISDAALLIPVVGYGARAAINLVRGGSIALKAGTA- 132
           +S+IP Y    E ++GN G  +   + D A      G+ +  ++ +  GG  ++ AG A 
Sbjct: 1   MSLIPFYTVITEAQQGNTGKAVQAGLWDMA------GFLSFISLTIQIGGRFSIAAGEAA 54

Query: 133 --GTMIAAKEACTIAQATEKTAKLTALTKEGITSIRTIEGSSVTIKSESIGTKASISSTN 190
             G   A K+A T  QA  +  K   L K GI  I      +V  K   +GT    S+  
Sbjct: 55  LNGLQTALKQA-TFRQALSQGGKQ--LLKSGIPHIANSLPPNVVAK---LGTAFLRSADP 108

Query: 191 TAEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALTKADPALESI 250
             E  A     + N+  +    +++    ++K+   L K        KA        E I
Sbjct: 109 GFELLASGGIKSINALKKAASQSKIEISGLNKLIKALEK--------KAADFPVVPTEKI 160

Query: 251 YQRGKIFSNTIKNNAFIEKLAHTTKAIDKKI------PFIGNQWRDINTAHSEFKMVPLS 304
                  ++  K  + I        AI  ++      P+     RD          VP+ 
Sbjct: 161 DIETAYRADLAKEVSVINIGYERGNAIYVQVNPATGEPYGRKYLRDAAGNLELAP-VPIG 219

Query: 305 DQTLFRDFQGLCG 317
           ++      QGL G
Sbjct: 220 ERLYHLKTQGLGG 232


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.309    0.117    0.285 

Lambda     K      H
   0.267   0.0360    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,306,884,983
Number of Sequences: 14124377
Number of extensions: 60614424
Number of successful extensions: 215137
Number of sequences better than 10.0: 1084
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 882
Number of HSP's that attempted gapping in prelim test: 211556
Number of HSP's gapped (non-prelim): 4016
length of query: 459
length of database: 4,842,793,630
effective HSP length: 143
effective length of query: 316
effective length of database: 2,823,007,719
effective search space: 892070439204
effective search space used: 892070439204
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 82 (36.4 bits)