RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780449|ref|YP_003064862.1| hypothetical protein
CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62]
         (459 letters)



>1fkm_A Protein (GYP1P), ORF YOR070C; GAP, YPT/RAB protein,
           vesicular trafficking, endocytosis, hydrolase, GTPase
           activation; 1.90A {Saccharomyces cerevisiae}
           (A:1-52,A:193-396)
          Length = 256

 Score = 29.6 bits (66), Expect = 0.88
 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 4/68 (5%)

Query: 322 NQFILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKN--PKQLQLISSYAN--QSIFAD 377
           N+F + +  A  I    +L   +  E I  L N   K+     ++ + S A   QS++ D
Sbjct: 185 NEFHVFVCAAFLIKWSDQLXEXDFQETITFLQNPPTKDWTETDIEXLLSEAFIWQSLYKD 244

Query: 378 SVVHLMQS 385
           +  H +  
Sbjct: 245 ATSHWLHH 252


>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1
           variant; triangular beta-sheet cluster, signaling
           protein; 3.10A {Homo sapiens} (A:1-38,A:169-247)
          Length = 117

 Score = 28.1 bits (62), Expect = 2.8
 Identities = 6/46 (13%), Positives = 10/46 (21%)

Query: 401 KFTAKTLTNGEVAFTAKYTTKVQAVDKIAGKPLKEYGLKISGILSP 446
                 +      F +     V  VD  +G  L         +   
Sbjct: 34  TLKEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFY 79


>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase,
           translation termination, ATP-binding, cytoplasm,
           hydrolase, membrane; 2.80A {Schizosaccharomyces pombe}
           (A:1-326)
          Length = 326

 Score = 27.8 bits (61), Expect = 3.0
 Identities = 19/83 (22%), Positives = 33/83 (39%), Gaps = 20/83 (24%)

Query: 289 RDINTAHSEFKMVPLSDQTLFRDFQGLCGKNIDNQFILDL---NRASFIFNGKKLARDNS 345
           R ++    +  ++  +D  L  D QGL      +  I  L   N    +F         S
Sbjct: 253 RQLDARDIKVFVLDEADNML--DQQGLGD---QSMRIKHLLPRNTQIVLF---------S 298

Query: 346 A---EAIQKLMNQFAKNPKQLQL 365
           A   E ++K   +FA N  +++L
Sbjct: 299 ATFSERVEKYAERFAPNANEIRL 321


>2w7t_A CTP synthetase, putative cytidine triphosphate synthase;
           glutaminase domain, trypsanosoma brucei, ligase,
           acivicin; HET: 5CS; 2.10A {Trypanosoma brucei}
           (A:1-129,A:223-273)
          Length = 180

 Score = 27.6 bits (61), Expect = 3.9
 Identities = 8/44 (18%), Positives = 15/44 (34%), Gaps = 7/44 (15%)

Query: 269 KLAHTTKAIDKKIPFIGNQWRDINTAHSEFKMVPLSDQTLFRDF 312
             A++    +    F+  Q+      H EF   P+     +  F
Sbjct: 121 SDANSE-EFNSLRFFLAVQF------HPEFISTPMDPAPTYLSF 157


>2c4m_A Glycogen phosphorylase; allosteric control, phosphate
           dependence, starch degrading, transferase,
           glycosyltransferase; HET: PLP; 1.9A {Corynebacterium
           callunae} (A:48-444,A:772-796)
          Length = 422

 Score = 27.0 bits (59), Expect = 5.0
 Identities = 12/58 (20%), Positives = 19/58 (32%), Gaps = 3/58 (5%)

Query: 60  DISTKVKDVAVDVAVSMIPIYGTYREFKKGNYGWGIVGA---ISDAALLIPVVGYGAR 114
            +  +      ++   +  I     +   GN G G + A    S      PV GYG  
Sbjct: 36  GLVDEAAAATRELGHELTDILEIENDAALGNGGLGRLAACFLDSAVTQDYPVTGYGLL 93


>2b9b_A Fusion glycoprotein F0; fusion protein, PRE-fusion
           conformation, viral protein; HET: NAG; 2.85A {Simian
           virus 5} (A:1-343)
          Length = 343

 Score = 27.1 bits (60), Expect = 5.2
 Identities = 17/121 (14%), Positives = 38/121 (31%), Gaps = 11/121 (9%)

Query: 115 AAINLVRGGSIALKAGTAG-----------TMIAAKEACTIAQATEKTAKLTALTKEGIT 163
             I ++      L   T             T+ +    C I   +   A +T L +    
Sbjct: 7   MQIGVIPTNVRQLMYYTEASSAFIVVKLMPTIDSPISGCNITSISSYNATVTKLLQPIGE 66

Query: 164 SIRTIEGSSVTIKSESIGTKASISSTNTAEKSAISQKITTNSTTEIGKTTEVVEESISKI 223
           ++ TI    +  +    G    +++   A  + ++  +      E       ++ +I K 
Sbjct: 67  NLETIRNQLIPTRRRFAGVVIGLAALGVATAAQVTAAVALVKANENAAAILNLKNAIQKT 126

Query: 224 N 224
           N
Sbjct: 127 N 127


>3ijd_A Uncharacterized protein; structural genomics, unknown
           function, PSI-2, protein structure initiative; HET: C2F;
           2.00A {Clostridium thermocellum atcc 27405} (A:)
          Length = 315

 Score = 26.6 bits (58), Expect = 7.3
 Identities = 6/35 (17%), Positives = 11/35 (31%)

Query: 9   YFPPNNNIERKEIADKLIKNISIVDKTMDVLPLYH 43
               +      E +  L K+I  + K       +H
Sbjct: 281 IESVSVRKVEIEASIALAKDIKYIMKGEGHHHHHH 315


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.313    0.128    0.345 

Gapped
Lambda     K      H
   0.267   0.0489    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 2,967,680
Number of extensions: 123504
Number of successful extensions: 286
Number of sequences better than 10.0: 1
Number of HSP's gapped: 286
Number of HSP's successfully gapped: 20
Length of query: 459
Length of database: 4,956,049
Length adjustment: 91
Effective length of query: 368
Effective length of database: 1,879,794
Effective search space: 691764192
Effective search space used: 691764192
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (25.9 bits)