RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780449|ref|YP_003064862.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62] (459 letters) >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Length = 359 Score = 27.2 bits (59), Expect = 2.8 Identities = 26/205 (12%), Positives = 60/205 (29%), Gaps = 14/205 (6%) Query: 192 AEKSAISQKITTNSTTEIGKTTEVVEESISKINSQLSKSTPQGIWTKALT--KADPALES 249 A A++++I+ + G + Q++ I A T A ES Sbjct: 156 AAAVALTRRISVI-SGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTES 214 Query: 250 IYQRGKIFSNTIKNNAFIEKLAHTTKAIDKKI----PFIGNQWRDINTAHSEFKMVPLSD 305 + + + T + I + A T + + ++ + D Sbjct: 215 LGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMID 274 Query: 306 QTLFRDFQGLCGKNIDNQFIL--DLNRASFIFNGKKLA---RDNSAEAIQKLMNQFAKNP 360 + + + I D ++ + + G L +A + Q ++ Sbjct: 275 LPMMSRLIDALPDHA--RVIFLGDRDQLASVEAGAVLGDICAYANAGFTAERARQLSRLT 332 Query: 361 KQLQLISSYANQSIFADSVVHLMQS 385 + + DS+ L +S Sbjct: 333 GTHVPAGTGTEAASLRDSLCLLQKS 357 >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Score = 26.3 bits (57), Expect = 4.7 Identities = 5/21 (23%), Positives = 9/21 (42%) Query: 254 GKIFSNTIKNNAFIEKLAHTT 274 +F +N ++L H T Sbjct: 458 ALVFREIATHNGIPDELQHLT 478 >d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 258 Score = 26.1 bits (57), Expect = 6.1 Identities = 9/30 (30%), Positives = 11/30 (36%), Gaps = 6/30 (20%) Query: 283 FIGNQWRDINTAHSEFKMVPLSDQTLFRDF 312 F+ Q+ H EF P LF F Sbjct: 223 FVACQF------HPEFTSTPRDGHPLFAGF 246 >d3byqa1 d.79.9.1 (A:2-192) Uncharacterized protein BB2672 {Bordetella bronchiseptica [TaxId: 518]} Length = 191 Score = 25.8 bits (57), Expect = 6.9 Identities = 10/48 (20%), Positives = 18/48 (37%), Gaps = 9/48 (18%) Query: 94 GIVGAISDAALLIPVVGYGARAAINLVRGGSIAL-----KAGTAGTMI 136 G+ G + A+ G+ R+ + G A+ TAG + Sbjct: 85 GVDGEMEHGAVWHEAGGWAMRSVL----GEPKAMVPAVKAVATAGYRM 128 >d1r5qa_ a.186.1.1 (A:) Circadian clock protein KaiA, C-terminal domain {Cyanobacterium (Nostoc sp. PCC 7120) [TaxId: 103690]} Length = 98 Score = 25.8 bits (57), Expect = 7.8 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Query: 352 LMNQFAKNPKQLQLISSYANQSIFAD-SV-----VHLMQSIPEFAK 391 L++ F + + I + N A+ V +H M+ I EF+K Sbjct: 19 LLSYFTTDKALKEKIDKFINAVFCANIPVPEIIEIH-MELIDEFSK 63 >d1r8ja1 a.186.1.1 (A:177-282) Circadian clock protein KaiA, C-terminal domain {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Length = 106 Score = 25.8 bits (57), Expect = 8.6 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 7/46 (15%) Query: 352 LMNQFAKNPKQLQLISSYANQSIFAD-SV-----VHLMQSIPEFAK 391 +++ F+ N Q I ++ N + FAD V +H M+ + EFAK Sbjct: 26 VLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIH-MELMDEFAK 70 >d1v2za_ a.186.1.1 (A:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]} Length = 106 Score = 25.4 bits (56), Expect = 9.6 Identities = 11/46 (23%), Positives = 24/46 (52%), Gaps = 7/46 (15%) Query: 352 LMNQFAKNPKQLQLISSYANQSIFAD-SV-----VHLMQSIPEFAK 391 ++ F + K + I + +++ FAD SV +H ++ + F+K Sbjct: 29 VLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIH-VELMDTFSK 73 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.128 0.345 Gapped Lambda K H 0.267 0.0679 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,504,049 Number of extensions: 66707 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's gapped: 141 Number of HSP's successfully gapped: 13 Length of query: 459 Length of database: 2,407,596 Length adjustment: 88 Effective length of query: 371 Effective length of database: 1,199,356 Effective search space: 444961076 Effective search space used: 444961076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 54 (24.7 bits)