HHsearch alignment for GI: 254780450 and conserved domain: COG0643

>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].
Probab=99.78  E-value=5.2e-17  Score=137.85  Aligned_cols=167  Identities=31%  Similarity=0.440  Sum_probs=119.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHC-CCCCEEEEEECCCCCEEEEECHHHHHHH---H
Q ss_conf             99998888764300454212005843585346789999999987503-5681699981489722699871699999---9
Q gi|254780450|r  462 IKHNANRAAILVRQLLAFSRKQTMRLTVLNLTEVIGNLRMMIQKLIS-EPPQVKLTVDYERDLWGVKTDLSQFEQV---L  537 (803)
Q Consensus       462 i~~~~~r~~~li~~lLd~sr~~~~~~~~~~l~~~i~~~~~~~~~~~~-~~~~i~~~~~~~~~~~~v~~D~~~l~qv---l  537 (803)
T Consensus       366 l~~~~~~l~~~~~~LQd~vm--~~RM--vP~~~vf~RfpR~VRdla~~lgK~V~L~ieG~~----telDksIlE~l~dPL  437 (716)
T COG0643         366 LDEALRQLSRLTTDLQDEVM--KIRM--VPFEQVFSRFPRMVRDLARKLGKQVELVIEGED----TELDKSILERLGDPL  437 (716)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--HHHC--EEHHHHHHHCCHHHHHHHHHHCCEEEEEEECCC----EEEHHHHHHHHCCCH
T ss_conf             99999999999999999999--9700--039998744409999999986991699996487----134298998864669


Q ss_pred             HHHHHHHH----------HHHCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCHHH----------
Q ss_conf             99874227----------6520678857999998504210122455667889789999997886688445----------
Q gi|254780450|r  538 VNLCVNAH----------HAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDI----------  597 (803)
Q Consensus       538 ~NLl~NA~----------~A~~~~~~G~v~i~~~~~~~~~~~~~~~~~~~~~~~v~i~V~D~G~GI~~~~----------  597 (803)
T Consensus       438 ~HLvRNAvDHGIE~pE~R~a~GKp~~G~I~L~A~~---------------~gn~ivIev~DDG~Gid~ekI~~KAiErGl  502 (716)
T COG0643         438 THLVRNAVDHGIETPEERRAAGKPEEGTITLSAYH---------------EGNNIVIEVSDDGAGIDREKIREKAIERGL  502 (716)
T ss_pred             HHHHHCCHHCCCCCHHHHHHCCCCCCCEEEEEEEC---------------CCCEEEEEEEECCCCCCHHHHHHHHHHCCC
T ss_conf             98885001105898899987598986369999983---------------798699999568998799999999998299


Q ss_pred             --------------HHHCCCCCCCCCCCC---CCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEECC
Q ss_conf             --------------420232222101357---765303889999985167549999618894299999437
Q gi|254780450|r  598 --------------MEKIFEPFFTTKKVG---EGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPR  651 (803)
Q Consensus       598 --------------~~~iFepF~ttk~~g---~GtGLGL~i~~~iv~~~gG~i~v~S~~g~Gt~F~i~lP~  651 (803)
T Consensus       503 i~~~~a~~lSd~Ei~~LIF~PGFSTa~~VtdvSGRGVGMDVVk~~I~~LgG~I~V~S~~G~GT~Fti~LPL  573 (716)
T COG0643         503 ITEEEAETLSDEEILNLIFAPGFSTAEQVTDVSGRGVGMDVVKTNIEQLGGSISVSSEPGKGTTFTIRLPL  573 (716)
T ss_pred             CCHHHHCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEEECCC
T ss_conf             88677520799999988736998734111016577657899999999739989999627897699996687