HHsearch alignment for GI: 254780450 and conserved domain: PRK10337

>PRK10337 sensor protein QseC; Provisional.
Probab=100.00  E-value=1.5e-41  Score=310.76  Aligned_cols=210  Identities=20%  Similarity=0.282  Sum_probs=167.9

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC----CEEEEEHH
Q ss_conf             44687630342566415899999999998507998478888999999988887643004542120058----43585346
Q gi|254780450|r  418 NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTM----RLTVLNLT  493 (803)
Q Consensus       418 ~a~~~~~a~isHelr~pL~~I~g~~~ll~~~~~~~~~~~~~l~~i~~~~~r~~~li~~lLd~sr~~~~----~~~~~~l~  493 (803)
T Consensus       232 ~~~r~F~adaAHELRTPLt~i~~~~e~~~~~~~~~~~~~~~l~~i~~~~~rl~~lv~~LL~Lar~d~~~~~~~~~~v~l~  311 (446)
T PRK10337        232 VRERRFTSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLDSLDNLQDVAEIPLE  311 (446)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECHH
T ss_conf             99999999788875168999999999984279998999999999999999999999999998775446565678175299


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEECHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCCC
Q ss_conf             78999999998750356816999814897226998716999999998742276520678857999998504210122455
Q gi|254780450|r  494 EVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVLVNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNY  573 (803)
Q Consensus       494 ~~i~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~D~~~l~qvl~NLl~NA~~A~~~~~~G~v~i~~~~~~~~~~~~~~~  573 (803)
T Consensus       312 ~l~~~~v~~~~~~a-~~~~i~l~~~~~~~~~~~~~d~~ll~~~l~NLl~NA--ikytp~g~~I~v~~~~-----------  377 (446)
T PRK10337        312 DLLQSAVMDIYHTA-QQAKIDVRLTLNAHGIKRTGQPLLLSLLVRNLLDNA--VRYSPQGSVVDVTLNA-----------  377 (446)
T ss_pred             HHHHHHHHHHHHHH-HHCCCEEEEECCCCCEEEECCHHHHHHHHHHHHHHH--HHHCCCCCEEEEEEEC-----------
T ss_conf             99999999999999-975977999628877067168999999999999999--9748999769999980-----------


Q ss_pred             CCCCCCCEEEEEEEECCCCCCHHHHHHCCCCCCCCC-CCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEE
Q ss_conf             667889789999997886688445420232222101-3577653038899999851675499996188942999994
Q gi|254780450|r  574 SDLPTKDMVLVEVEDTGIGMSPDIMEKIFEPFFTTK-KVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFL  649 (803)
Q Consensus       574 ~~~~~~~~v~i~V~D~G~GI~~~~~~~iFepF~ttk-~~g~GtGLGL~i~~~iv~~~gG~i~v~S~~g~Gt~F~i~l  649 (803)
T Consensus       378 --------~~l~V~D~G~GIp~e~~~~iFeRFyR~~~~~~~GsGLGLaIV~~I~~~hgG~i~l~~~~~GG~~~~vt~  446 (446)
T PRK10337        378 --------RNFTVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLSIVQRIAKLHGMNVSFGNAEEGGFEAKVSW  446 (446)
T ss_pred             --------CEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCEEEEEEEC
T ss_conf             --------779999769999999998742797069999999826749999999998199899997898927999969