HHsearch alignment for GI: 254780450 and conserved domain: PRK10701

>PRK10701 DNA-binding transcriptional regulator RstA; Provisional.
Probab=99.87  E-value=1.7e-21  Score=169.39  Aligned_cols=115  Identities=20%  Similarity=0.243  Sum_probs=102.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             69997698899999999999889899998998999899986599954899858788988899999999868998299990
Q gi|254780450|r  683 IVLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFIS  762 (803)
Q Consensus       683 ~iLvvdD~~~~~~~~~~~L~~~g~~v~~a~~g~eal~~~~~~~~~~dlil~D~~mp~m~G~~~~~~ir~~~~~~~ii~~t  762 (803)
T Consensus         3 kILlVEDd~~l~~~l~~~L~~~g~~v~~a~~g~~a~~~~~~~--~~DlvilDi~LP~~dG~~l~~~iR~~-~~~PiI~lt   79 (240)
T PRK10701          3 TIVFVEDDAEVGSLIAAYLAKHDIDVTVEPRGDRAEETILRE--QPDLVLLDIMLPGKDGMTICRDLRPK-WSGPIVLLT   79 (240)
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC--CCCEEEEECCCCCCCCCEEEEECCCC-CCCCEEEEE
T ss_conf             899997999999999999988799999989999999998617--99999992899767887876311025-898789994


Q ss_pred             CCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
Q ss_conf             67858998767605798075079799999999999851
Q gi|254780450|r  763 GYAEDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQ  800 (803)
Q Consensus       763 ~~~~~~~~~~~~~~~~~~~l~KP~~~~~L~~~i~~~L~  800 (803)
T Consensus        80 a~~~~~d~v~gl~~GADDYl~KPf~~~eL~aRi~a~lr  117 (240)
T PRK10701         80 SLDSDMNHILALEMGACDYILKTTPPAVLLARLRLHLR  117 (240)
T ss_pred             ECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             05757889999976887764179987999999999996