HHsearch alignment for GI: 254780450 and conserved domain: PRK11086

>PRK11086 sensory histidine kinase DcuS; Provisional.
Probab=98.24  E-value=0.00056  Score=45.99  Aligned_cols=115  Identities=10%  Similarity=0.043  Sum_probs=68.8

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCEEEEHHHHHHHCCCCH--HHHCCCCCCHHHHCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999985259619999299968976467986429996--78045632188808820489999998620026714888
Q gi|254780450|r  158 ELQNAIDYLDHSPVGFMSADHQGKILYINATLAEWIGIDL--TTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLD  235 (803)
Q Consensus       158 ~~~~~~~~le~a~~gi~~~D~~g~i~~~N~~~~~llG~~~--~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e  235 (803)
T Consensus       219 l~~er~aiL~s~~eGVIavD~~g~I~l~N~~A~~ll~~~~~~~~~~g--~~~~~~~~~~~---l~~vl~~---~-~~~~d  289 (541)
T PRK11086        219 LFEQRQAMLQSIKEGVIAVDDRGEVTLINDEAQRLFYKKGQEDDPLS--TDVHSWSPVSR---LKEVLRT---G-TPRRD  289 (541)
T ss_pred             HHHHHHHHHHHHHCEEEEECCCCEEEEECHHHHHHHCCCCCCCCCCC--CCHHHHCCCHH---HHHHHHC---C-CCCCE
T ss_conf             99999999853001699975898799984999987433588743125--51777275455---9999844---8-85310


Q ss_pred             EEEEEEECCEEEEEEEEEEEEECCCCCEEEEEEEEEEHHHHHHHHHHHHHH
Q ss_conf             999980489799999955676538885547999998607899999999999
Q gi|254780450|r  236 LDLRRIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIA  286 (803)
Q Consensus       236 ~~~~~~~~g~~~~v~~~~~~~~~~~G~~~~~~~~~~Dit~~k~~e~~l~~s  286 (803)
T Consensus       290 ~e~--~~~~~~l~~~--~~pi~-~~g~~~G~V~~~rD~TE~~~L~~~L~~v  335 (541)
T PRK11086        290 EEI--NINGRLLLTN--TVPVR-VNGEIIGAISTFRDKTEVRQLAQRLDGV  335 (541)
T ss_pred             EEE--EECCEEEEEE--EEEEE-ECCEEEEEEEEEECHHHHHHHHHHHHHH
T ss_conf             799--9899899999--77765-4890689999984427899999999999