BLAST/PSIBLAST alignment of GI: 254780450 and GI: 209549555 at iteration 1
>gi|209549555|ref|YP_002281472.1| multi-sensor hybrid histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 867
>gi|209535311|gb|ACI55246.1| multi-sensor hybrid histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 867
 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/814 (61%), Positives = 633/814 (77%), Gaps = 18/814 (2%)

Query: 1   MLAIVGILLLLLLAIGSIE-MTIKPKIPLETIFMDSEPEGILITNERGHIIYANNAYNAL 59
           +LA+VGI  L+   IG IE M  +    L   F++S P+G LIT+E+G IIYAN AY AL
Sbjct: 59  VLAMVGIFFLVSSVIGFIEVMPQRQSDSLARAFLNSHPDGTLITDEKGRIIYANAAYGAL 118

Query: 60  TNAVWNKRTKSLESLLSRNQEASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQNSEPHW 119
           T A      ++LE+LLSR++E++EALYRL+N LR   EG EEFRL++++   S +S  HW
Sbjct: 119 TGARKATEVQTLETLLSRHRESNEALYRLVNGLREGKEGREEFRLLRAVGPGSNSSGAHW 178

Query: 120 YRLKARVLPISLHKEKLLYAWRITDITSERKDQEKFFRELQNAIDYLDHSPVGFMSADHQ 179
           YRLKAR+L    +  K L  W+ITDIT+ER DQE+FF+ELQNAIDYLDH+P GF SA  +
Sbjct: 179 YRLKARLLQPEENGGKPLQIWQITDITTERDDQERFFKELQNAIDYLDHAPAGFFSAGRK 238

Query: 180 GKILYINATLAEWIGIDLTTFTSKSISIGDITAGEGLALIQAIRTEPSHQKITTLDLDLR 239
           G+I Y+NATLAEW+G+DLT F   S++IGD+ AGEGLALIQ+++ EP  +K  TLDLDLR
Sbjct: 239 GEIFYLNATLAEWLGLDLTKFVPGSMTIGDVVAGEGLALIQSVQAEPGLKKTVTLDLDLR 298

Query: 240 RIDNGHGIPVKIVHHILASCDGKPGESRTVVVSRKNCDSGDPSGTIANMRFNRFFNNIPM 299
           +  NG  +PV+I+H + +  DG PGESRT+V+ R+  ++G  S + A MRF RFFNN PM
Sbjct: 299 KT-NGQSLPVQIIHSVTSMRDGAPGESRTIVLGREKSEAGGQSASAAAMRFTRFFNNTPM 357

Query: 300 AIASIDKKGRILRTNAHFLKLFPNCTEGDG--TSNDIFSIVHKNEKRKIIAALYDANDQK 357
           AIAS+D +GRILRTNA FLKLF      D    +  + +IV ++++ ++  AL  A D++
Sbjct: 358 AIASVDGEGRILRTNAPFLKLFSGVVSRDDLEKAPHLETIVQESDRPQLAEALAAAKDRQ 417

Query: 358 SDISPIDSPHPQDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKL 417
            DI+P+D+  P DE RYFRFY++A +D+S EAPEE AI+Y VE+TEQKALEA+MAQTQK+
Sbjct: 418 GDIAPLDTRTPTDEARYFRFYVNAVIDQSDEAPEEAAIVYAVEVTEQKALEAQMAQTQKM 477

Query: 418 NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLL 477
           NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQ+R +DASFADLMEIK NANRAA+LVRQLL
Sbjct: 478 NAVGTLAGGIAHDFNNVLTAILLSSDHLLLQARPADASFADLMEIKRNANRAAVLVRQLL 537

Query: 478 AFSRKQTMRLTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDYERDLWGVKTDLSQFEQVL 537
           AFSRKQTMR +VLNLT+V+G+LRM++ +L+S    VKL V Y RDLW VKTDLSQFEQVL
Sbjct: 538 AFSRKQTMRPSVLNLTDVVGDLRMLVDRLLSG-TNVKLDVQYGRDLWPVKTDLSQFEQVL 596

Query: 538 VNLCVNAHHAIMLKESGSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDI 597
           +NLCVNA  A  + E G+LT+RTRN+ + E+  FNYS +P +DMVL+EV D G G++P+I
Sbjct: 597 INLCVNARDA--MPEGGTLTLRTRNLTAAEVSAFNYSYMPAEDMVLIEVADNGTGIAPEI 654

Query: 598 MEKIFEPFFTTKKVGEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLPRYVQEHT 657
           M+KIFEPFFTTK VG+GTGLGL++VYGI++QSGGYI PESEVGKGT FR+FLPR++ E  
Sbjct: 655 MDKIFEPFFTTKDVGKGTGLGLAMVYGIVKQSGGYIQPESEVGKGTTFRVFLPRHIPEPA 714

Query: 658 QESHYS------HDIAIIPQ----EEPADLTGNSAIVLLVEDEDSVRRGSKRMLETRGYT 707
             +          +I + P+    ++P DLTG SA++LLVEDE++VRRG KRMLETRGYT
Sbjct: 715 VAAEAGAIDSAVAEIGLRPEAPTAQQPEDLTG-SAVILLVEDEEAVRRGGKRMLETRGYT 773

Query: 708 VHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGPTLLRELRKTYPSLKFIFISGYAED 767
           VHEA SG +AL +ME+L G+VDIV+SDVVMPEMDGPTLLRELRKTYP +KFIF+SGYAED
Sbjct: 774 VHEAGSGVEALSIMEELDGKVDIVVSDVVMPEMDGPTLLRELRKTYPDMKFIFVSGYAED 833

Query: 768 AFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQS 801
           AF++NLP ++KF FL KPFSLKQLA  V E L S
Sbjct: 834 AFARNLPPESKFGFLPKPFSLKQLAVVVKETLDS 867