RPSBLAST alignment for GI: 254780450 and conserved domain: cd00082

>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.. Length = 65
 Score = 46.1 bits (110), Expect = 4e-05
 Identities = 18/65 (27%), Positives = 27/65 (41%)

Query: 417 LNAVGTLAGGIAHDFNNVLTAILLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQL 476
           L A G     ++H+    LTAI  + + L  +    +     L  I+  A R   L+  L
Sbjct: 1   LQAKGEFLANVSHELRTPLTAIRGALELLEEELLDDEEQREYLERIREEAERLLRLINDL 60

Query: 477 LAFSR 481
           L  SR
Sbjct: 61  LDLSR 65