RPSBLAST alignment for GI: 254780450 and conserved domain: COG5002

>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms]. Length = 459
 Score = 66.9 bits (163), Expect = 2e-11
 Identities = 70/297 (23%), Positives = 120/297 (40%), Gaps = 47/297 (15%)

Query: 369 QDENRYFRFYISATLDRSTEAPEEQAILYTVEITEQKALEARMAQTQKLNAVGTLAGGIA 428
            DE   +   ++ ++ +         I    ++TEQ+ +E    +             ++
Sbjct: 183 SDEEEGYVLRVNFSVIQRESGFISGLIAVLHDVTEQEKVERERRE---------FVANVS 233

Query: 429 HDFNNVLTAI---LLSSDHLLLQSRSSDASFADLMEIKHNANRAAILVRQLLAFSRKQTM 485
           H+    LT++   L + +    + +     F  L    +   R   LV  LL  SR    
Sbjct: 234 HELRTPLTSMKSYLEALEEGAWEDKEIAPRF--LRVTLNETERMIRLVNDLLQLSRMDNA 291

Query: 486 R----LTVLNLTEVIGNLRMMIQKLISEPPQVKLTVDY-ERDLWGVKTDLSQFEQVLVNL 540
           R       +N T  +  +    + ++ +    +   D  ++D+W V+ D  +  QVL N+
Sbjct: 292 RYQLNKEWINFTAFLNEIINRFEMILKKETIARFVRDIPKQDIW-VEIDPDKMTQVLDNI 350

Query: 541 CVNAHHAIMLKES---GSLTVRTRNIPSTEIHTFNYSDLPTKDMVLVEVEDTGIGMSPDI 597
             NA     LK S   G +TV  +                 +  V + + D G+G+  + 
Sbjct: 351 ISNA-----LKYSPDGGRITVSVKQ---------------RETWVEISISDQGLGIPKED 390

Query: 598 MEKIFEPFFTTKKV----GEGTGLGLSVVYGIIRQSGGYILPESEVGKGTIFRIFLP 650
           +EKIF+ F+   K       GTGLGL++   I++  GG I  ESE GKGT F   LP
Sbjct: 391 LEKIFDRFYRVDKARSRKMGGTGLGLAIAKEIVQAHGGRIWAESEEGKGTTFSFTLP 447