RPSBLAST alignment for GI: 254780451 and conserved domain: cd01584

>gnl|CDD|153134 cd01584, AcnA_Mitochondrial, Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members. Length = 412
 Score =  170 bits (432), Expect = 2e-42
 Identities = 137/488 (28%), Positives = 212/488 (43%), Gaps = 88/488 (18%)

Query: 88  RVLMQDFTGVPAVVDLAAMRDAIVVLGGDPQNINPLVPVDLVIDHSLIVDYSGNKDAVTR 147
           RV MQD T   A++   +         G P+     VP  +  DH LI    G +  + R
Sbjct: 1   RVAMQDATAQMALLQFMS--------SGLPK---VAVPSTIHCDH-LIEAQVGGEKDLKR 48

Query: 148 NKDLEYQRNEERYRFL-----KWGQKSFKNFRVVPPGTGICHQINLEYLGQSVWTKNENG 202
            KD+    N+E Y FL     K+G   +K      PG+GI HQI LE             
Sbjct: 49  AKDI----NKEVYDFLASAGAKYGIGFWK------PGSGIIHQIVLE------------- 85

Query: 203 ENIAYPDTC-VGTDSHTTMINALGILGWGVGGIEAEAAMLGCPISMLLPEVVGFEVTGSL 261
            N A+P    +GTDSHT     LG +  GVGG +A   M G P  +  P+V+G ++TG L
Sbjct: 86  -NYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKL 144

Query: 262 QEGVTATDLVLTITQMLRKEGVVSKFVEFFGSGFESMVLADRATIANMAPEYGATCGFFP 321
               +  D++L +  +L  +G     VE+FG G +S+      TI NM  E GAT   FP
Sbjct: 145 SGWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFP 204

Query: 322 VDRGTIDYLRLSGRSNSRVDLVEAYTKVQGMWREDIDYEKVAFTKKMKLDLGNVSPSVAG 381
            +     YL+ +GR+    DL + +     +  E  +Y+++     ++++L  + P + G
Sbjct: 205 YNERMKKYLKATGRAEI-ADLADEFKDDLLVADEGAEYDQL-----IEINLSELEPHING 258

Query: 382 PRRPESRLSLSEVPSSFVTEMNEYYKKSHTLDEKYPVKGCDFHLKHGDVAIASITSCTNT 441
           P  P+    +S+              K       +P+          D+ +  I SCTN+
Sbjct: 259 PFTPDLATPVSKF-------------KEVAEKNGWPL----------DLRVGLIGSCTNS 295

Query: 442 FNPSVMIGAGLLARNAVRAGLKSKPWVKTSCAPGSQVSYEYLVQAGLVEYLEALGFSLVG 501
            +   M  A  +A+ A+  GLK K     +  PGS+     + + GL++     G  ++ 
Sbjct: 296 -SYEDMGRAASIAKQALAHGLKCK--SIFTITPGSEQIRATIERDGLLQTFRDAGGIVLA 352

Query: 502 FGCTTCIGN---SGALKKEISEVIHQKSLVVAGVLSGNRNFEGRISPDVEA-NYLLSPPL 557
             C  CIG        K E + ++           S NRNF GR   +     ++ SP +
Sbjct: 353 NACGPCIGQWDRKDIKKGEKNTIVT----------SYNRNFTGRNDANPATHAFVASPEI 402

Query: 558 VVAYALAG 565
           V A A+AG
Sbjct: 403 VTAMAIAG 410