RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780452|ref|YP_003064865.1| hypothetical protein CLIBASIA_01685 [Candidatus Liberibacter asiaticus str. psy62] (259 letters) >gnl|CDD|182469 PRK10447, PRK10447, HflBKC-binding inner membrane protein; Provisional. Length = 219 Score = 35.6 bits (82), Expect = 0.015 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 9/114 (7%) Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204 TA F S Y TT++D+ +G ++ G + + + N+F++ A+ L +SA+ ++I Sbjct: 113 TALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILIS 172 Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258 S ++T I + E + + LY+ IFV LL LG Sbjct: 173 SGAILFETSNI---------IHGGETNYIRATVSLYVSLYNIFVSLLSILGFAS 217 >gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein. This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl. Length = 327 Score = 34.1 bits (79), Expect = 0.039 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Query: 42 VTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79 V+ I+ + +L T P+ A+ I++RG++LTG GAL+ Sbjct: 250 VSAIVEAVKEVLEKT-PPELAADIVDRGIVLTGGGALL 286 >gnl|CDD|184404 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional. Length = 335 Score = 32.4 bits (75), Expect = 0.13 Identities = 12/21 (57%), Positives = 18/21 (85%) Query: 59 PDAASIIINRGVMLTGFGALM 79 P+ A+ II+RG++LTG GAL+ Sbjct: 273 PELAADIIDRGIVLTGGGALL 293 >gnl|CDD|184402 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional. Length = 336 Score = 32.2 bits (74), Expect = 0.16 Identities = 10/22 (45%), Positives = 19/22 (86%) Query: 59 PDAASIIINRGVMLTGFGALMY 80 P+ ++ II+RG+++TG GAL++ Sbjct: 268 PELSADIIDRGIIMTGGGALLH 289 >gnl|CDD|184401 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional. Length = 334 Score = 30.8 bits (71), Expect = 0.37 Identities = 11/20 (55%), Positives = 17/20 (85%) Query: 59 PDAASIIINRGVMLTGFGAL 78 P+ A+ I++RG++LTG GAL Sbjct: 269 PELAADIVDRGIVLTGGGAL 288 >gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family. A close homolog is found in the Archaeon Methanobacterium thermoautotrophicum, and a more distant homolog in Archaeoglobus fulgidus. The family is related to cell division protein FtsA and heat shock protein DnaK. Length = 333 Score = 30.5 bits (69), Expect = 0.47 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 42 VTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79 V I+ + L T P+ A+ I+ RG++LTG GAL+ Sbjct: 256 VNQIVEAVKRTLEKT-PPELAADIVERGIVLTGGGALL 292 >gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional. Length = 335 Score = 29.9 bits (67), Expect = 0.75 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Query: 45 IMSFLVNILATTVD--PDAASIIINRGVMLTGFGALM 79 ++ L I AT D P+ + I++RGV+LTG GAL+ Sbjct: 255 LLHILEAIRATLEDCPPELSGDIVDRGVILTGGGALL 291 >gnl|CDD|151892 pfam11453, DUF2950, Protein of unknown function (DUF2950). This is a bacterial family of uncharacterized proteins. Length = 266 Score = 28.0 bits (63), Expect = 2.4 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 41 GVTGIMSFLVN 51 G TG+M+F+VN Sbjct: 223 GDTGVMTFIVN 233 >gnl|CDD|150933 pfam10337, DUF2422, Protein of unknown function (DUF2422). This is a family of proteins conserved in fungi. The function is not known. This family is the C-terminal half of some member proteins which contain the DUF2421 pfam10334 domain at their N-terminus. Length = 448 Score = 28.1 bits (63), Expect = 2.6 Identities = 19/141 (13%), Positives = 46/141 (32%), Gaps = 22/141 (15%) Query: 27 AYMIRVYNLMALGLGVTGIM-SFLVNILATTV------DPDAASIIINRGVMLTG----- 74 M ++A L + G+ ++ ++A + + +I G T Sbjct: 58 PGMPIAKFVLAALLLLLGVCIAWAWGVIAMKIANRARGQSITQADLIQAGACTTSVSLAA 117 Query: 75 ------FGALMYTSPLRWIFIFAPLGVFIFL--NVRLHSLSAYAAKMMFLLYSALIGLSL 126 F + + ++ L VFI+ +R + +A +F + +A + L+ Sbjct: 118 CAQQQVFDGRYLDARVSAVYAVW-LFVFIYFVGWLRAKN-PKFAFGYIFGIIAANVFLTY 175 Query: 127 SSFFLVYTSKSIVQTFFITAA 147 + ++ T Sbjct: 176 GPLLPTFAPGTLGLTLLKPMG 196 >gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional. Length = 244 Score = 27.0 bits (60), Expect = 4.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 210 YDTQKIKEAYSDRYDVAYAERQSVIGAL 237 Y+ + E +S Y+V Y E S++ AL Sbjct: 14 YNPEVDTEPHSQTYEVPYDETTSLLDAL 41 >gnl|CDD|149229 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain. Length = 148 Score = 26.5 bits (59), Expect = 6.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 35 LMALGLGVTGIMSFLVNILATTVDPDAASI 64 L+A G G+T +S L +++ + SI Sbjct: 6 LVAGGSGITPFISILRDLINKSKKNTLKSI 35 >gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional. Length = 257 Score = 26.5 bits (59), Expect = 6.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 66 INRGVMLTGFGALMYTSPLRW 86 +N G LTGF M +P RW Sbjct: 173 VNPGPYLTGFNDTMAETPKRW 193 >gnl|CDD|180807 PRK07046, PRK07046, aminotransferase; Validated. Length = 453 Score = 26.1 bits (58), Expect = 8.4 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Query: 58 DPDAASII----INRGVMLTGFGALMYTSP 83 DP+ + + +NRGV++T F +M P Sbjct: 401 DPELEAALHLYLLNRGVLITPFHNMMLVCP 430 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.331 0.142 0.405 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,191,692 Number of extensions: 274152 Number of successful extensions: 880 Number of sequences better than 10.0: 1 Number of HSP's gapped: 871 Number of HSP's successfully gapped: 115 Length of query: 259 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 168 Effective length of database: 4,028,145 Effective search space: 676728360 Effective search space used: 676728360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 56 (25.3 bits)