RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780452|ref|YP_003064865.1| hypothetical protein
CLIBASIA_01685 [Candidatus Liberibacter asiaticus str. psy62]
         (259 letters)



>gnl|CDD|182469 PRK10447, PRK10447, HflBKC-binding inner membrane protein;
           Provisional.
          Length = 219

 Score = 35.6 bits (82), Expect = 0.015
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA  F   S Y  TT++D+  +G  ++ G   + +  + N+F++  A+ L +SA+ ++I 
Sbjct: 113 TALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILIS 172

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           S    ++T  I         +   E   +   + LY+    IFV LL  LG   
Sbjct: 173 SGAILFETSNI---------IHGGETNYIRATVSLYVSLYNIFVSLLSILGFAS 217


>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein.  This family consists of
           bacterial MreB and Mbl proteins as well as two related
           archaeal sequences. MreB is known to be a rod
           shape-determining protein in bacteria and goes to make
           up the bacterial cytoskeleton. Genes coding for MreB/Mbl
           are only found in elongated bacteria, not in coccoid
           forms. It has been speculated that constituents of the
           eukaryotic cytoskeleton (tubulin, actin) may have
           evolved from prokaryotic precursor proteins closely
           related to today's bacterial proteins FtsZ and MreB/Mbl.
          Length = 327

 Score = 34.1 bits (79), Expect = 0.039
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 42  VTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           V+ I+  +  +L  T  P+ A+ I++RG++LTG GAL+
Sbjct: 250 VSAIVEAVKEVLEKT-PPELAADIVDRGIVLTGGGALL 286


>gnl|CDD|184404 PRK13930, PRK13930, rod shape-determining protein MreB;
           Provisional.
          Length = 335

 Score = 32.4 bits (75), Expect = 0.13
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 59  PDAASIIINRGVMLTGFGALM 79
           P+ A+ II+RG++LTG GAL+
Sbjct: 273 PELAADIIDRGIVLTGGGALL 293


>gnl|CDD|184402 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.
          Length = 336

 Score = 32.2 bits (74), Expect = 0.16
 Identities = 10/22 (45%), Positives = 19/22 (86%)

Query: 59  PDAASIIINRGVMLTGFGALMY 80
           P+ ++ II+RG+++TG GAL++
Sbjct: 268 PELSADIIDRGIIMTGGGALLH 289


>gnl|CDD|184401 PRK13927, PRK13927, rod shape-determining protein MreB;
           Provisional.
          Length = 334

 Score = 30.8 bits (71), Expect = 0.37
 Identities = 11/20 (55%), Positives = 17/20 (85%)

Query: 59  PDAASIIINRGVMLTGFGAL 78
           P+ A+ I++RG++LTG GAL
Sbjct: 269 PELAADIVDRGIVLTGGGAL 288


>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family.
           A close homolog is found in the Archaeon
           Methanobacterium thermoautotrophicum, and a more distant
           homolog in Archaeoglobus fulgidus. The family is related
           to cell division protein FtsA and heat shock protein
           DnaK.
          Length = 333

 Score = 30.5 bits (69), Expect = 0.47
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 42  VTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           V  I+  +   L  T  P+ A+ I+ RG++LTG GAL+
Sbjct: 256 VNQIVEAVKRTLEKT-PPELAADIVERGIVLTGGGALL 292


>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH;
           Provisional.
          Length = 335

 Score = 29.9 bits (67), Expect = 0.75
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 45  IMSFLVNILATTVD--PDAASIIINRGVMLTGFGALM 79
           ++  L  I AT  D  P+ +  I++RGV+LTG GAL+
Sbjct: 255 LLHILEAIRATLEDCPPELSGDIVDRGVILTGGGALL 291


>gnl|CDD|151892 pfam11453, DUF2950, Protein of unknown function (DUF2950).  This is
           a bacterial family of uncharacterized proteins.
          Length = 266

 Score = 28.0 bits (63), Expect = 2.4
 Identities = 7/11 (63%), Positives = 10/11 (90%)

Query: 41  GVTGIMSFLVN 51
           G TG+M+F+VN
Sbjct: 223 GDTGVMTFIVN 233


>gnl|CDD|150933 pfam10337, DUF2422, Protein of unknown function (DUF2422).  This is
           a family of proteins conserved in fungi. The function is
           not known. This family is the C-terminal half of some
           member proteins which contain the DUF2421 pfam10334
           domain at their N-terminus.
          Length = 448

 Score = 28.1 bits (63), Expect = 2.6
 Identities = 19/141 (13%), Positives = 46/141 (32%), Gaps = 22/141 (15%)

Query: 27  AYMIRVYNLMALGLGVTGIM-SFLVNILATTV------DPDAASIIINRGVMLTG----- 74
             M     ++A  L + G+  ++   ++A  +           + +I  G   T      
Sbjct: 58  PGMPIAKFVLAALLLLLGVCIAWAWGVIAMKIANRARGQSITQADLIQAGACTTSVSLAA 117

Query: 75  ------FGALMYTSPLRWIFIFAPLGVFIFL--NVRLHSLSAYAAKMMFLLYSALIGLSL 126
                 F      + +  ++    L VFI+    +R  +   +A   +F + +A + L+ 
Sbjct: 118 CAQQQVFDGRYLDARVSAVYAVW-LFVFIYFVGWLRAKN-PKFAFGYIFGIIAANVFLTY 175

Query: 127 SSFFLVYTSKSIVQTFFITAA 147
                 +   ++  T      
Sbjct: 176 GPLLPTFAPGTLGLTLLKPMG 196


>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit;
           Provisional.
          Length = 244

 Score = 27.0 bits (60), Expect = 4.9
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query: 210 YDTQKIKEAYSDRYDVAYAERQSVIGAL 237
           Y+ +   E +S  Y+V Y E  S++ AL
Sbjct: 14  YNPEVDTEPHSQTYEVPYDETTSLLDAL 41


>gnl|CDD|149229 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain. 
          Length = 148

 Score = 26.5 bits (59), Expect = 6.7
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 35 LMALGLGVTGIMSFLVNILATTVDPDAASI 64
          L+A G G+T  +S L +++  +      SI
Sbjct: 6  LVAGGSGITPFISILRDLINKSKKNTLKSI 35


>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional.
          Length = 257

 Score = 26.5 bits (59), Expect = 6.8
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 66  INRGVMLTGFGALMYTSPLRW 86
           +N G  LTGF   M  +P RW
Sbjct: 173 VNPGPYLTGFNDTMAETPKRW 193


>gnl|CDD|180807 PRK07046, PRK07046, aminotransferase; Validated.
          Length = 453

 Score = 26.1 bits (58), Expect = 8.4
 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 4/30 (13%)

Query: 58  DPDAASII----INRGVMLTGFGALMYTSP 83
           DP+  + +    +NRGV++T F  +M   P
Sbjct: 401 DPELEAALHLYLLNRGVLITPFHNMMLVCP 430


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.331    0.142    0.405 

Gapped
Lambda     K      H
   0.267   0.0744    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 4,191,692
Number of extensions: 274152
Number of su