RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780453|ref|YP_003064866.1| orotidine 5'-phosphate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] (238 letters) >gnl|CDD|30632 COG0284, PyrF, Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism]. Length = 240 Score = 196 bits (500), Expect = 4e-51 Identities = 93/225 (41%), Positives = 132/225 (58%), Gaps = 3/225 (1%) Query: 12 KKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMK 71 +RL+V LD+PT +EA V L TV F K+G L G ++ +L + GK VFLD+K Sbjct: 11 SRRLIVALDVPTEEEALAFVDKLGPTVDFVKVGKPLVAFFGADILEELKARGKKVFLDLK 70 Query: 72 LFDIGSSVTAAIEHIANMGVAMLTVHAYP--QTMRSAVSVVRDTGICLLAVTVLTSMDDF 129 L DI ++V A + A++G +TVHA+ +R+A + G +LAVT LTSM + Sbjct: 71 LADIPNTVALAAKAAADLGADAVTVHAFGGFDMLRAAKEALEAGGPFVLAVTSLTSMGEL 130 Query: 130 DLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGS 189 L E G + + V A A + G+ G+VCS +EV +REI+G + +I+TPGI GS Sbjct: 131 QLAELGINSSLEEQVLRLAKLAGEAGLDGVVCSAEEVAAIREILGPDFLILTPGIGA-GS 189 Query: 190 ATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAI 234 Q R TP A++ GA +IVV RPI +A DPV+AA+ R I Sbjct: 190 QGGDQGRVMTPGEAVRAGADYIVVGRPITQAGDPVAAARAIAREI 234 >gnl|CDD|73387 cd04725, OMP_decarboxylase_like, Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway. In mammals, UMP synthase contains two domains: the orotate phosphoribosyltransferase (OPRTase) domain that catalyzes the transfer of phosphoribosyl 5'-pyrophosphate (PRPP) to orotate to form OMP, and the orotidine-5'-phosphate decarboxylase (ODCase) domain that decarboxylates OMP to form UMP.. Length = 216 Score = 190 bits (485), Expect = 2e-49 Identities = 87/218 (39%), Positives = 125/218 (57%), Gaps = 4/218 (1%) Query: 15 LVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKLFD 74 L+V LD P + A ++ L V K+G L + G E+ ++L G VFLD+KL D Sbjct: 1 LIVALDPPDEEFALALIDALGPYVCAVKVGLELFEAAGPEIVKELRELGFLVFLDLKLGD 60 Query: 75 IGSSVTAAIEHIANMGVAMLTVHAYP--QTMRSAVSVVRDTGICLLAVTVLTSMDDFDLR 132 I ++V AA E + +G +TVH Y +++A+ + G L AVTVL+S DL+ Sbjct: 61 IPNTVAAAAEALLGLGADAVTVHPYGGSDMLKAALEAAEEKGKGLFAVTVLSSPGALDLQ 120 Query: 133 ESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATD 192 E G + D+V A AR+ G+ G+VC E +R +G + +I+TPGI GS D Sbjct: 121 E-GIPGSLEDLVERLAKLAREAGVDGVVCGATEPEALRRALGPDFLILTPGIGAQGSGDD 179 Query: 193 GQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEF 230 QKR TPE A++ GA +IVV RPI +AADPV+AA+ Sbjct: 180 -QKRGGTPEDAIRAGADYIVVGRPITQAADPVAAAEAI 216 >gnl|CDD|143972 pfam00215, OMPdecase, Orotidine 5'-phosphate decarboxylase / HUMPS family. This family includes Orotidine 5'-phosphate decarboxylase enzymes EC:4.1.1.23 that are involved in the final step of pyrimidine biosynthesis. The family also includes enzymes such as hexulose-6-phosphate synthase. This family appears to be distantly related to pfam00834. Length = 218 Score = 169 bits (429), Expect = 8e-43 Identities = 80/221 (36%), Positives = 117/221 (52%), Gaps = 6/221 (2%) Query: 13 KRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMKL 72 L V LD+PT++EA + L V K+G L + GL+L +L G +FLD+K Sbjct: 1 PNLCVALDVPTLEEALELADELGPYVDIIKVGTPLFEAFGLKLVAELRKHGFLIFLDLKF 60 Query: 73 FDIGSSVTAAIEHIANMGVAMLTVHAYP--QTMRSAVSVVRDTGI-CLLAVTVLTSMDDF 129 DIG++V ++ A +G ++TVHAY T+++A + G LL V L+S Sbjct: 61 ADIGNTVAKQAKYKAKLGADIVTVHAYAGDGTLKAAKEAAEEYGGRGLLLVAELSSKGSL 120 Query: 130 DLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGS 189 DL+E G ++V A A G+ G+V S E +REI + +I+TPGI + G Sbjct: 121 DLQEEGDLGYTQEIVHRAADLA--AGVDGVVASATEPEALREIRP-DFLILTPGIGLQGG 177 Query: 190 ATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEF 230 GQ+R TP A + GA I+V R I A DPV+AA+ Sbjct: 178 DAGGQQRVTTPAVAKEAGADIIIVGRGITGAGDPVAAARAI 218 >gnl|CDD|73388 cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS). KGPDC catalyzes the formation of L-xylulose 5-phosphate and carbon dioxide from 3-keto-L-gulonate 6-phosphate as part of the anaerobic pathway for L-ascorbate utilization in some eubacteria. HPS catalyzes the formation of D-arabino-3-hexulose-6-phosphate from D-ribulose 5-phosphate and formaldehyde in microorganisms that can use formaldehyde as a carbon source. Both catalyze reactions that involve the Mg2+-assisted formation and stabilization of 1,2-enediolate reaction intermediates.. Length = 202 Score = 52.5 bits (126), Expect = 1e-07 Identities = 56/219 (25%), Positives = 88/219 (40%), Gaps = 22/219 (10%) Query: 15 LVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDL--ISDGKSVFLDMKL 72 L V LDL ++EA + + D V + G L S G+E R L K + D+K Sbjct: 3 LQVALDLLDLEEALELAKKVPDGVDIIEAGTPLIKSEGMEAVRALREAFPDKIIVADLKT 62 Query: 73 FDIGS-SVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDL 131 D G+ A + A++ + T++ AV + G L ++D + Sbjct: 63 ADAGALEAEMAFKAGADIVTVLGAAPL--STIKKAVKAAKKYGK--EVQVDLIGVEDPEK 118 Query: 132 RESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSAT 191 R + K D+V + D G +++ V++++G V V GI Sbjct: 119 R-AKLLKLGVDIVILHR--GIDAQAAGGWWPEDDLKKVKKLLG-VKVAVAGGITP----- 169 Query: 192 DGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEF 230 T K GA ++V R I AADP AA+EF Sbjct: 170 ------DTLPEFKKAGADIVIVGRAITGAADPAEAAREF 202 >gnl|CDD|30618 COG0269, SgbH, 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]. Length = 217 Score = 52.1 bits (125), Expect = 1e-07 Identities = 53/227 (23%), Positives = 90/227 (39%), Gaps = 27/227 (11%) Query: 15 LVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLIS--DGKSVFLDMKL 72 L V LDL ++EA I ++D V ++G L + G+ R L K + D+K Sbjct: 6 LQVALDLLDLEEAIEIAEEVADYVDIIEVGTPLIKAEGMRAVRALRELFPDKIIVADLKT 65 Query: 73 FDIGS-SVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAVTVLTSMDDFDL 131 D G+ A E A+ + T++ A+ V ++ G L + D + Sbjct: 66 ADAGAIEARMAFEAGADWVTVLGAAD--DATIKKAIKVAKEYGK--EVQIDLIGVWDPEQ 121 Query: 132 RESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVI-VTPGIRMLGSA 190 R ++ D V + + RD G ++ ++++ + V GI Sbjct: 122 RAKWLKELGVDQVILH--RGRDAQAAGKSWGEDDLEKIKKLSDLGAKVAVAGGI------ 173 Query: 191 TDGQKRFATPETALKY---GASHIVVSRPIVRAADPVSAAQEFQRAI 234 TPE + GA ++V R I A DP AA++F+ I Sbjct: 174 --------TPEDIPLFKGIGADIVIVGRAITGAKDPAEAARKFKEEI 212 >gnl|CDD|32205 COG2022, ThiG, Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]. Length = 262 Score = 31.7 bits (72), Expect = 0.17 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 11/81 (13%) Query: 154 IGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVV 213 IG G + +P + ++ E VIV GI G+ +D A++ GA +++ Sbjct: 162 IGSGLGLQNPYNLEIIIEEADVP-VIVDAGI---GTPSDAA-------QAMELGADAVLL 210 Query: 214 SRPIVRAADPVSAAQEFQRAI 234 + I RA DPV+ A+ F A+ Sbjct: 211 NTAIARAKDPVAMARAFALAV 231 >gnl|CDD|107215 cd06459, M3B_Oligoendopeptidase_F, Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid. Length = 427 Score = 29.1 bits (66), Expect = 1.00 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%) Query: 38 VSFYKIGYHLSFSGGLELARDLISDGKSVFLD--MKLFDIGSSVTAAIEHIANMGVAMLT 95 V FY Y L L DG+ ++ ++L G S + +E + GV + + Sbjct: 358 VPFYVYPYAFGQLAALALYAKYKEDGEG-AVEKYLELLKAGGSKS-PLELLKKAGVDLTS 415 Query: 96 VHAYPQTMRSAVSVVR 111 P A+ V+ Sbjct: 416 ----PDFWEEAIDVIE 427 >gnl|CDD|147701 pfam05690, ThiG, Thiazole biosynthesis protein ThiG. This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway. Length = 246 Score = 29.1 bits (66), Expect = 1.0 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 10/57 (17%) Query: 178 VIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAI 234 VIV GI G+ +D A A++ GA ++++ I RA DPV+ A+ F+ A+ Sbjct: 177 VIVDAGI---GTPSD-----AA--QAMELGADAVLLNTAIARAKDPVAMARAFKLAV 223 >gnl|CDD|73390 cd04728, ThiG, Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism. ThiG catalyzes the formation of thiazole from 1-deoxy-D-xylulose 5-phosphate (DXP) and dehydroglycine, with the help of the sulfur carrier protein ThiS that carries the sulfur needed for thiazole assembly on its carboxy terminus (ThiS-COSH).. Length = 248 Score = 28.9 bits (65), Expect = 1.2 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 11/81 (13%) Query: 154 IGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVV 213 IG G + +P +R++ E VIV GI G+ +D + A++ GA +++ Sbjct: 155 IGSGQGLLNPYNLRIIIERA-DVPVIVDAGI---GTPSDAAQ-------AMELGADAVLL 203 Query: 214 SRPIVRAADPVSAAQEFQRAI 234 + I +A DPV+ A+ F+ A+ Sbjct: 204 NTAIAKAKDPVAMARAFKLAV 224 >gnl|CDD|30701 COG0352, ThiE, Thiamine monophosphate synthase [Coenzyme metabolism]. Length = 211 Score = 28.3 bits (63), Expect = 1.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 201 ETALKYGASHIVVSRPIVRAADPVSAAQEFQRAI 234 L+ GA + V I AADP +AA+ + A+ Sbjct: 173 PEVLEAGADGVAVVSAITSAADPAAAAKALRNAL 206 >gnl|CDD|30053 cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.. Length = 251 Score = 28.2 bits (63), Expect = 2.2 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 14 RLVVGLDLP----TVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDG 63 L L+LP + E ++ IL + + +H FSG E A++L+ G Sbjct: 115 ELAKELNLPVVIHSRDAHEDVLEILKEYGPPKRGVFH-CFSGSAEEAKELLDLG 167 >gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 28.0 bits (62), Expect = 2.4 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 12/99 (12%) Query: 48 SFSGG----LELARDLISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTM 103 +FSGG L++AR+L++ + VF+D + SV A + + V L + Sbjct: 151 TFSGGMQQRLQIARNLVTRPRLVFMDEPTGGLDVSVQARLLDLLRGLVRELGL------- 203 Query: 104 RSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISD 142 + V V D + L L M + ESG + D Sbjct: 204 -AVVIVTHDLAVARLLADRLMVMKQGQVVESGLTDRVLD 241 >gnl|CDD|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.. Length = 299 Score = 27.3 bits (61), Expect = 3.8 Identities = 38/177 (21%), Positives = 57/177 (32%), Gaps = 52/177 (29%) Query: 80 TAAIEHIANMGVAMLTVHAY----PQTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESG 135 T ++E +A Y + + G L +TV D G Sbjct: 104 TTSLEEVAAAAPGPRWFQLYVPRDREITEDLLRRAEAAGYKALVLTV-------DTPVLG 156 Query: 136 YEKDISDMVRMR-----------------AVQARDIGMGGIVCS----------PQEVRM 168 D+ +R A++A D G GIV S P + Sbjct: 157 RRLTWDDLAWLRSQWKGPLILKGILTPEDALRAVDAGADGIVVSNHGGRQLDGAPATIDA 216 Query: 169 VREI---VGHNM-VIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAA 221 + EI VG + V++ GIR TD K AL GA +++ RP + Sbjct: 217 LPEIVAAVGGRIEVLLDGGIR---RGTDVLK-------ALALGADAVLIGRPFLYGL 263 >gnl|CDD|144356 pfam00723, Glyco_hydro_15, Glycosyl hydrolases family 15. Length = 416 Score = 27.0 bits (60), Expect = 4.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 110 VRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVR 145 VRD+ + +LA+ L D+ D E ++ ++R Sbjct: 42 VRDSALTILALLGLGYRDEADAFRYELETSLAKLMR 77 >gnl|CDD|73374 cd02812, PcrB_like, PcrB_like proteins. One member of this family, a protein from Archaeoglobus fulgidus, has been characterized as a (S)-3-O-geranylgeranylglyceryl phosphate synthase (AfGGGPS). AfGGGPS catalyzes the formation of an ether linkage between sn-glycerol-1-phosphate (G1P) and geranylgeranyl diphosphate (GGPP), the committed step in archaeal lipid biosynthesis. Therefore, it has been proposed that PcrB-like proteins are either prenyltransferases or are involved in lipoteichoic acid biosynthesis although the exact function is still unknown.. Length = 219 Score = 27.1 bits (60), Expect = 4.4 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 16/59 (27%) Query: 158 GIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASH---IVV 213 G P+ VR V++++G +IV GIR + E A + + IVV Sbjct: 158 GAYGPPEVVRAVKKVLGDTPLIVGGGIR-------------SGEQAKEMAEAGADTIVV 203 >gnl|CDD|146784 pfam04326, AAA_4, Divergent AAA domain. This family is related to the pfam00004 family, and presumably has the same function (ATP-binding). Length = 116 Score = 26.9 bits (60), Expect = 5.0 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 5 LIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVS 39 L+I VD+K VVG+D + + + + D + Sbjct: 33 LLIGVDDKGGEVVGIDDDQDDLLDLLRNAILDLIE 67 >gnl|CDD|37491 KOG2280, KOG2280, KOG2280, Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]. Length = 829 Score = 26.9 bits (59), Expect = 5.2 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 4/82 (4%) Query: 28 ERIVSILSDTVSFYKIGYHLSFSGGLELARDLI----SDGKSVFLDMKLFDIGSSVTAAI 83 E++ + L+ +S+ I G ELAR L+ G+ V L +K+ D ++ AI Sbjct: 498 EKLSAKLTPGISYAAIARRAYQEGRFELARKLLELEPRSGEQVPLLLKMKDSSLALKKAI 557 Query: 84 EHIANMGVAMLTVHAYPQTMRS 105 E + + +H + RS Sbjct: 558 ESGDTDLIIQVLLHLKNKLNRS 579 >gnl|CDD|35758 KOG0538, KOG0538, KOG0538, Glycolate oxidase [Energy production and conversion]. Length = 363 Score = 26.8 bits (59), Expect = 5.5 Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 24/85 (28%) Query: 148 AVQARDIGMGGIV----------CSPQEVRMVREIV----GHNMVIVTPGIRMLGSATDG 193 A +A + G+ GI+ P + + E+V G V + G+R TD Sbjct: 237 ARKAVEAGVAGIIVSNHGGRQLDYVPATIEALPEVVKAVEGRIPVFLDGGVR---RGTDV 293 Query: 194 QKRFATPETALKYGASHIVVSRPIV 218 K AL GA + + RPIV Sbjct: 294 LK-------ALALGAKGVFIGRPIV 311 >gnl|CDD|73367 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl) thiazole phosphate to yield thiamine phosphate. TenI is a enzymatically inactive regulatory protein involved in the regulation of several extracellular enzymes. This superfamily also contains other enzymatically inactive proteins with unknown functions.. Length = 196 Score = 26.7 bits (59), Expect = 5.8 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Query: 199 TPETA---LKYGASHIVVSRPIVRAADPVSAAQEFQR 232 TPE A L GA + V I A DP +AA+E Sbjct: 160 TPENAAEVLAAGADGVAVISAITGADDPAAAARELLA 196 >gnl|CDD|38321 KOG3111, KOG3111, KOG3111, D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]. Length = 224 Score = 26.4 bits (58), Expect = 6.3 Identities = 36/169 (21%), Positives = 66/169 (39%), Gaps = 26/169 (15%) Query: 63 GKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYP-QTMRSAVSVVRDTGICL-LAV 120 G F D+ + + + ++ +A G ++ T H Q V +R+ G+ + LA+ Sbjct: 62 GADPFFDVHM--MVENPEQWVDQMAKAGASLFTFHYEATQKPAELVEKIREKGMKVGLAL 119 Query: 121 TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQ---EVRMVREIVGHNM 177 T ++D + ++ V M V + G GG +V +RE + Sbjct: 120 KPGTPVEDLEPL--------AEHVDMVLVMTVEPGFGGQKFMEDMMPKVEWLREKYPNLD 171 Query: 178 VIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSA 226 + V G+ +T + A + GA+ IV + AADP Sbjct: 172 IEVDGGVGP-----------STIDKAAEAGANMIVAGSAVFGAADPSDV 209 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.136 0.376 Gapped Lambda K H 0.267 0.0785 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,719,854 Number of extensions: 140740 Number of successful extensions: 330 Number of sequences better than 10.0: 1 Number of HSP's gapped: 320 Number of HSP's successfully gapped: 29 Length of query: 238 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 147 Effective length of database: 4,297,318 Effective search space: 631705746 Effective search space used: 631705746 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.2 bits)