BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780453|ref|YP_003064866.1| orotidine 5'-phosphate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] (238 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780453|ref|YP_003064866.1| orotidine 5'-phosphate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 238 Score = 478 bits (1230), Expect = e-137, Method: Compositional matrix adjust. Identities = 238/238 (100%), Positives = 238/238 (100%) Query: 1 MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLI 60 MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLI Sbjct: 1 MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLI 60 Query: 61 SDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAV 120 SDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAV Sbjct: 61 SDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYPQTMRSAVSVVRDTGICLLAV 120 Query: 121 TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIV 180 TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIV Sbjct: 121 TVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNMVIV 180 Query: 181 TPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS 238 TPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS Sbjct: 181 TPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLIS 238 >gi|254781065|ref|YP_003065478.1| L-lysine 2,3-aminomutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 23.9 bits (50), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Query: 54 ELARDLISDGKSVFLDMKL---FDIGSSVTAAIEHIANMGVAMLT 95 EL + L GK V++ + ++ AAI +AN G+ +L+ Sbjct: 195 ELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLS 239 >gi|254781107|ref|YP_003065520.1| phosphoglucomutase [Candidatus Liberibacter asiaticus str. psy62] Length = 542 Score = 23.5 bits (49), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/46 (26%), Positives = 22/46 (47%) Query: 154 IGMGGIVCSPQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFAT 199 IG GGI+ +P ++R+ +I+T G+ D ++ T Sbjct: 83 IGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNT 128 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 23.5 bits (49), Expect = 3.2, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 184 IRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADP 223 +R + + + GQ+ A ++ +GA I++S P V ADP Sbjct: 209 MRYIANRSSGQQGHAIAKSLAYFGAEVILISGP-VSIADP 247 >gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Score = 23.1 bits (48), Expect = 4.9, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 115 ICLLAVTVLTSMDDFDLRESGYEKDISDMVR 145 +C + T S + +LR++G+ DI D+VR Sbjct: 83 LCRIKNTWNMSFRN-ELRDNGFVNDIDDIVR 112 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.136 0.376 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 138,864 Number of Sequences: 1233 Number of extensions: 5140 Number of successful extensions: 10 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 5 length of query: 238 length of database: 328,796 effective HSP length: 71 effective length of query: 167 effective length of database: 241,253 effective search space: 40289251 effective search space used: 40289251 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)