BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus str. psy62] (385 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 385 Score = 783 bits (2022), Expect = 0.0, Method: Compositional matrix adjust. Identities = 385/385 (100%), Positives = 385/385 (100%) Query: 1 MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60 MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS Sbjct: 1 MKITVERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPEIEITGAIPAS 60 Query: 61 VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120 VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS Sbjct: 61 VDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISHGDSNFYLQSFPESEFPS 120 Query: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR Sbjct: 121 TKEEEYVYSFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHR 180 Query: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR Sbjct: 181 LAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVSLSESRIHLNIESLSMSVR 240 Query: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD Sbjct: 241 LIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD 300 Query: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR Sbjct: 301 NPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR 360 Query: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385 GKDKDSKNNKDNKVNAFYVLMPMRI Sbjct: 361 GKDKDSKNNKDNKVNAFYVLMPMRI 385 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 26.6 bits (57), Expect = 0.71, Method: Compositional matrix adjust. Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 22/100 (22%) Query: 153 IRYYLNGIFFHINEEDLKLCAVA---TDGHRLAVAEVDIVAQIAKMPSIIVP-RKAVGEI 208 + +YLN IFF N + A+ L + E +A + K PS P RK I Sbjct: 168 LEFYLNEIFFGFNSYGIASAALTYFNKSVSELTIEEAAYLAALPKGPSNYDPFRKNKAAI 227 Query: 209 LR------------------ILSSKDSSVKVSLSESRIHL 230 R L +K +K+++ + R HL Sbjct: 228 ARRNWVIDRMEENGYISQEQALVAKQKPLKITIKQRRSHL 267 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 25.4 bits (54), Expect = 1.7, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 8/67 (11%) Query: 165 NEEDLKLCAVATDGHRLAVAE--VDIVAQIAKMPSIIVPRKAVGEILRILSSKDSSVKVS 222 N E+ ++ A+A H L E + ++A AK R + + L KDS V+ + Sbjct: 1492 NPEEARVIALAVKDHALRYPEESLGVIAMNAKQ------RDLIESTINKLCRKDSEVEKA 1545 Query: 223 LSESRIH 229 +S+ R+H Sbjct: 1546 ISKLRMH 1552 >gi|254780775|ref|YP_003065188.1| undecaprenyl diphosphate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Score = 25.0 bits (53), Expect = 2.2, Method: Compositional matrix adjust. Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 10/62 (16%) Query: 281 VRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEI---IDNIS 337 VR+ +LSL D LC+ + D + +N++ I FNY EI I NI Sbjct: 100 VRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLF-------IAFNYSSRDEISRAIKNIF 152 Query: 338 SD 339 D Sbjct: 153 QD 154 >gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 24.3 bits (51), Expect = 3.4, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 20/41 (48%) Query: 63 VCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNISH 103 + G I + H D+ KL G QIS + E +V ISH Sbjct: 73 ISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISH 113 >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 23.9 bits (50), Expect = 5.2, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 19/32 (59%) Query: 99 VNISHGDSNFYLQSFPESEFPSTKEEEYVYSF 130 +N+ D +F++ +++ P KEE+ +SF Sbjct: 1 MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSF 32 >gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Score = 23.5 bits (49), Expect = 5.5, Method: Compositional matrix adjust. Identities = 10/32 (31%), Positives = 20/32 (62%) Query: 274 RVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMG 305 R+ I+S+ + ++L ++SD +D PD+G Sbjct: 284 RMKILSNFKEGTIQLMVASDLAARGLDIPDVG 315 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 23.5 bits (49), Expect = 6.7, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 42 LEIKASGPEIEITGAIPASVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELG 96 LE+ G I+I+ IP S + SI S L + + KL D I+ ++ L Sbjct: 404 LELTRFGINIDISAGIPLSTTLHSSILTS---LLNAIFKLNDFMAIATLVKHPLA 455 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 23.1 bits (48), Expect = 9.2, Method: Compositional matrix adjust. Identities = 12/48 (25%), Positives = 25/48 (52%) Query: 334 DNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLM 381 D++ +E +D + +SNSSVF++ + + + D+ V + M Sbjct: 81 DDLEDEEGSEDSLDLASSASNSSVFLQKRKDSADRSTDDPVRMYLREM 128 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.134 0.374 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 234,103 Number of Sequences: 1233 Number of extensions: 9306 Number of successful extensions: 35 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 12 length of query: 385 length of database: 328,796 effective HSP length: 76 effective length of query: 309 effective length of database: 235,088 effective search space: 72642192 effective search space used: 72642192 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 39 (19.6 bits)